We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for 9-cis-Retinoic acid (BMDB02369)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2006-05-22 15:17:50
Update Date 2009-06-09 04:01:29
Accession Number BMDB02369
Common Name 9-cis-Retinoic acid
Description 9-cis-retinoic acid is an active retinoid that regulates expression of retinoid responsive genes, serving as ligand for two classes of ligand-dependent transcription factors, the retinoic acid receptors and retinoid X receptors. Retinoids (vitamin A and its analogs) are essential dietary substances that are needed by mammals for reproduction, normal embryogenesis, growth, vision, and maintaining normal cellular differentiation and the integrity of the immune system. Within cells, retinoids regulate gene transcription acting through ligand-dependent transcription factors, the retinoic acid receptors (RARs), and the retinoid X receptors (RXRs). All-trans-retinoic acid binds only to RARs with high affinity, whereas its 9-cis isomer binds with high affinity to both RARs and RXRs. The actions of all-trans- and 9-cis-retinoic acid in regulating cellular responses are distinct and not interchangeable. (PMID: 9115228)
Synonyms
  1. Tretinoin [usan:ban:inn]
  2. Aberel
  3. Tretinoina [inn-spanish]
  4. Atragen
  5. Avita
  6. Vesanoid
  7. 9-Retinoic acid
  8. B-retinoic acid
  9. Aberela [norway]
  10. All-trans-vitamin a acid
  11. All-trans-b-retinoic acid
  12. Tretinoino [inn-spanish]
  13. Renova
  14. Panretyn
  15. Alitretinoin [usan]
  16. Retin-a
  17. Panretin (TN)
  18. Tretinoin (TN)
  19. Retin a
  20. Epi-aberel
  21. A-acido (argentina)
  22. beta-retinoic acid
  23. Tretinoin/all-trans retinoic acid
  24. Avitoin [norway]
  25. Effederm [france]
  26. Panretin gel
  27. all-trans- Vitamin A1 acid
  28. Trans-retinoic acid
  29. Eudyna
  30. Tretinoinum [inn-latin]
  31. Retin-a micro
  32. Dermairol
  33. Retinoate
  34. 9-cis-Tretinoin
  35. Tretinoine [inn-french]
  36. Tretinon
  37. Airol
  38. trans-Vitamin a acid
  39. 15-Apo-beta-caroten-15-oic acid
  40. Alitretinoin (usan)
  41. Effederm
  42. Retinova
  43. Isotretinoin retinoic acid
  44. Alitretinoin
  45. Panrexin
  46. All-trans-beta-retinoic acid
  47. Retacnyl
  48. acide retinoique (french) (DSL)
  49. Aknoten
  50. 9-cis-Retinoic acid
  51. Tretinoin
  52. Vesnaroid
  53. Panretin
  54. Tretinoin (jan/usp)
  55. Tretinoine (french) (einecs)
  56. Retin a (TN)
  57. alpha-acido (argentina)
  58. alpha-vitaminsyre [denmark]
  59. 9-Retinoate
  60. B-retinoate
  61. All-trans-b-retinoate
  62. beta-retinoate
  63. Tretinoin/all-trans retinoate
  64. Trans-retinoate
  65. Retinoic acid
  66. 15-Apo-beta-caroten-15-oate
  67. Isotretinoin retinoate
  68. All-trans-beta-retinoate
  69. 9-cis-Retinoate
Chemical IUPAC Name 3,7-dimethyl-9-(2,6,6-trimethyl-1-cyclohexenyl)nona-2,4,6,8-t
Chemical Formula C20H28O2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Miscellaneous
Class
  • Retinoids
Sub Class
  • Carotenoids
Family
  • Mammalian_Metabolite
Species
  • carboxylic acid; alkene
Biofunction
Application
Source
  • Endogenous
Average Molecular Weight 300.435
Monoisotopic Molecular Weight 300.208923
Isomeric SMILES CC(C=CC1=C(C)CCCC1(C)C)=CC=CC(C)=CC(O)=O
Canonical SMILES CC(C=CC1=C(C)CCCC1(C)C)=CC=CC(C)=CC(O)=O
KEGG Compound ID C15493 Link Image
BioCyc ID Not Available
BiGG ID Not Available
Wikipedia Link Avita Link Image
METLIN ID Not Available
PubChem Compound 444795 Link Image
PubChem Substance 855632 Link Image
ChEBI ID Not Available
CAS Registry Number Not Available
InChI Identifier InChI=1/C20H28O2/c1-15(8-6-9-16(2)14-19(21)22)11-12-18-17(3)10-7-13-20(18,4)5/h6,8-9,11-12,14H,7,10,13H2,1-5H3,(H,21,22)/b9-6+,12-11+,15-8-,16-14+
Synthesis Reference Not Available
Melting Point (Experimental) Not Available
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 4.77e-03 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -1
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity 5.66 [Predicted by ALOGPS]; 4.2 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS) Not Available
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location Not Available
Biofluid Location Not Available
Tissue Location Not Available
Concentrations (Normal) Not Available
Concentrations (Abnormal) Not Available
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Prostaglandin-H2 D-isomerase
  2. Retinal dehydrogenase 1
  3. Polycomb group RING finger protein 1
  4. Retinoic acid receptor responder (Tazarotene induced) 1
  5. Retinoic acid receptor beta
  6. Retinoic acid receptor responder protein 2
