We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for L-Proline (BMDB00162)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-07-06 14:30:00
Accession Number BMDB00162
Common Name L-Proline
Description L-Proline is one of the twenty amino acids used in living organisms as the building blocks of proteins. Proline is sometimes called an imino acid, although the IUPAC definition of an imine requires a carbon-nitrogen double bond. Proline is a non-essential amino acid that is synthesized from glutamic acid. It is an essential component of collagen and is important for proper functioning of joints and tendons.
Synonyms
  1. (-)-(S)-Proline
  2. (-)-2-Pyrrolidinecarboxylate
  3. (-)-2-Pyrrolidinecarboxylic acid
  4. (-)-Proline
  5. (S)-(-)-Proline
  6. (S)-(-)-Pyrrolidine-2-carboxylate
  7. (S)-(-)-Pyrrolidine-2-carboxylic acid
  8. (S)-2-Carboxypyrrolidine
  9. (S)-2-Pyrralidinecarboxylate
  10. (S)-2-Pyrralidinecarboxylic acid
  11. (S)-2-Pyrrolidinecarboxylate
  12. (S)-2-Pyrrolidinecarboxylic acid
  13. (S)-Proline
  14. 2-Pyrrolidinecarboxylate
  15. 2-Pyrrolidinecarboxylic acid
  16. Proline
Chemical IUPAC Name (2S)-pyrrolidine-2-carboxylic acid
Chemical Formula C5H9NO2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Amino Acids
Sub Class
  • NA
Family
  • Mammalian_Metabolite
Species
  • secondary amine; secondary aliphatic amine (dialkylamine); carboxylic acid; heterocyclic compound; alpha-aminoacid
Biofunction
  • Component of Arginine and proline metabolism
Application
Source
  • Endogenous
Average Molecular Weight 115.131
Monoisotopic Molecular Weight 115.063332
Isomeric SMILES OC(=O)[C@@H]1CCCN1
Canonical SMILES OC(=O)C1CCCN1
KEGG Compound ID C00148 Link Image
BioCyc ID PRO Link Image
BiGG ID 34042 Link Image
Wikipedia Link L-Proline Link Image
METLIN ID 29 Link Image
PubChem Compound 145742 Link Image
PubChem Substance 841800 Link Image
ChEBI ID 17203 Link Image
CAS Registry Number 147-85-3
InChI Identifier InChI=1/C5H9NO2/c7-5(8)4-2-1-3-6-4/h4,6H,1-3H2,(H,7,8)/t4-/m0/s1
Synthesis Reference Itoh, Tamio. Synthesis of L-proline from L-glutamine. Bulletin of the Chemical Society of Japan (1963), 36(1), 25-9
Melting Point (Experimental) 221 oC
Experimental Water Solubility 162.0 mg/mL [MERCK INDEX (1996)] Source: PhysProp
Predicted Water Solubility 365.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity -2.54 [HANSCH,C ET AL. (1995)] Source: PhysProp
Predicted LogP/Hydrophobicity -2.71 [Predicted by ALOGPS]; -2.4 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Show Image
Show Peaklist
BMRB Spectrum Show Image
Show Peaklist
Cellular Location
  • Cytoplasm
  • endoplasmic reticulum
  • Extracellular
  • lysosome
  • mitochondria
Biofluid Location
  • Breast_Milk
  • Rumen
Tissue Location
Tissue References
All Tissues
Concentrations (Normal)
Biofluid Breast_Milk
Value 11 - 47 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. skim.
References
Biofluid Breast_Milk
Value 30834.441 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, Skim.
References
Biofluid Breast_Milk
Value 32137.304 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, fluid, partly skimmed, 1% milkfat.
References
Biofluid Breast_Milk
Value 33005.880 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, fluid, partly skimmed, 2% milkfat.
References
Biofluid Breast_Milk
Value 29879.00739 uM
Age N/A
Sex N/A
Condition Normal
Comments Pasteurized. Milk, whole, pasteurized, homogenized, 3.3% milkfat.
References
Biofluid Breast_Milk
Value 28489.286 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, fluid, whole, producer, 3.7% milkfat.
