We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for D-Fructose 2,6-bisphosphate (BMDB01047)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-05 20:58:27
Accession Number BMDB01047
Common Name D-Fructose 2,6-bisphosphate
Description D-Fructose 2,6-bisphosphate is a regulatory molecule controlling the activity of the enzyme Phosphofructokinase-1 or PFK1 (in mammals). PFK1, in turn, is the key regulatory enzyme in the central metabolic pathway Glycolysis. D-Fructose 2,6-bisphosphate has the effect of increasing the activity of PFK1, thus increasing the rate at which the principle food molecule glucose is broken down. At the same time, this regulatory molecule also inhibits the opposing enzyme (FBPase1) in the reverse pathway (gluconeogenesis) so that the synthesis of glucose is not taking place in the same cell where glucose is being broken down (which would be wasteful) (Wikipedia).
Synonyms
  1. D-Fructose 2,6-bisphosphate
  2. D-Fructose 2,6-bisphosphic acid
  3. fructose 2,6-bisphosphate
  4. beta-D-fructose 2,6-bisphosphate
  5. b-D-fructose 2,6-bisphosphate
  6. Fru 2,6-P2, Fructose 2,6-diphosphate
Chemical IUPAC Name [(2S,3S,5S)-3,4-dihydroxy-5-(hydroxymethyl)-5-phosphonooxy-oxolan-2-yl]methoxyphosphonic acid
Chemical Formula C6H14O12P2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Carbohydrates and Carbohydrate conjugates
Class
  • Sugar Phosphates
Sub Class
  • Monosaccharide phosphates
Family
  • Mammalian_Metabolite
Species
  • primary alcohol; secondary alcohol; 1,2-diol; phosphoric acid ester; heterocyclic compound
Biofunction
  • Component of Fructose and mannose metabolism
Application
Source
  • Endogenous
Average Molecular Weight 340.116
Monoisotopic Molecular Weight 339.996063
Isomeric SMILES OC[C@]1(O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O)OP(O)(O)=O
Canonical SMILES OCC1(OC(COP(O)(O)=O)C(O)C1O)OP(O)(O)=O
KEGG Compound ID C00665 Link Image
BioCyc ID CPD-535 Link Image
BiGG ID 35645 Link Image
Wikipedia Link Not Available
METLIN ID 5964 Link Image
PubChem Compound 105021 Link Image
PubChem Substance 3934 Link Image
ChEBI ID 28602 Link Image
CAS Registry Number Not Available
InChI Identifier InChI=1/C6H14O12P2/c7-2-6(18-20(13,14)15)5(9)4(8)3(17-6)1-16-19(10,11)12/h3-5,7-9H,1-2H2,(H2,10,11,12)(H2,13,14,15)/t3-,4-,5+,6+/m1/s1
Synthesis Reference Shulman, Hagit; Makarov, Carina; Ogawa, Anthony K.; Romesberg, Floyd; Keinan, Ehud. Chemically Reactive Immunogens Lead to Functional Convergence of the Immune Response. Journal of the American Chemical Society (2000), 122(44), 10743-10753.