  7. Retinoic acid receptor, alpha
  8. RARG protein
  9. Peroxisome proliferator-activated receptor gamma
  10. Fatty acid-binding protein, adipocyte
  11. Cellular retinoic acid-binding protein 1
  12. LOC100138545 protein
  13. Retinoic acid receptor RXR-gamma
  14. Cellular retinoic acid-binding protein 2
Enzyme 1 [top]
Enzyme 1 ID 102
Enzyme 1 Name Prostaglandin-H2 D-isomerase
Enzyme 1 Synonyms
  1. Lipocalin-type prostaglandin-D synthase
  2. Glutathione-independent PGD synthetase
  3. Prostaglandin-D2 synthase
  4. PGD2 synthase
  5. PGDS2
  6. PGDS
Enzyme 1 Gene Name PTGDS
Enzyme 1 Protein Sequence >Prostaglandin-H2 D-isomerase
MATPNRLWMALLLLGVLGVLQTPAPAQAALQPNFEEDKFLGRWFTSGLASNSSWFLEKKK
VLSMCKSVVAPAADGGLNLTSTFLRKDQCETRTLLLRPAGPPGCYSYTSPHWSSTHEVSV
AETDYETYALLYTEGVRGPGQDFRMATLYSRSQNPRAEVKEHFTTFAKSLGFTEEGIVFL
PKTDKCMEEHP
Enzyme 1 Number of Residues 191
Enzyme 1 Molecular Weight 21229.0
Enzyme 1 Theoretical pI 6.92
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Involved in prostaglandin-D synthase activity
Enzyme 1 Specific Function Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NREM sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophopic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • 1-28
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 2196434 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID O02853 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name PTGDS_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >576 bp
ATGGCCACTCCGAATAGGCTGTGGATGGCGCTGCTCCTGCTGGGGGTCCTGGGGGTCCTG
CAGACCCCAGCCCCCGCCCAGGCCGCCCTGCAGCCCAACTTCGAAGAGGACAAGTTTCTG
GGGCGCTGGTTCACCTCCGGCCTTGCCTCCAACTCGAGCTGGTTCCTGGAGAAGAAGAAG
GTGCTGTCCATGTGCAAGTCTGTGGTGGCCCCCGCGGCGGACGGCGGCCTCAACCTCACC
TCTACCTTCCTCAGGAAAGACCAGTGTGAGACGCGGACCTTACTGCTGCGCCCCGCCGGC
CCCCCAGGCTGCTACAGCTACACCAGCCCTCACTGGAGCAGCACCCACGAGGTGTCAGTG
GCAGAGACAGACTACGAGACCTACGCCCTGCTCTACACAGAGGGTGTCCGAGGCCCGGGG
CAGGACTTCCGCATGGCCACGCTCTACAGCCGCTCCCAGAACCCCCGAGCCGAGGTCAAG
GAACACTTCACCACCTTTGCCAAGAGCCTGGGCTTCACAGAGGAAGGCATTGTGTTCCTG
CCGAAGACTGACAAGTGCATGGAGGAGCACCCATAG
Enzyme 1 GenBank Gene ID AB004647 Link Image
Enzyme 1 GeneCard ID PTGDS Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:9
Enzyme 1 Locus 9q34.2-q34.3
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 601
Enzyme 2 Name Retinal dehydrogenase 1
Enzyme 2 Synonyms
  1. RALDH 1
  2. RalDH1
  3. Aldehyde dehydrogenase family 1 member A1
  4. Aldehyde dehydrogenase, cytosolic
  5. ALHDII
  6. ALDH-E1
Enzyme 2 Gene Name ALDH1A1
Enzyme 2 Protein Sequence >Retinal dehydrogenase 1
MSSSAMPDVPAPLTNLQFKYTKIFINNEWHSSVSGKKFPVFNPATEEKLCEVEEGDKEDV
DKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLIERDHLLLATMEAMNGGKLFSNAYL
MDLGGCIKTLRYCAGWADKIQGRTIPMDGNFFTYTRSEPVGVCGQIIPWNFPLLMFLWKI
GPALSCGNTVVVKPAEQTPLTALHMGSLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVD
KVAFTGSTEVGKLIKEAAGKSNLKRVSLELGGKSPCIVFADADLDNAVEFAHQGVFYHQG
QCCIAASRLFVEESIYDEFVRRSVERAKKYVLGNPLTPGVSQGPQIDKEQYEKILDLIES
GKKEGAKLECGGGPWGNKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTFYGLSAGIFTNDIDKAITVSSALQSGTVWVNCYSVVSAQCPFGGFKMSGNGRELGE
YGFHEYTEVKTVTIKISQKNS
Enzyme 2 Number of Residues 501
Enzyme 2 Molecular Weight 54805.4
Enzyme 2 Theoretical pI 6.62
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Energy production and conversion
Enzyme 2 Specific Function Binds free retinal and cellular retinol-binding protein- bound retinal. Can convert/oxidize retinaldehyde to retinoic acid
Enzyme 2 Pathways
  • Cofactor metabolism
  • retinol metabolism
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 537498 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID P48644 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name AL1A1_BOVIN Link Image
Enzyme 2 PDB ID 1BXS Link Image
Enzyme 2 PDB File Show
Enzyme 2 3D Structure
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1506 bp
ATGTCGTCCTCAGCCATGCCAGACGTACCTGCCCCACTCACCAATTTGCAGTTTAAATAT
ACTAAGATCTTCATAAACAATGAATGGCATAGTTCAGTGAGTGGTAAGAAATTTCCAGTC
TTTAATCCTGCAACTGAGGAGAAACTCTGTGAGGTGGAAGAAGGAGATAAGGAGGATGTT
GACAAAGCAGTGAAGGCTGTAAGACAAGCTTTTCAGATTGGCTCTCCATGGCGTACTATG
GATGCTTCAGAGAGAGGACGGCTGTTAAACAAGTTGGCTGACTTAATTGAAAGAGATCAT
CTGCTCCTGGCGACAATGGAGGCAATGAATGGTGGAAAACTATTTTCCAATGCATATCTG
ATGGATTTAGGAGGCTGCATAAAAACACTACGCTACTGTGCAGGCTGGGCTGACAAGATC
CAGGGCCGCACAATACCCATGGATGGAAACTTTTTTACATATACAAGAAGTGAGCCTGTT
GGTGTGTGTGGCCAAATCATTCCTTGGAATTTCCCATTGCTCATGTTCCTCTGGAAGATA
GGGCCTGCCCTTAGCTGCGGAAACACAGTGGTTGTCAAACCAGCAGAGCAAACCCCTCTG
ACTGCTCTTCACATGGGATCTTTAATAAAAGAGGCAGGGTTTCCTCCTGGAGTAGTGAAT
ATTGTCCCTGGTTATGGGCCTACTGCAGGGGCAGCCATTTCTTCTCACATGGATGTAGAC
