We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for D-Maltose (BMDB00163)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-05 20:57:43
Accession Number BMDB00163
Common Name D-Maltose
Description Maltose, or malt sugar, is a primary disaccharide in the human diet formed from two units of glucose joined with an alpha (1->4) linkage. It is the second member of an important biochemical series of glucose chains. The addition of another glucose unit yields maltotriose, Further additions will produce dextrins, also called maltodextrins, and eventually starch. Maltose can be broken down into two glucose molecules by hydrolysis in living organisms. At the surface of the small intestine, the brush border enzymes maltase, breaks down maltose. (PMID: 14522745)
Synonyms
  1. alpha-Malt sugar
  2. alpha-D-glucopyranosyl-(1->4)-D-glucose
  3. alpha-D-glucopyranosyl-(1->4)-D-glucopyranose
  4. alpha-D-Glcp-(1->4)-D-Glcp
  5. Sunmalt S
  6. Sunmalt
  7. Martos-10
  8. Malzzucker
  9. Maltose solution
  10. Maltose HHH
  11. Maltose HH
  12. Maltose
  13. Maltos
  14. Maltodiose
  15. Maltobiose
  16. Malt sugar
  17. Madoros (TN)
  18. Madoros
  19. Finetose F
  20. Finetose
  21. D-Maltose
  22. D-(+)-maltose
  23. Cextromaltose
  24. Advantose 100
  25. 4-O-alpha-D-glucopyranosyl-D-glucose
  26. 4-O-alpha-D-glucopyranosyl-D-glucopyranose
  27. 4-O-a-D-Glucopyranosyl-D-glucose
  28. 4-(alpha-D-glucosido)-D-glucose
  29. 4-(alpha-D-glucopyranosido)-alpha-glucopyranose
  30. 1-alpha-D-Glucopyranosyl-4-alpha-D-glucopyranose
  31. alpha-delta-glucopyranosyl-(1->4)-delta-glucose
  32. alpha-delta-glucopyranosyl-(1->4)-delta-glucopyranose
  33. alpha-delta-Glcp-(1->4)-delta-Glcp
  34. delta-Maltose
  35. delta-(+)-maltose
  36. 4-O-alpha-delta-glucopyranosyl-delta-glucose
  37. 4-O-alpha-delta-glucopyranosyl-delta-glucopyranose
  38. 4-(alpha-delta-glucosido)-delta-glucose
  39. 4-(alpha-delta-glucopyranosido)-alpha-glucopyranose
  40. 1-alpha-delta-Glucopyranosyl-4-alpha-delta-glucopyranose
Chemical IUPAC Name (2R,3S,4S,5R,6R)-2-(hydroxymethyl)-6-[(2R,3S,4R,5R)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxyoxane-3,4,5-triol
Chemical Formula C12H22O11
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Carbohydrates and Carbohydrate conjugates
Class
  • Carbohydrates
Sub Class
  • Disaccharides
Family
  • Mammalian_Metabolite
Species
  • hemiacetal; acetal; primary alcohol; secondary alcohol; 1,2-diol; heterocyclic compound
Biofunction
Application
Source
  • Endogenous
Average Molecular Weight 342.297
Monoisotopic Molecular Weight 342.116211
Isomeric SMILES OC[C@H]1O[C@H](O[C@@H]2[C@@H](CO)O[C@H](O)[C@@H](O)[C@H]2O)[C@H](O)[C@@H](O)[C@@H]1O
Canonical SMILES OCC1OC(OC2C(CO)OC(O)C(O)C2O)C(O)C(O)C1O
KEGG Compound ID C00208 Link Image
BioCyc ID MALTOSE Link Image
BiGG ID 34261 Link Image
Wikipedia Link Malt sugar Link Image
METLIN ID 413 Link Image
PubChem Compound 439186 Link Image
PubChem Substance 24882612 Link Image
ChEBI ID 17306 Link Image
CAS Registry Number 69-79-4
InChI Identifier InChI=1/C12H22O11/c13-1-3-5(15)6(16)9(19)12(22-3)23-10-4(2-14)21-11(20)8(18)7(10)17/h3-20H,1-2H2/t3-,4-,5-,6+,7-,8+,9-,10-,11+,12-/m1/s1
Synthesis Reference Pedersen, Sven; Vang Hendriksen, Hanne. Method for production of maltose and/or enzymatically modified starch. PCT Int. Appl. (2001), 99 pp.