Melting Point (Experimental) Not Available
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 15.8 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -4
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -1.50 [Predicted by ALOGPS]; -5.3 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS) Not Available
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
Biofluid Location Not Available
Tissue Location Not Available
Concentrations (Normal) Not Available
Concentrations (Abnormal) Not Available
Pathway Names
  • Fructose and Mannose Metabolism
HMDB Pathways
Name Fructose and Mannose Metabolism
Image Show Link Image
KEGG Pathways
Name Fructose and Mannose Metabolism
Image Show Link Image
SimCell Pathways
Name Fructose and Mannose Metabolism
Image Show Link Image
Graph Show Link Image
SBML Download (XML) Link Image
General References Not Available
Metabolic Enzymes
  1. 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1
  2. 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
  3. 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
  4. Probable fructose-2,6-bisphosphatase TIGAR
Enzyme 1 [top]
Enzyme 1 ID 140
Enzyme 1 Name 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1
Enzyme 1 Synonyms
  1. 6PF-2-K/Fru-2,6-P2ASE liver isozyme
  2. 6-phosphofructo-2-kinase
  3. Fructose-2,6-bisphosphatase
Enzyme 1 Gene Name PFKFB1
Enzyme 1 Protein Sequence >6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1
MSQEMGELTQTRLQKIWIPHNNGNSRLQRRRGSSIPQFTNSPTMVIMVGLPARGKTYIST
KLTRYLNWIGTPTKVFNLGQYRREAVSYKNYEFFLPDNMEALLIRKQCALAALKDVHSYL
SHEEGRVAVFDATNTTRERRSLILQFAKEHGYKVFFIESICNDPDVIAENIRQVKLGSPD
YIDCDREKVLEDFLKRIECYEVNYQPLDDELDSHLSYIKIFDVGTRYMVNRVQDHIQSRT
VYYLMNIHVTPRSIYLCRHGESELNLRGRIGGDSGLSARGKQYAYALANFIQSQGISSLK
VGTSHMKRTIQTAEALGLPYEQWKALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRY
RYPKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLH
TVLKLTPVAYGCKVESIYLNVEAVNTHREKPENVDITREPEEALDTVPAHY
Enzyme 1 Number of Residues 471
Enzyme 1 Molecular Weight 54656.8
Enzyme 1 Theoretical pI 6.51
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Carbohydrate transport and metabolism
Enzyme 1 Specific Function Synthesis and degradation of fructose 2,6-bisphosphate
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 163518 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID P49872 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name F261_BOVIN Link Image
Enzyme 1 PDB ID 1K6M Link Image
Enzyme 1 PDB File Show
Enzyme 1 3D Structure
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1416 bp
ATGTCTCAAGAGATGGGAGAGCTCACCCAAACCAGATTGCAGAAGATCTGGATTCCACAC
AACAACGGCAACAGCAGGCTTCAACGGAGGAGGGGCTCATCCATACCACAGTTTACAAAT
TCCCCCACAATGGTGATCATGGTGGGTTTACCAGCTCGAGGAAAGACCTACATCTCAACA
AAGCTCACACGCTATCTCAACTGGATAGGAACACCAACTAAAGTGTTTAATTTAGGCCAA