AAAGTGGCCTTCACAGGATCGACAGAGGTTGGCAAACTGATCAAAGAAGCTGCTGGGAAA
AGCAATCTGAAAAGGGTGTCCCTGGAACTCGGGGGAAAGAGTCCTTGCATTGTGTTTGCT
GATGCCGACTTGGACAATGCTGTTGAATTTGCACACCAAGGAGTATTCTATCACCAGGGC
CAGTGTTGTATAGCTGCATCCCGTCTCTTTGTAGAAGAATCAATTTACGATGAGTTTGTT
CGAAGGAGTGTTGAGCGGGCGAAAAAGTATGTTCTTGGAAATCCTCTGACCCCAGGAGTC
AGTCAAGGCCCTCAGATTGATAAAGAACAATATGAAAAAATACTTGACCTCATTGAAAGT
GGGAAGAAGGAGGGGGCCAAGCTGGAATGTGGCGGAGGCCCTTGGGGGAATAAAGGCTAC
TTTATCCAACCCACAGTTTTCTCTGATGTTACTGATGATATGCGCATTGCCAAAGAGGAG
ATATTTGGACCTGTGCAGCAAATCATGAAGTTTAAGTCTTTAGATGATGTAATCAAGAGA
GCAAACAATACTTTCTATGGGTTATCTGCAGGAATATTTACCAATGATATTGATAAAGCC
ATCACAGTCTCCTCTGCTTTGCAGTCTGGAACCGTGTGGGTGAACTGCTATAGTGTGGTA
TCTGCCCAGTGCCCCTTTGGTGGATTCAAGATGTCTGGAAATGGTCGAGAACTGGGAGAA
TATGGTTTCCATGAATACACAGAAGTCAAGACGGTCACAATCAAAATTTCTCAGAAGAAC
TCATAA
Enzyme 2 GenBank Gene ID L36128 Link Image
Enzyme 2 GeneCard ID ALDH1A1 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:9
Enzyme 2 Locus 9q21.13
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 1877
Enzyme 3 Name Polycomb group RING finger protein 1
Enzyme 3 Synonyms Not Available
Enzyme 3 Gene Name PCGF1
Enzyme 3 Protein Sequence >Polycomb group RING finger protein 1
MASPQGGQIAIAMRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTI
TECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNHKLDRVMQDIVYKLVPGLQDSEE
KRIREFYQSRGLDRVTQPSGEEPALSNLGLPFSSFDHSKAHYYRYDEQLSLCLERLSSGK
DKNKSILQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSH
WFGKPSPLLLQYSVKEKRR
Enzyme 3 Number of Residues 259
Enzyme 3 Molecular Weight 30324.0
Enzyme 3 Theoretical pI 8.98
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Transcription
Enzyme 3 Specific Function Component of the Polycomb group (PcG) multiprotein BCOR complex, a complex required to maintain the transcriptionally repressive state of some genes, such as BCL6 and the cyclin- dependent kinase inhibitor, CDKN1A. Transcriptional repressor that may be targeted to the DNA by BCL6; this transcription repressor activity may be related to PKC signaling pathway. Represses CDKN1A expression by binding to its promoter, and this repression is dependent on the retinoic acid response element (RARE element). Promotes cell cycle progression and enhances cell proliferation as well. May have a positive role in tumor cell growth by down- regulating CDKN1A
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 82571652 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q2YDF9 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name PCGF1_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >744 bp
ATGAGGCTTCGGAACCAGCTCCAGTCAGTGTACAAGATGGACCCACTACGGAACGAGGAG
GAAGTACGAGTAAAGATCAAAGACTTGAACGAGCACATCGTCTGCTGCCTGTGCGCTGGC
TACTTCGTAGATGCCACCACCATAACAGAGTGTCTTCATACGTTCTGCAAGAGTTGTATT
GTGAAGTACCTCCAAACCAGCAAGTACTGCCCCATGTGTAACATCAAGATCCATGAAACA
CAACCACTGCTCAACCACAAACTGGACCGGGTCATGCAGGACATCGTGTACAAACTAGTG
CCAGGCTTGCAAGACAGTGAAGAGAAACGCATCCGAGAATTCTACCAGTCCCGAGGCTTG
GACCGGGTCACCCAGCCCAGTGGGGAAGAGCCAGCCCTGAGCAACCTTGGCCTCCCCTTC
AGCAGCTTCGACCACTCAAAAGCCCACTACTATCGCTATGATGAGCAGCTGAGCCTATGC
CTGGAGCGGCTGAGTTCTGGCAAAGACAAGAATAAAAGCATACTGCAGAACAAATATGTC
CGGTGTTCTGTTAGAGCTGAAGTTCGTCATCTCCGGAGGGTCCTGTGTCATCGCTTGATG
CTAAATCCCCAGCATGTGCAGCTCCTTTTTGACAATGAAGTTCTCCCTGATCACATGACC
ATGAAGCAGATATGGCTGTCCCACTGGTTCGGCAAACCATCCCCTTTGCTTTTACAATAC
AGCGTGAAAGAGAAGAGGAGGTAG
Enzyme 3 GenBank Gene ID BC110242 Link Image
Enzyme 3 GeneCard ID PCGF1 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:2
Enzyme 3 Locus 2p13.1
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 1878
Enzyme 4 Name Retinoic acid receptor responder (Tazarotene induced) 1
Enzyme 4 Synonyms Not Available
Enzyme 4 Gene Name RARRES1
Enzyme 4 Protein Sequence >Retinoic acid receptor responder (Tazarotene induced) 1
MQLRRQPLSAPRPGDTRPAAQRLAVPLLLLLALQGAAASGGPEDSGWLQDAEPSSRLLSQ
AARAALHFFNFRAASPSALQVLANVLDGRSWVNQKKEYKFDLVFTTEFYSAEEGEKRLGK
CSAQVFFRNEKPRPAVNVTCTQLVKKERRQEEDYQLYKLMKQLKSPLNAVSIPDSHGYIA
PSLRPIWDLAFLGSSYVMWQKSTPFLHYYMSQISSVKQWKTNDDAIDFDYTVLLHEFSTQ
EIIPCRIHLVWYPSKPLKVKYHCQERQTPEEASGTEEGSAVALTELSNF
Enzyme 4 Number of Residues 289
Enzyme 4 Molecular Weight 32771.0
Enzyme 4 Theoretical pI 8.57
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in receptor activity
Enzyme 4 Specific Function Not Available
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 112362395 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q0P5D6 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name Q0P5D6_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >870 bp
ATGCAGCTCCGCAGGCAACCGCTTTCCGCTCCCCGGCCGGGGGACACGCGCCCCGCAGCC