Melting Point (Experimental) 102-103 oC
Experimental Water Solubility 780.0 mg/mL [YALKOWSKY,SH & DANNENFELSER,RM (1992)] Source: PhysProp
Predicted Water Solubility 586.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -5.03 [MEYLAN,WM & HOWARD,PH (1995)]; -4.3 [Predicted by PubChem via XLOGP]; -3.01 [Predicted by ALOGPS] Calculated using ALOGPS
Material Safety Data Sheet (MSDS) Not Available
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID 1A7L Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Show Image
Show Peaklist
BMRB Spectrum Show Image
Show Peaklist
Cellular Location
  • Cytoplasm
  • Extracellular
  • lysosome
Biofluid Location
  • Breast_Milk
  • Rumen
Tissue Location
Tissue References
Platelet
Concentrations (Normal)
Biofluid Breast_Milk
Value 292.144 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, fluid, partly skimmed, 2% milkfat.
References
Biofluid Rumen
Value 70.89 +/- 21.37 uM
Age N/A
Sex N/A
Condition Normal
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Biofluid Rumen
Value 133.75 +/- 118.39 uM
Age N/A
Sex N/A
Condition Rumen acidosis
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names
  • Starch and Sucrose Metabolism
HMDB Pathways
Name Starch and Sucrose Metabolism
Image Show Link Image
KEGG Pathways
Name Starch and Sucrose Metabolism
Image Show Link Image
SimCell Pathways
Name Starch and Sucrose Metabolism
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Collectin-43
  2. Pulmonary surfactant-associated protein D
Enzyme 1 [top]
Enzyme 1 ID 1617
Enzyme 1 Name Collectin-43
Enzyme 1 Synonyms
  1. 43 kDa collectin
  2. CL-43
Enzyme 1 Gene Name CL43
Enzyme 1 Protein Sequence >Collectin-43
MLPLPLSILLLLTQSQSFLGEEMDVYSEKTLTDPCTLVVCAPPADSLRGHDGRDGKEGPQ
GEKGDPGPPGMPGPAGREGPSGRQGSMGPPGTPGPKGEPGPEGGVGAPGMPGSPGPAGLK
GERGTPGPGGAIGPQGPSGAMGPPGLKGDRGDPGEKGARGETSVLEVDTLRQRMRNLEGE
VQRLQNIVTQYRKAVLFPDGQAVGEKIFKTAGAVKSYSDAEQLCREAKGQLASPRSSAEN
EAVTQLVRAKNKHAYLSMNDISKEGKFTYPTGGSLDYSNWAPGEPNNRAKDEGPENCLEI
YSDGNWNDIECREERLVICEF
Enzyme 1 Number of Residues 321
Enzyme 1 Molecular Weight 33615.3
Enzyme 1 Theoretical pI 4.76
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Carbohydrate transport and metabolism
Enzyme 1 Specific Function Lectin that binds to various sugars:mannose = ManNAc > fucose > GlcNAc > glucose = maltose > galactose > lactose > galNAc. Could play a role in immune defense
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • 1-20
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 18252109 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID P42916 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name CL43_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >966 bp
ATGCTTCCCCTCCCTCTCTCCATATTGCTCCTGCTCACACAGTCCCAGAGTTTCCTGGGC
GAAGAAATGGATGTCTATTCTGAGAAAACCCTCACCGATCCCTGCACCCTGGTTGTGTGT
GCTCCACCAGCAGATAGCCTTCGTGGTCATGATGGACGAGATGGGAAAGAAGGCCCCCAG
GGAGAGAAGGGGGATCCAGGGCCTCCAGGTATGCCTGGACCAGCTGGAAGAGAGGGCCCC
TCAGGGAGGCAGGGGAGCATGGGACCTCCAGGCACACCAGGCCCCAAAGGAGAACCTGGG
CCCGAAGGAGGAGTGGGTGCCCCAGGCATGCCCGGCTCCCCAGGCCCCGCAGGTCTCAAA
GGAGAGAGAGGTACCCCTGGGCCTGGTGGAGCCATCGGTCCACAGGGACCTTCAGGTGCC
ATGGGTCCCCCAGGACTGAAGGGAGACAGAGGTGATCCTGGAGAAAAAGGAGCAAGGGGG
GAGACTTCAGTCCTAGAGGTTGATACTCTAAGGCAGCGGATGAGAAACTTAGAGGGAGAA
GTTCAACGCCTCCAGAACATAGTCACTCAGTACAGGAAAGCGGTGCTCTTCCCTGATGGC