TATCGACGAGAGGCAGTGAGCTACAAGAACTACGAATTCTTTCTTCCCGACAACATGGAG
GCCCTACTTATCAGGAAGCAGTGTGCCCTAGCAGCCCTGAAAGATGTTCATAGCTATCTC
AGCCATGAGGAAGGTCGTGTTGCAGTTTTTGATGCCACCAACACTACCAGAGAACGACGG
TCACTGATTCTGCAGTTTGCTAAAGAACATGGTTACAAGGTCTTTTTCATTGAGTCCATT
TGTAATGACCCTGACGTCATTGCAGAAAACATCAGGCAAGTGAAACTTGGCAGTCCTGAT
TATATAGACTGTGATCGTGAAAAGGTTCTGGAAGATTTTCTAAAGAGAATAGAGTGCTAT
GAGGTCAACTACCAACCCTTGGATGATGAACTGGATAGCCACCTGTCCTACATCAAGATC
TTCGACGTGGGCACACGCTACATGGTGAATCGTGTGCAGGACCATATCCAGAGCCGCACA
GTCTACTATCTCATGAACATTCACGTCACACCCCGCTCCATCTACCTATGCCGGCACGGT
GAGAGTGAACTCAACCTCAGAGGCCGCATTGGAGGTGACTCTGGCCTCTCAGCTCGGGGC
AAGCAGTATGCCTATGCCCTGGCCAATTTCATTCAGTCCCAGGGTATCAGCTCACTGAAG
GTTGGGACCAGCCACATGAAGAGGACTATCCAGACAGCTGAAGCCTTAGGACTTCCCTAT
GAGCAATGGAAGGCCCTGAATGAGATTGATGCGGGTGTCTGTGAGGAGATGACCTATGAA
GAAATCCAAGAACACTACCCTGAAGAATTTGCACTGCGAGACCAAGATAAATACCGCTAC
CGCTATCCTAAGGGAGAGTCTTACGAGGATCTGGTCCAGCGTCTGGAGCCAGTTATAATG
GAGCTAGAACGGCAGGAAAATGTATTGGTGATCTGCCATCAGGCTGTCATGCGGTGCCTC
CTGGCCTACTTTCTGGACAAGAGCTCAGATGAGTTGCCTTATCTCAAGTGCCCTCTCCAC
ACAGTGCTCAAACTTACACCTGTGGCTTATGGCTGCAAAGTGGAGTCCATCTACCTGAAT
GTGGAGGCTGTAAACACACATCGGGAGAAACCTGAGAATGTGGACATCACCCGGGAACCT
GAAGAAGCCCTGGACACTGTTCCTGCCCACTACTGA
Enzyme 1 GenBank Gene ID M64323 Link Image
Enzyme 1 GeneCard ID PFKFB1 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Not Available
Enzyme 1 Locus Xp11.21
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 155
Enzyme 2 Name 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
Enzyme 2 Synonyms
  1. 6PF-2-K/Fru-2,6-P2ASE brain/placenta-type isozyme
  2. 6-phosphofructo-2-kinase
  3. Fructose-2,6-bisphosphatase
Enzyme 2 Gene Name PFKFB3
Enzyme 2 Protein Sequence >6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3
MPLELTQSRVQKIWIPVDHRPSLPRTCGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLN
WIGVPTKVFNLGEYRRDGVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKSYLTKEGGQ
IAVFDATNTTRERRHMILHFPKENDFKVFFIESVCDDPTVVASNIMEVKISSPDYKDCNS
RENAMDDFMKRINCYEASYQPLDPDNDDRDLSLIKVIDVGQRFLVNRVQDHIQRRIVYYL
MNIHWQPRTIYLCRHGESKHNLQGKIGGDSGLSSRGRKFANALSKFVEEQNLKDLKVWTS
QLKSTIQTAEALQLPYEQWKALNEIDAGVCEEMTYEEIKDTYPEEYALAEADKYYYRYPT
GESYQDLVQRLEPVIMELERQENVLVICHQAVCVCLLAYFLDKSAEEMPYLKCPLHAVLK
LTPIAYGCRVESIYLNVESVSTHRERSEDAKKGPNPLMRSNSH
Enzyme 2 Number of Residues 463
Enzyme 2 Molecular Weight 53583.8
Enzyme 2 Theoretical pI 7.66
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Carbohydrate transport and metabolism
Enzyme 2 Specific Function Synthesis and degradation of fructose 2,6-bisphosphate
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 7544879 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q28901 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name F263_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence Not Available
Enzyme 2 GenBank Gene ID S77845 Link Image