CAGCGGCTCGCGGTTCCGCTGCTACTGCTGCTCGCCCTCCAGGGGGCGGCGGCGTCCGGG
GGCCCCGAGGACTCCGGGTGGCTCCAGGACGCGGAGCCCTCGAGCCGGCTCCTCTCGCAG
GCGGCGCGCGCGGCGCTGCACTTCTTCAACTTCCGCGCCGCCTCGCCCAGCGCCCTTCAG
GTGCTGGCGAATGTGCTGGACGGCCGCTCGTGGGTTAATCAGAAGAAGGAATATAAATTT
GACCTGGTGTTTACCACAGAATTCTACAGTGCAGAGGAAGGTGAGAAACGTCTGGGAAAA
TGTTCTGCTCAAGTATTTTTCAGGAATGAGAAACCCAGACCAGCCGTTAATGTGACATGT
ACTCAGCTCGTTAAGAAGGAGAGGAGACAGGAAGAGGATTACCAGCTCTACAAGCTCATG
AAGCAACTTAAAAGCCCCTTGAATGCAGTCAGCATTCCTGACAGTCATGGATATATTGCT
CCATCTCTGAGACCCATCTGGGACCTAGCTTTTCTGGGCAGCTCTTATGTGATGTGGCAG
AAGTCAACACCGTTTCTACACTACTACATGTCACAGATTAGCAGTGTCAAGCAGTGGAAA
ACAAATGATGATGCAATTGATTTTGATTATACTGTTCTACTCCATGAATTCTCAACACAG
GAAATTATCCCCTGCCGTATTCACTTGGTCTGGTACCCCAGCAAACCACTGAAAGTGAAG
TACCACTGCCAAGAGCGACAGACACCAGAAGAGGCCTCTGGAACTGAAGAAGGATCGGCT
GTGGCACTGACGGAGCTTAGTAATTTCTGA
Enzyme 4 GenBank Gene ID BC120187 Link Image
Enzyme 4 GeneCard ID RARRES1 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:3
Enzyme 4 Locus 3q25.32-q25.33
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References Not Available
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 1879
Enzyme 5 Name Retinoic acid receptor beta
Enzyme 5 Synonyms Not Available
Enzyme 5 Gene Name Not Available
Enzyme 5 Protein Sequence >Retinoic acid receptor beta
CLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFAGQLLPLEMDDA
ETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEA
Enzyme 5 Number of Residues 94
Enzyme 5 Molecular Weight 10458.9
Enzyme 5 Theoretical pI 3.91
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Involved in retinoic acid receptor activity
Enzyme 5 Specific Function Not Available
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 71034226 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID Q45UD6 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name Q45UD6_BOVIN Link Image
Enzyme 5 PDB ID 1XDK Link Image
Enzyme 5 PDB File Show
Enzyme 5 3D Structure
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence Not Available
Enzyme 5 GenBank Gene ID DQ114538 Link Image
Enzyme 5 GeneCard ID Not Available
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Not Available
Enzyme 5 Locus Not Available
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References
  1. [PubMed Link Image]
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 1880
Enzyme 6 Name Retinoic acid receptor responder protein 2
Enzyme 6 Synonyms Not Available
Enzyme 6 Gene Name RARRES2
Enzyme 6 Protein Sequence >Retinoic acid receptor responder protein 2
MWQLLLPLALGLGTMGLGRAELTTAQHRGLQVALEEFHKHPPVLWAFQVTSVDNAADTLF
PAGQFVRLEFKLQQTSCRKKDWRKEDCKVKPNGRKRKCLACIKLDSKDQVLGRMVHCPIQ
TQVQRELDDAQDAQCSRVERAGEDPHSYYLPGQFAFIKALSP
Enzyme 6 Number of Residues 162
Enzyme 6 Molecular Weight 18357.1
Enzyme 6 Theoretical pI 8.85
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Not Available
Enzyme 6 Specific Function Not Available
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function Not Available
Enzyme 6 Signals
  • 1-20
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 88954105 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID Q29RS5 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name RARR2_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >489 bp
ATGTGGCAGCTACTGCTCCCCCTGGCCCTGGGGCTGGGCACCATGGGCTTGGGCAGGGCG
GAGCTCACGACGGCCCAGCACCGGGGCCTGCAGGTGGCCCTGGAGGAGTTCCACAAGCAT
CCACCCGTGCTGTGGGCCTTCCAGGTGACCAGCGTGGACAATGCGGCAGACACGCTCTTC
CCGGCTGGGCAGTTTGTGAGGCTGGAGTTCAAGCTCCAGCAGACGAGCTGTCGGAAGAAA
GACTGGAGGAAAGAAGACTGCAAAGTCAAGCCCAACGGGAGAAAGCGGAAATGCCTGGCC
TGCATCAAGCTGGACTCAAAAGATCAAGTCCTGGGCCGGATGGTGCACTGTCCCATACAG
ACTCAGGTTCAACGGGAGCTGGACGACGCCCAGGACGCCCAGTGCAGCAGGGTGGAGCGC
GCCGGCGAGGACCCCCACAGCTACTACCTCCCCGGACAGTTTGCCTTCATCAAAGCCTTG
TCCCCCTGA
Enzyme 6 GenBank Gene ID BC114047 Link Image
Enzyme 6 GeneCard ID RARRES2 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:7
Enzyme 6 Locus 7q36.1
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References Not Available
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 1881
Enzyme 7 Name Retinoic acid receptor, alpha
Enzyme 7 Synonyms Not Available
Enzyme 7 Gene Name RARA
Enzyme 7 Protein Sequence >Retinoic acid receptor, alpha
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILVRVCTLPA
Enzyme 7 Number of Residues 277
Enzyme 7 Molecular Weight 30654.0
Enzyme 7 Theoretical pI 8.57
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Involved in retinoic acid receptor activity
Enzyme 7 Specific Function Not Available
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • None