CAGGCTGTCGGGGAGAAGATCTTCAAGACGGCAGGTGCTGTAAAGTCATATTCGGATGCA
GAGCAGCTCTGCAGAGAGGCTAAGGGACAGCTGGCCTCCCCACGCTCTTCAGCCGAGAAC
GAGGCCGTGACACAGCTGGTCAGAGCCAAGAACAAGCATGCTTACCTGAGCATGAATGAC
ATCTCCAAAGAGGGCAAGTTCACCTACCCAACGGGGGGGTCACTGGACTATTCCAACTGG
GCCCCCGGGGAGCCCAACAATAGGGCAAAAGACGAAGGCCCAGAGAACTGTCTTGAGATC
TATTCCGATGGCAATTGGAATGACATAGAATGCAGGGAGGAGCGCCTCGTGATCTGTGAG
TTCTGA
Enzyme 1 GenBank Gene ID AY071821 Link Image
Enzyme 1 GeneCard ID CL43 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Not Available
Enzyme 1 Locus Not Available
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 2052
Enzyme 2 Name Pulmonary surfactant-associated protein D
Enzyme 2 Synonyms
  1. SP-D
  2. PSP-D
  3. Lung surfactant protein D
Enzyme 2 Gene Name SFTPD
Enzyme 2 Protein Sequence >Pulmonary surfactant-associated protein D
MLLLPLSVLLLLTQPWRSLGAEMKIYSQKTMANACTLVMCSPPEDGLPGRDGRDGREGPR
GEKGDPGSPGPAGRAGMPGPAGPIGLKGDNGSAGEPGPKGDTGPPGPPGMPGPAGREGPS
GKQGSMGPPGTPGPKGDTGPKGGVGAPGIQGSPGPAGLKGERGAPGEPGAPGRAGAPGPA
GAIGPQGPSGARGPPGLKGDRGTPGERGAKGESGLAEVNALRQRVGILEGQLQRLQNAFS
QYKKAMLFPNGRSVGEKIFKTEGSEKTFQDAQQICTQAGGQLPSPRSAAENEALTQLATA
QNKAAFLSMSDTRKEGTFIYPTGEPLVYSNWAPQEPNNDGGSENCVEIFPNGKWNDKVCG
EQRLVICEF
Enzyme 2 Number of Residues 369
Enzyme 2 Molecular Weight 37404.8
Enzyme 2 Theoretical pI 8.35
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Carbohydrate transport and metabolism
Enzyme 2 Specific Function Contributes to the lung's defense against inhaled microorganisms. May participate in the extracellular reorganization or turnover of pulmonary surfactant. Binds strongly maltose residues and to a lesser extent other alpha-glucosyl moieties
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • 1-20
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 415939 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID P35246 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name SFTPD_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1110 bp
ATGCTTCTCCTCCCTCTCTCCGTGCTGCTCCTGCTCACACAGCCCTGGAGATCCCTGGGA
GCAGAAATGAAGATCTATTCCCAGAAAACAATGGCCAACGCCTGTACCCTGGTCATGTGT
AGCCCCCCGGAGGATGGTTTGCCTGGTCGTGATGGACGAGATGGGAGAGAAGGCCCCCGG
GGGGAGAAGGGAGATCCAGGTTCACCAGGACCTGCAGGACGAGCAGGAATGCCTGGACCA
GCTGGCCCTATTGGGCTGAAAGGAGACAATGGCTCTGCTGGAGAACCCGGACCAAAGGGA
GACACTGGACCACCTGGGCCTCCAGGTATGCCTGGACCAGCTGGAAGAGAGGGCCCCTCA
GGGAAGCAGGGGAGCATGGGACCTCCAGGCACACCAGGCCCCAAAGGAGACACTGGGCCC
AAAGGAGGAGTGGGTGCCCCAGGCATTCAGGGCTCCCCAGGCCCTGCAGGTCTCAAAGGA
GAGAGAGGTGCCCCTGGTGAGCCCGGAGCCCCTGGACGTGCTGGGGCACCAGGGCCTGCT
GGAGCCATAGGTCCACAGGGGCCTTCAGGTGCCAGGGGCCCCCCAGGACTGAAGGGAGAC
AGAGGTACTCCTGGAGAAAGAGGAGCAAAGGGGGAGAGTGGGCTTGCAGAGGTCAATGCT
CTCAGGCAGCGGGTGGGAATCTTAGAGGGACAACTACAACGGCTCCAGAATGCCTTCTCT
CAGTATAAGAAAGCGATGCTCTTCCCTAATGGCCGGAGTGTCGGGGAGAAGATCTTTAAG
ACGGTAGGCTCTGAAAAAACGTTTCAGGATGCCCAGCAGATCTGCACACAGGCTGGAGGA
CAGTTGCCCTCCCCACGTTCTGGAGCTGAAAACGAGGCCTTGACTCAGCTGGCCACAGCC
CAGAACAAGGCTGCTTTCCTGAGCATGAGCGACACCAGGAAGGAGGGTACTTTCATCTAC
CCCACGGGGGAGCCCCTGGTCTATTCCAACTGGGCCCCCCAGGAGCCCAACAATGATGGC
GGCTCAGAGAACTGTGTGGAGATCTTTCCCAATGGCAAGTGGAATGACAAAGTCTGCGGA
GAGCAGCGCCTCGTGATCTGCGAGTTCTGA
Enzyme 2 GenBank Gene ID X75911 Link Image
Enzyme 2 GeneCard ID SFTPD Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 10q22.2-q23.1
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available