Enzyme 2 GeneCard ID PFKFB3 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 10p14-p15
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 162
Enzyme 3 Name 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
Enzyme 3 Synonyms
  1. PFK-2/FBPase-2
  2. 6PF-2-K/Fru-2,6-P2ASE heart-type isozyme
  3. 6-phosphofructo-2-kinase
  4. Fructose-2,6-bisphosphatase
Enzyme 3 Gene Name PFKFB2
Enzyme 3 Protein Sequence >6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
MSGNPASSSEQNNNSYETKASLRISEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLT
RYLNWIGVPTKVFNLGVYRRQAVKSYKSYDFFRHDNEEAMKIRKQCALVALKDVKAYLTE
ESGQIAVFDATNTTRERRDLILNFAEENSFKVFFVESVCDDPDVIAANILEVKVSSPDYP
ERNRENVMDDFLKRIECYKVTYQPLDPDSHDKDLSFIKVINVGQRFLVNKVQDYIQSKIV
YYLMNIHVHPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEIADLKV
WTSQLKRTIQTAESLGVTYEQWKILNEIDAGVCEEMTYAEIQEQYPDEFALRDEEKYLYR
YPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHT
IFKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKSQTPVRMRRNSFTPLSSSNTIRRP
RNYSVGSRPLQPLSPLRALDTQEGADQPKTQAETSRAAHRLPSPAPPTSPS
Enzyme 3 Number of Residues 531
Enzyme 3 Molecular Weight 60810.7
Enzyme 3 Theoretical pI 8.41
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Carbohydrate transport and metabolism
Enzyme 3 Specific Function Synthesis and degradation of fructose 2,6-bisphosphate
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 552322 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID P26285 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name F262_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1596 bp
ATGTCCGGGAATCCTGCCTCTTCCTCAGAACAGAACAACAATAGCTATGAAACCAAAGCA
AGTCTCCGAATATCAGAGAAGAAATGTTCATGGGCATCTTACATGACAAACTCTCCAACC
CTCATCGTTATGATTGGCTTGCCAGCCCGTGGCAAAACCTACGTGTCCAAGAAACTTACA
CGCTACCTCAACTGGATTGGGGTGCCCACCAAAGTGTTTAATCTTGGGGTGTATCGGCGG
CAAGCAGTCAAGTCCTATAAGTCCTATGACTTCTTCCGGCATGACAACGAGGAGGCCATG
AAGATTCGCAAACAGTGTGCCCTGGTGGCACTGAAAGACGTGAAGGCGTATCTCACGGAG
GAGAGCGGGCAGATTGCGGTGTTTGATGCTACCAATACCACTCGAGAGAGGAGGGACTTG
ATTTTGAACTTTGCCGAGGAGAATTCTTTCAAGGTGTTCTTTGTGGAGTCCGTGTGCGAT
GATCCTGATGTCATTGCTGCCAACATCCTGGAGGTAAAGGTGTCGAGCCCCGACTACCCT
GAAAGGAACAGGGAGAATGTGATGGATGACTTCCTAAAGAGGATTGAGTGCTACAAAGTC
ACCTATCAACCCCTTGACCCAGACAGCCATGACAAGGATCTTTCTTTCATCAAGGTGATA
AACGTGGGCCAGAGATTTCTCGTGAACAAAGTCCAGGACTACATCCAGAGCAAGATCGTC
TACTACCTCATGAATATCCACGTCCACCCTCGCACCATCTACCTTTGCCGGCATGGAGAG
AGCGAGTTCAACCTCTTGGGGAAGATTGGGGGTGACTCAGGCCTCTCAGTGCGAGGAAAA
CAGTTTGCCCAGGCTCTAAGGAAGTTTCTGGAGGAACAGGAGATAGCAGACCTCAAAGTG
TGGACGAGCCAGTTGAAAAGGACTATCCAGACCGCAGAATCTCTGGGGGTGACCTACGAG
CAGTGGAAGATTCTGAACGAGATTGATGCTGGCGTGTGCGAGGAGATGACTTACGCGGAG
ATTCAGGAGCAGTATCCGGATGAGTTTGCGCTTCGAGATGAAGAGAAATATCTGTACCGA
TATCCTGGAGGGGAGTCATACCAGGACCTCGTGCAGCGGTTGGAGCCAGTCATCATGGAG
CTGGAGCGCCAGGGCAATGTCCTCGTTATCTCCCACCAGGCTGTCATGCGCTGCCTCCTG