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 61553931 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q58DG3 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name Q58DG3_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >834 bp
ATGGCCAGCAACAGCAGCTCCTGCCCAACACCTGGGGGAGGGCACCTCAATGGGTACCCG
GTGCCCCCCTACGCCTTCTTCTTCCCCCCCATGCTGGGTGGACTCTCCCCGCCAGGCGCT
CTGACCACTCTCCAGCACCAGCTTCCAGTGAGCGGCTATAGCACGCCATCCCCAGCCACC
ATTGAGACCCAGAGCAGCAGTTCTGAAGAGATTGTGCCCAGCCCCCCCTCGCCACCTCCC
CTCCCCCGCATCTACAAGCCTTGCTTTGTCTGTCAAGACAAATCCTCCGGCTACCACTAT
GGGGTCAGCGCCTGTGAAGGCTGCAAGGGCTTCTTCCGCCGCAGCATCCAGAAGAACATG
GTGTACACGTGTCACCGGGACAAGAACTGCATCATCAACAAGGTGACCCGGAACCGTTGC
CAGTACTGCCGGCTGCAGAAGTGCTTCGAAGTGGGCATGTCCAAGGAGTCTGTGAGAAAT
GACCGGAACAAGAAGAAGAAGGAGGTGCCCAAGCCCGAGTGCTCCGAGAGCTACACGTTG
ACGCCGGAGGTGGGGGAGCTCATCGAGAAGGTGCGCAAAGCGCATCAGGAGACCTTCCCT
GCTCTCTGCCAACTGGGCAAATACACTACGAACAACAGCTCAGAACAGCGTGTCTCTCTG
GACATTGACCTCTGGGACAAGTTCAGTGAACTCTCCACCAAGTGCATCATTAAGACTGTG
GAGTTCGCCAAGCAACTGCCCGGCTTCACCACCCTCACCATTGCGGACCAGATCACCCTC
CTTAAGGCTGCCTGCCTGGATATCCTGGTGAGGGTCTGCACCTTGCCCGCCTAG
Enzyme 7 GenBank Gene ID BT021634 Link Image
Enzyme 7 GeneCard ID RARA Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:1
Enzyme 7 Locus 17q21
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References
  1. [PubMed Link Image]
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 1882
Enzyme 8 Name RARG protein
Enzyme 8 Synonyms Not Available
Enzyme 8 Gene Name RARG
Enzyme 8 Protein Sequence >RARG protein
MATNKERLFVPGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSLDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE
MFEDDSSQPGPHPKASSEDEVPGGQGRGGRSPHPDQGL
Enzyme 8 Number of Residues 458
Enzyme 8 Molecular Weight 50945.1
Enzyme 8 Theoretical pI 7.54
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Involved in retinoic acid receptor activity
Enzyme 8 Specific Function Not Available
Enzyme 8 Pathways Not Available
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • None
Enzyme 8 Transmembrane Regions
  • None
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 158455128 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID Q08DD4 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name Q08DD4_BOVIN Link Image
Enzyme 8 PDB ID 4LBD Link Image
Enzyme 8 PDB File Show
Enzyme 8 3D Structure
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence >1377 bp
ATGGCCACCAATAAGGAGCGACTCTTTGTGCCTGGTGCCCTGGGTCCTGGCTCTGGCTAC
CCAGGGGCTGGCTTCCCCTTCGCCTTCCCAGGGGCACTCAGGGGGTCTCCACCTTTCGAG
ATGCTGAGCCCTAGCTTCCGGGGCTTGGGCCAGCCTGACCTCCCCAAGGAGATGGCCTCT
CTGTCGGTGGAGACACAGAGCACTAGCTCAGAGGAGATGGTGCCAAGCTCGCCCTCGCCC
CCTCCACCTCCCCGGGTGTACAAGCCGTGCTTCGTGTGCAATGACAAGTCCTCTGGCTAC
CACTATGGGGTCAGCTCTTGTGAAGGCTGCAAGGGCTTCTTCCGTCGCAGCATCCAGAAG
AACATGGTGTACACATGTCACCGCGACAAAAACTGTATCATCAACAAGGTGACCCGGAAT
CGTTGCCAGTACTGCCGGCTACAGAAATGCTTTGAAGTTGGCATGTCCAAGGAAGCCGTA
CGGAATGATCGCAACAAGAAGAAGAAAGAGGTGAAGGAAGAAGGGTCGCTTGACAGCTAT
GAGCTGAGCCCCCAGTTAGAAGAGCTCATCACCAAGGTCAGCAAGGCCCATCAGGAGACC
TTCCCCTCGCTCTGCCAGCTGGGCAAGTACACCACGAACTCCAGTGCAGACCACCGGGTG
CAGCTGGATCTGGGGCTGTGGGACAAGTTCAGCGAGCTGGCCACCAAGTGCATCATCAAG
ATCGTGGAGTTTGCCAAGCGGTTACCTGGCTTCACCGGTCTCAGCATTGCTGACCAGATC
ACTCTGCTCAAGGCCGCCTGCCTGGACATCCTGATGCTGCGGATCTGCACAAGGTACACC
CCAGAGCAGGACACTATGACGTTCTCCGATGGGCTGACCCTAAACCGGACTCAGATGCAC
AACGCCGGCTTCGGGCCCCTCACAGACCTCGTCTTTGCCTTCGCTGGGCAGCTCCTGCCG
CTGGAGATGGACGACACAGAGACAGGCCTGCTCAGCGCCATCTGCCTCATCTGCGGAGAC
CGCATGGACCTGGAGGAGCCTGAGAAAGTGGACAAGCTGCAGGAACCGCTGCTTGAAGCC
CTGAGGCTCTATGCCCGGCGCCGGCGGCCCAGTCAGCCCTATATGTTCCCCAGGATGCTC
ATGAAGATCACTGACCTCCGGGGCATCAGCACCAAGGGAGCAGAAAGGGCCATTACCCTG
AAGATGGAGATTCCAGGCCCGATGCCTCCCCTGATCCGAGAAATGCTGGAGAACCCCGAA
ATGTTTGAGGACGACTCCTCGCAGCCTGGCCCTCACCCCAAGGCCTCCAGCGAGGATGAG
GTTCCCGGGGGCCAGGGCAGAGGGGGCCGCAGCCCCCATCCTGACCAGGGTCTCTGA
Enzyme 8 GenBank Gene ID BC123809 Link Image
Enzyme 8 GeneCard ID RARG Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:1
Enzyme 8 Locus 12q13
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References Not Available
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 1883
Enzyme 9 Name Peroxisome proliferator-activated receptor gamma
Enzyme 9 Synonyms
  1. PPAR-gamma
  2. Nuclear receptor subfamily 1 group C member 3
Enzyme 9 Gene Name PPARG
Enzyme 9 Protein Sequence >Peroxisome proliferator-activated receptor gamma
MGETLGDALIDPESEPFAVTVSARTSQEITMVDTEMPFWPTNFGISSVDLSMMDDHSHAF
DIKPFTTVDFSSISTPHYEDIPFPRADPMVADYKYDLKLQEYQSAIKVEPVSPPYYSEKT
QLYSKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHISPLQE
PSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
Enzyme 9 Number of Residues 505
Enzyme 9 Molecular Weight 57578.8
Enzyme 9 Theoretical pI 6.04
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Involved in protein binding
Enzyme 9 Specific Function Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the receptor binds to a promoter element in the gene for acyl-CoA oxidase and activates its transcription. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis
Enzyme 9 Pathways Not Available
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • None
Enzyme 9 Transmembrane Regions
  • None
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 2653406 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID O18971 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name PPARG_BOVIN Link Image
Enzyme 9 PDB ID 1I7I Link Image
Enzyme 9 PDB File Show
Enzyme 9 3D Structure
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence >1518 bp
ATGGGTGAAACTCTGGGAGATGCTCTTATTGACCCAGAGAGTGAGCCCTTCGCTGTCACA
GTGTCTGCAAGGACCTCACAAGAAATTACCATGGTTGACACAGAGATGCCGTTTTGGCCC
ACCAACTTTGGGATCAGCTCCGTGGACCTTTCTATGATGGATGACCACTCCCATGCCTTT
GACATCAAGCCCTTCACCACCGTTGACTTCTCCAGCATTTCCACTCCGCACTATGAGGAC
ATTCCGTTCCCAAGAGCTGACCCGATGGTTGCAGATTATAAGTATGACCTGAAGCTCCAA
GAGTACCAAAGTGCAATCAAAGTGGAGCCTGTATCCCCACCTTATTATTCTGAAAAGACT
CAGCTGTACAGTAAGCCTCATGAAGAGCCTTCCAACTCCCTCATGGCCATTGAATGCCGG
GTCTGTGGGGATAAAGCGTCAGGGTTCCACTATGGAGTTCATGCTTGTGAAGGATGCAAG
GGTTTCTTCCGGAGGACAATCAGATTGAAACTTATTTACGATAGGTGTGATCTTAACTGT
CGGATCCACAAGAAAAGTAGAAATAAATGTCAGTACTGTCGGTTTCAGAAGTGCCTTGCT
GTGGGGATGTCTCATAATGCCATCAGGTTTGGGCGCATGCCACAGGCCGAGAAGGAGAAG
CTGTTAGCGGAGATCTCCAGCGATATCGACCAACTGAACCCAGAGTCTGCTGACCTCCGG
GCCCTGGCAAAGCATTTGTATGACTCGTACATAAAGTCCTTCCCGCTGACCAAAGCAAAG
GCGAGGGCGATCTTGACGGGAAAGACGACAGACAAATCACCGTTTGTTATCTATGACATG
AACTCCTTAATGATGGGAGAAGATAAAATCAAGTTCAAGCACATCAGTCCCCTGCAGGAG
CCCAGCAAAGAGGTGGCCATCCGCATCTTCCAGGGGTGTCAGTTTCGCTCCGTGGAAGCC
GTGCAGGAGATCACAGAGTACGCCAAGAATATCCCCGGCTTTGTGAACCTTGACTTGAAC
GACCAAGTAACTCTCCTAAAATACGGCGTGCACGAGATCATTTACACGATGCTGGCCTCC
TTGATGAATAAGGATGGGGTCCTCATATCCGAGGGCCAAGGATTCATGACAAGGGAGTTT
CTAAAGAGCCTGCGAAAGCCCTTTGGTGACTTTATGGAGCCCAAGTTCGAGTTTGCTGTG
AAGTTCAACGCACTGGAATTAGATGACAGCGACTTAGCAATATTTATAGCTGTCATTATT
CTCAGTGGAGACCGCCCAGGTTTGCTGAACGTGAAGCCCATTGAGGACATACAAGACAAT
CTGCTGCAAGCCTTGGAGCTGCAGCTCAAGCTGAACCACCCCGAGTCCTCCCAGCTCTTT
GCCAAGCTGCTCCAGAAAATGACAGACCTCAGACAGATTGTGACAGAACACGTGCAGCTG
TTGCAAGTAATAAAGAAAACAGAGACGGACATGAGTCTCCACCCACTCCTACAGGAAATC
TACAAGGACTTGTATTAG
Enzyme 9 GenBank Gene ID Y12420 Link Image
Enzyme 9 GeneCard ID PPARG Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Chromosome:3
Enzyme 9 Locus 3p25
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References
  1. [PubMed Link Image]
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 1884
Enzyme 10 Name Fatty acid-binding protein, adipocyte
Enzyme 10 Synonyms
  1. AFABP
  2. Fatty acid-binding protein 4
  3. Adipocyte lipid-binding protein
  4. ALBP
Enzyme 10 Gene Name FABP4
Enzyme 10 Protein Sequence >Fatty acid-binding protein, adipocyte
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPTLIISLNGGVVTIKSESTFKN
TEISFKLGQEFDEITPDDRKVKSIVNLDEGALVQVQNWDGKSTTIKRKLMDDKMVLECVM
NGVTATRVYERA
Enzyme 10 Number of Residues 132
Enzyme 10 Molecular Weight 14677.8
Enzyme 10 Theoretical pI 5.27
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Involved in lipid binding
Enzyme 10 Specific Function Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus
Enzyme 10 Pathways Not Available
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • None
Enzyme 10 Transmembrane Regions
  • None
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 895754 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID P48035 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name FABP4_BOVIN Link Image
Enzyme 10 PDB ID Not Available
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >399 bp
ATGTGTGATGCATTTGTAGGTACCTGGAAACTTGTCTCCAGTGAAAACTTTGATGATTAC
ATGAAAGAAGTGGGCGTGGGCTTTGCTACCAGGAAAGTGGCTGGCATGGCCAAACCCACT
TTGATCATCAGTTTGAATGGGGGTGTGGTCACCATTAAATCAGAAAGCACCTTTAAAAAT
ACTGAGATTTCCTTCAAATTGGGCCAGGAATTTGATGAAATCACTCCAGATGACAGGAAA
GTCAAGAGCATCGTAAACTTAGATGAAGGTGCTCTGGTACAAGTACAAAACTGGGATGGA
AAATCAACCACCATAAAGAGAAAACTCATGGATGATAAGATGGTGCTGGAATGTGTCATG
AATGGTGTCACTGCCACCAGAGTTTATGAGAGAGCATAA
Enzyme 10 GenBank Gene ID X89244 Link Image
Enzyme 10 GeneCard ID FABP4 Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:8
Enzyme 10 Locus 8q21
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References
  1. [PubMed Link Image]
Enzyme 10 Metabolite References Not Available
Enzyme 11 [top]
Enzyme 11 ID 1885
Enzyme 11 Name Cellular retinoic acid-binding protein 1
Enzyme 11 Synonyms