GCCTACTTCTTGGACAAGGGTGCAGATGAGCTACCATACCTGAGGTGCCCTCTCCATACC
ATCTTCAAACTTACTCCTGTGGCCTACGGGTGCAAAGTGGAAACAATTAAACTCAATGTG
GAGGCTGTGAACACGCACCGTGACAAGCCAACTAACAACTTTCCCAAGAGCCAAACCCCT
GTAAGGATGAGAAGGAACAGCTTTACGCCTCTGTCCAGTTCGAATACAATCAGGCGTCCA
AGAAATTACAGTGTTGGGAGCCGGCCCCTCCAGCCCCTCAGCCCGCTCCGTGCCCTGGAC
ACGCAAGAAGGGGCCGACCAGCCGAAGACCCAAGCAGAGACCTCGCGGGCTGCACACAGG
CTCCCGTCTCCAGCGCCCCCCACGTCGCCCTCCTGA
Enzyme 3 GenBank Gene ID M34241 Link Image
Enzyme 3 GeneCard ID PFKFB2 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 1q31
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 1129
Enzyme 4 Name Probable fructose-2,6-bisphosphatase TIGAR
Enzyme 4 Synonyms
  1. TP53-induced glycolysis and apoptosis regulator
Enzyme 4 Gene Name TIGAR
Enzyme 4 Protein Sequence >Probable fructose-2,6-bisphosphatase TIGAR
MTRFALTVVRHGETRLNKEKIIQGQGIDEPLSETGFKQAAAAGIFLKDVKFTHVFSSDLT
RTKQTVHGILEKSKFCKDMTVKYDSRLRERKYGVAEGRPLSELRAMAKAAGEECPAFTPP
GGETLDQLKRRGKDFFEFLCQLILKEAGQNEQFSQEAPSSCLESSLAEIFPLGKNCASTF
NSDSGTPGLAASVLVVSHGAYIRSLLDYFLTDLKCSFPATLSRSELTSVSPNTGMTVFIL
NFEKGGKGRPTAQCVCVNLQGHLAGVNKTP
Enzyme 4 Number of Residues 270
Enzyme 4 Molecular Weight 29466.5
Enzyme 4 Theoretical pI 8.57
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Carbohydrate transport and metabolism
Enzyme 4 Specific Function Probable fructose-biphosphatase. Lowers cellular levels of fructose 2,6-bisphosphate. Protects cells against reactive oxygen species and against apoptosis induced by TP53
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 94574108 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q1JQA7 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name TIGAR_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >813 bp
ATGACGCGCTTCGCTCTGACCGTGGTCCGGCATGGAGAAACAAGACTTAACAAGGAGAAA
ATAATTCAAGGACAAGGAATAGATGAGCCTCTTTCAGAAACTGGATTTAAACAAGCAGCT
GCTGCTGGTATATTTCTTAAAGATGTGAAGTTTACTCATGTTTTCTCCAGTGACCTTACA
AGGACAAAGCAGACCGTGCATGGGATTTTGGAGAAGAGCAAATTTTGCAAAGATATGACA
GTAAAGTATGATTCAAGACTCCGAGAAAGGAAATATGGGGTTGCAGAAGGCAGGCCGCTG
AGCGAGCTGAGGGCCATGGCCAAAGCGGCAGGGGAGGAGTGCCCAGCATTCACACCGCCT
GGAGGAGAGACCTTGGACCAGCTGAAAAGGCGTGGGAAAGACTTTTTTGAATTTCTTTGT
CAACTGATCCTGAAAGAAGCCGGTCAGAATGAACAGTTTTCCCAGGAAGCCCCGAGCAGC
TGTCTGGAAAGTTCCCTGGCAGAGATATTTCCTTTAGGGAAGAACTGTGCCTCCACGTTT
AACTCTGACAGCGGCACCCCGGGCCTAGCAGCCAGTGTCTTAGTCGTGAGTCATGGCGCC
TACATACGAAGCCTGTTGGATTACTTTCTGACTGACCTCAAGTGCTCGTTCCCAGCGACT
CTGAGCAGGTCCGAGCTCACGTCAGTCAGCCCTAACACAGGGATGACTGTCTTCATCCTA
AACTTTGAGAAAGGAGGCAAAGGGAGACCAACTGCCCAGTGTGTGTGTGTGAACCTCCAG
GGCCACCTGGCCGGGGTGAACAAAACTCCCTAA
Enzyme 4 GenBank Gene ID BC116101 Link Image
Enzyme 4 GeneCard ID TIGAR Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Not Available
Enzyme 4 Locus Not Available
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References Not Available
Enzyme 4 Metabolite References Not Available