  1. Cellular retinoic acid-binding protein I
  2. CRABP-I
Enzyme 11 Gene Name CRABP1
Enzyme 11 Protein Sequence >Cellular retinoic acid-binding protein 1
MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVR
TTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLLEGDGPKTYWTRELANDELI
LTFGADDVVCTRIYVRE
Enzyme 11 Number of Residues 137
Enzyme 11 Molecular Weight 15591.5
Enzyme 11 Theoretical pI 5.03
Enzyme 11 GO Classification
Function
Process
Component
Enzyme 11 General Function Involved in retinal binding
Enzyme 11 Specific Function Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors
Enzyme 11 Pathways Not Available
Enzyme 11 Reactions Not Available
Enzyme 11 Pfam Domain Function
Enzyme 11 Signals
  • None
Enzyme 11 Transmembrane Regions
  • None
Enzyme 11 Essentiality Not Available
Enzyme 11 GenBank ID Protein 284 Link Image
Enzyme 11 UniProtKB/Swiss-Prot ID P62964 Link Image
Enzyme 11 UniProtKB/Swiss-Prot Entry Name RABP1_BOVIN Link Image
Enzyme 11 PDB ID 2CBR Link Image
Enzyme 11 PDB File Show
Enzyme 11 3D Structure
Enzyme 11 Cellular Location Not Available
Enzyme 11 Gene Sequence >414 bp
ATGCCCAACTTCGCTGGCACCTGGAAGATGCGCAGCAGCGAGAATTTCGACGAGCTGCTC
AAGGCGCTGGGTGTGAACGCCATGCTGAGGAAAGTGGCCGTGGCGGCTGCGTCCAAGCCG
CACGTGGAGATCCGCCAGGACGGGGACCAGTTCTACATCAAGACGTCCACCACGGTGCGC
ACGACCGAGATCAACTTCAAGGTCGGAGAAGGCTTTGAGGAGGAGACCGTGGACGGACGC
AAGTGCAGGAGCTTACCCACTTGGGAGAATGAGAACAAGATCCACTGCACACAAACTCTT
CTGGAGGGGGACGGCCCCAAAACCTACTGGACCCGCGAGCTGGCCAACGACGAACTCATC
CTGACGTTCGGCGCCGATGACGTGGTCTGCACGAGGATTTATGTTCGGGAATGA
Enzyme 11 GenBank Gene ID X07436 Link Image
Enzyme 11 GeneCard ID CRABP1 Link Image
Enzyme 11 GenAtlas ID Not Available
Enzyme 11 HGNC ID Not Available
Enzyme 11 Chromosome Location Chromosome:1
Enzyme 11 Locus 15q24
Enzyme 11 SNPs SNPJam Report Link Image
Enzyme 11 General References
  1. [PubMed Link Image]
Enzyme 11 Metabolite References Not Available
Enzyme 12 [top]
Enzyme 12 ID 1886
Enzyme 12 Name LOC100138545 protein
Enzyme 12 Synonyms Not Available
Enzyme 12 Gene Name LOC100138545
Enzyme 12 Protein Sequence >LOC100138545 protein
FSALEERNRIETALDSMQQDPEPAGSPGPQQDPALPHSPSMPPPESLSEGHQSSHSDSPT
EQATEEEFQFLRCQGCRAEAKCPKLLPCLHTLCSGCLEESSMQCPVCRAPWPSGAGTQAL
DNVFFESLQRRLSVYQQIAREQAFCTRCKEPAHYWCFECEQLICTKCFEAHQWFLKHEAR
PLAELRSQSVREFLDGTRKSNIIFCSNPNHRSPMLTSIYCRGCSKPLCCSCALLDRGHSE
LKCDISMEIQQRQDELDTMTQDLQEQDRTFGAAQAQMRSAISQLGRVRADTEEFIRERVR
EVVAHVLEQERELLQGVGARYQRDYEEIAGQLGRLDAVLQRIRMGSVLVQRMKLYASDQE
VLDMHDFLRKALHQLRQEEPQSLRATVHTDSFDEFRVRLQDLVSCITRGTDAALSRRASP
EAASTPRDTCGTDPPEEVPRDQMQASGLAVVQPVPGAHPVPVYAFSIQDPSLREEGTNTT
TPQKRKACQTECPRKAVKMESEEGEESRLAWSSPEQPRPSTSRAVSPPHLDGPPSPKSPI
VRDELSLPESNHQTGDPAETEERVVVISSSEDSDAENPRAEPTETAVLPPSSSVHPPLRA
RRASHSLQASRLSHGTCRPPAWPPHHPAEQAAIPDAESPSQPAGHQEQAAVHRGISFLSR
RAQRALRPRSTFHLPLKTYGAHTCTWPPSMGQATTLATTGPPSQPANPQEDPTHPQRAGS
QPRLVQLAARPLDPFPSVSQWLNIFPLPHSPGISQRNTFYRRIMGGGRASQIPGPVISFG
DSGRAPMENPPAQVPPEASPSAFLPPHPLERPPTGTDTPQTSL
Enzyme 12 Number of Residues 823
Enzyme 12 Molecular Weight 91117.2
Enzyme 12 Theoretical pI 6.33
Enzyme 12 GO Classification
Function
Process
Component
Enzyme 12 General Function Involved in SMAD binding
Enzyme 12 Specific Function Not Available
Enzyme 12 Pathways Not Available
Enzyme 12 Reactions Not Available
Enzyme 12 Pfam Domain Function
Enzyme 12 Signals
  • None
Enzyme 12 Transmembrane Regions
  • None
Enzyme 12 Essentiality Not Available
Enzyme 12 GenBank ID Protein 151555977 Link Image
Enzyme 12 UniProtKB/Swiss-Prot ID A6QQE3 Link Image
Enzyme 12 UniProtKB/Swiss-Prot Entry Name A6QQE3_BOVIN Link Image
Enzyme 12 PDB ID Not Available
Enzyme 12 Cellular Location Not Available
Enzyme 12 Gene Sequence Not Available
Enzyme 12 GenBank Gene ID BC149786 Link Image
Enzyme 12 GeneCard ID LOC100138545 Link Image
Enzyme 12 GenAtlas ID Not Available
Enzyme 12 HGNC ID Not Available
Enzyme 12 Chromosome Location Not Available
Enzyme 12 Locus Not Available
Enzyme 12 SNPs SNPJam Report Link Image
Enzyme 12 General References Not Available
Enzyme 12 Metabolite References Not Available
Enzyme 13 [top]
Enzyme 13 ID 1887
Enzyme 13 Name Retinoic acid receptor RXR-gamma
Enzyme 13 Synonyms
  1. Retinoid X receptor gamma
  2. Nuclear receptor subfamily 2 group B member 3
Enzyme 13 Gene Name RXRG
Enzyme 13 Protein Sequence >Retinoic acid receptor RXR-gamma
MYGNYSHFMKFPTGFGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSISEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECANSGHEDMPVERIL
EAELAVEPKTESYGDMNTENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQTT
Enzyme 13 Number of Residues 463
Enzyme 13 Molecular Weight 50881.7
Enzyme 13 Theoretical pI 7.67
Enzyme 13 GO Classification
Function
Process
Component
Enzyme 13 General Function Involved in steroid binding
Enzyme 13 Specific Function Nuclear hormone receptor. Involved in the retinoic acid response pathway. Binds 9-cis retinoic acid (9C-RA)
Enzyme 13 Pathways Not Available
Enzyme 13 Reactions Not Available
Enzyme 13 Pfam Domain Function
Enzyme 13 Signals
  • None
Enzyme 13 Transmembrane Regions
  • None
Enzyme 13 Essentiality Not Available
Enzyme 13 GenBank ID Protein 111305288 Link Image
Enzyme 13 UniProtKB/Swiss-Prot ID Q0VC20 Link Image
Enzyme 13 UniProtKB/Swiss-Prot Entry Name RXRG_BOVIN Link Image
Enzyme 13 PDB ID Not Available
Enzyme 13 Cellular Location Not Available
Enzyme 13 Gene Sequence >1392 bp
ATGTATGGAAATTATTCTCACTTCATGAAGTTTCCCACAGGCTTTGGAGGTTCTCCCGGC
CATACTGGCTCCACGTCCATGAGTCCATCGGCAGCCTTGTCCACAGGGAAGCCCATGGAC
AGCCACCCCAGCTACACCGACACCCCAGTGAGTGCCCCGCGAACTCTGAGTGCAGTGGGG
ACCCCCCTCAATGCCCTGGGCTCTCCATATCGAGTCATCACTTCTGCCATGGGCCCACCC
TCGGGAGCACTGGCAGCCCCTCCAGGAATCAATCTGGTTGCCCCGCCTAGCTCTCAGCTA
AATGTGGTCAACAGTGTCAGCATTTCAGAGGACATCAAGCCCTTACCAGGGCTTCCTGGC
ATTGGAAACATGAACTACCCATCCACCAGCCCGGGATCTCTGGTTAAGCACATCTGTGCC
ATCTGTGGGGACAGATCCTCAGGAAAGCACTACGGTGTGTACAGTTGTGAAGGCTGCAAA
GGGTTCTTCAAGAGAACCATAAGGAAAGACCTCATCTACACTTGTCGGGATAACAAAGAC
TGCCTCATTGACAAGCGCCAGCGCAACCGCTGTCAGTACTGCCGCTATCAGAAGTGCCTG
GTCATGGGCATGAAGAGGGAAGCTGTGCAGGAAGAAAGGCAGAGAAGCCGGGAGCGGGCT
GAAAGTGAGGCAGAGTGTGCCAACAGTGGCCATGAAGATATGCCCGTGGAGAGGATTCTG
GAAGCTGAACTTGCTGTTGAACCAAAGACAGAATCCTATGGTGACATGAACACGGAGAAT
TCGACTAATGACCCTGTCACCAATATATGCCACGCTGCTGATAAGCAGCTTTTTACTCTC
GTTGAATGGGCCAAGCGTATTCCCCACTTTTCTGACCTCACCTTGGAGGACCAAGTCATT
CTGCTCCGGGCAGGGTGGAATGAGCTGCTGATCGCCTCCTTTTCCCATCGCTCGGTTTCT
GTGCAGGATGGCATCCTTCTGGCCACGGGATTACACGTCCACCGAAGCAGTGCCCACAGC
GCTGGGGTTGGCTCCATCTTTGACAGAGTTCTGACTGAGCTGGTCTCCAAAATGAAGGAC
ATGCAGATGGATAAGTCAGAGCTGGGGTGCCTGCGAGCCATCGTGCTGTTTAACCCAGAT
GCCAAGGGTCTCTCCAACCCGTCTGAGGTAGAGACTCTACGAGAGAAGGTCTATGCCACC
CTTGAGGCCTACACCAAGCAAAAGTATCCAGAACAACCAGGCAGGTTTGCCAAGCTGCTG
CTGCGCCTCCCAGCCCTGCGTTCTATCGGCTTGAAGTGCCTGGAGCACCTTTTCTTCTTC
AAGCTCATCGGGGACACACCCATTGACACCTTCCTCATGGAGATGTTGGAGACCCCACTG
CAGACCACCTGA
Enzyme 13 GenBank Gene ID BC120391 Link Image
Enzyme 13 GeneCard ID RXRG Link Image
Enzyme 13 GenAtlas ID Not Available
Enzyme 13 HGNC ID Not Available
Enzyme 13 Chromosome Location Chromosome:1
Enzyme 13 Locus 1q22-q23
Enzyme 13 SNPs SNPJam Report Link Image
Enzyme 13 General References Not Available
Enzyme 13 Metabolite References Not Available
Enzyme 14 [top]
Enzyme 14 ID 1888
Enzyme 14 Name Cellular retinoic acid-binding protein 2
Enzyme 14 Synonyms
  1. Cellular retinoic acid-binding protein II
  2. CRABP-II
Enzyme 14 Gene Name CRABP2
Enzyme 14 Protein Sequence >Cellular retinoic acid-binding protein 2
MPNFSGNWKIIRSENFEDLLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVR
TTEINFKIGEEFEEQTVDGRPCKSLVKWESENKMVCEQRLLKGEGPKTSWTRELTNDGEL
ILTMTADDIVCTRVYVRE
Enzyme 14 Number of Residues 138
Enzyme 14 Molecular Weight 15734.9
Enzyme 14 Theoretical pI 5.06
Enzyme 14 GO Classification
Function
Process
Component
Enzyme 14 General Function Involved in retinal binding
Enzyme 14 Specific Function Transports retinoic acid to the nucleus. Regulates the access of retinoic acid to the nuclear retinoic acid receptors
Enzyme 14 Pathways Not Available
Enzyme 14 Reactions Not Available
Enzyme 14 Pfam Domain Function
Enzyme 14 Signals
  • None
Enzyme 14 Transmembrane Regions
  • None
Enzyme 14 Essentiality Not Available
Enzyme 14 GenBank ID Protein 56182498 Link Image
Enzyme 14 UniProtKB/Swiss-Prot ID Q5PXY7 Link Image
Enzyme 14 UniProtKB/Swiss-Prot Entry Name RABP2_BOVIN Link Image
Enzyme 14 PDB ID 3CBS Link Image
Enzyme 14 PDB File Show
Enzyme 14 3D Structure
Enzyme 14 Cellular Location Not Available
Enzyme 14 Gene Sequence >417 bp
ATGCCTAACTTCTCTGGCAACTGGAAAATCATCCGATCGGAGAACTTCGAGGATTTGCTC
AAAGTGCTGGGGGTGAATGTGATGCTGAGGAAGATCGCAGTGGCTGCAGCATCCAAGCCA
GCAGTGGAGATCAAACAGGAGGGGGACACTTTCTACATCAAAACCTCCACCACCGTGCGT
ACCACAGAGATCAACTTCAAGATCGGAGAGGAGTTTGAAGAGCAGACTGTGGATGGGAGA
CCCTGTAAGAGCCTGGTGAAATGGGAGAGCGAGAACAAAATGGTCTGTGAGCAGAGGCTG
TTGAAGGGAGAGGGTCCCAAGACCTCCTGGACCAGAGAACTGACCAACGATGGAGAGCTG
ATCCTGACCATGACGGCGGATGACATCGTGTGCACCAGGGTCTACGTCCGAGAGTGA
Enzyme 14 GenBank Gene ID AY821680 Link Image
Enzyme 14 GeneCard ID CRABP2 Link Image
Enzyme 14 GenAtlas ID Not Available
Enzyme 14 HGNC ID Not Available
Enzyme 14 Chromosome Location Chromosome:1
Enzyme 14 Locus 1q21.3
Enzyme 14 SNPs SNPJam Report Link Image
Enzyme 14 General References Not Available
Enzyme 14 Metabolite References Not Available