References
Biofluid Breast_Milk
Value 26 +/- 6 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 2% milk
References
Biofluid Breast_Milk
Value 26 +/- 5 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 1% milk
References
Biofluid Breast_Milk
Value 33 +/- 4 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in skim milk
References
Biofluid Breast_Milk
Value 28 +/- 9 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 3.25% milk
References
Biofluid Breast_Milk
Value 30636.646 uM
Age NA
Sex NA
Condition Normal
Comments Cow whole milk (3.25% fat)
References
Biofluid Breast_Milk
Value 32965.748 uM
Age NA
Sex NA
Condition Normal
Comments Cow reduced fat milk (2% fat) with added vitamin A
References
Biofluid Breast_Milk
Value 32159.521 uM
Age NA
Sex NA
Condition Normal
Comments Cow reduced fat milk (1% fat) with added vitamin A
References
Biofluid Breast_Milk
Value 30850.316 uM
Age NA
Sex NA
Condition Normal
Comments Cow skim milk with added vitamin A
References
Biofluid Rumen
Value 154.56 +/- 24.18 uM
Age N/A
Sex N/A
Condition Normal
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Biofluid Rumen
Value 173.23 +/- 28.4 uM
Age N/A
Sex N/A
Condition Rumen acidosis
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names
  • Arginine and Proline Metabolism
  • Transcription Translation
HMDB Pathways
Name Arginine and Proline Metabolism
Image Show Link Image
Name Transcription Translation
Image Show Link Image
KEGG Pathways
Name Arginine and Proline Metabolism
Image Show Link Image
SimCell Pathways
Name Arginine and Proline Metabolism
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Cytosol aminopeptidase
  2. Xaa-Pro aminopeptidase 1
  3. Prolyl 4-hydroxylase subunit alpha-1
  4. Prolyl 4-hydroxylase subunit alpha-3
  5. Probable proline dehydrogenase 2
  6. Probable proline racemase
  7. Pyrroline-5-carboxylate reductase 3
  8. Pyrroline-5-carboxylate reductase 2
  9. Pyrroline-5-carboxylate reductase 1, mitochondrial
  10. Cathepsin Z
Enzyme 1 [top]
Enzyme 1 ID 499
Enzyme 1 Name Cytosol aminopeptidase
Enzyme 1 Synonyms
  1. Leucine aminopeptidase
  2. Leucyl aminopeptidase
  3. Leucine aminopeptidase 3
  4. LAP
  5. Proline aminopeptidase
  6. Prolyl aminopeptidase
  7. Peptidase S
Enzyme 1 Gene Name LAP3
Enzyme 1 Protein Sequence >Cytosol aminopeptidase
MFLLPLPAAARVAVRHLSVKRLWAPGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFN
KLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKEN
IRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGS
EDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWI
EEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMD
LMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQV
DNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFE
ASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHL
DIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQDSA
Enzyme 1 Number of Residues 519
Enzyme 1 Molecular Weight 56288.9
Enzyme 1 Theoretical pI 6.44
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Amino acid transport and metabolism
Enzyme 1 Specific Function Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 410689 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID P00727 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name AMPL_BOVIN Link Image
Enzyme 1 PDB ID 1LAP Link Image
Enzyme 1 PDB File Show
Enzyme 1 3D Structure
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1542 bp
ATGCCACCACCTGGATCCCCTTGGCCTTCAGAGCGTCAGCCTGCTCCACGAACCCTGGCA
GGTGGGTGCTCAGACATGACGAAGGGCCTTGTTTTAGGAATCTATAGCAAAGAAAAAGAA
GAAGATGAGCCTCAGTTTACAAGTGCAGGAGAGAATTTTAATAAATTGGTGTCTGGAAAG
CTGAGAGAAATTTTGAACATATCTGGACCATCCCTGAAGGCAGGCAAAACCCGAACCTTT
TATGGTCTACATGAGGACTTCCCTAGCGTGGTGGTGGTTGGCCTTGGCAAAAAGACGGCT
GGAATTGATGAACAGGAGAACTGGCATGAAGGCAAAGAAAACATCAGAGCTGCTGTTGCA
GCGGGGTGCAGACAGATTCAGGACCTGGAGATCCCGTCGGTGGAGGTGGACCCCTGCGGA
GATGCCCAGGCGGCTGCGGAAGGAGCGGTGCTCGGGCTCTATGAATATGATGACCTGAAG
CAGAAAAGGAAGGTGGTGGTGTCGGCCAAACTCCATGGAAGTGAGGACCAGGAGGCCTGG
CAGAGAGGCGTCCTCTTTGCTTCTGGGCAGAACCTGGCACGCCGCTTGATGGAGACGCCT
GCCAACGAGATGACGCCAACCAAATTTGCCGAAATTGTTGAGGAGAATCTCAAAAGTGCT
AGTATTAAAACAGACGTCTTCATCAGACCCAAGTCTTGGATTGAGGAACAGGAAATGGGA
TCATTTCTAAGTGTGGCCAAAGGGTCCGAAGAGCCTCCAGTCTTCCTGGAAATTCACTAC
AAAGGCAGTCCCAATGCAAGTGAACCTCCCTTGGTGTTTGTTGGGAAGGGGATTACCTTT
GACAGTGGTGGCATCTCCATCAAGGCTGCTGCAAACATGGACCTCATGAGGGCCGACATG
GGAGGAGCTGCCACTATCTGTTCAGCCATCGTGTCTGCTGCCAAGCTCGACCTGCCCATC
AACATCGTAGGTTTGGCTCCTCTTTGTGAAAATATGCCCAGTGGGAAGGCCAACAAGCCT
GGGGATGTTGTTAGAGCCAGGAACGGGAAGACCATACAGGTGGATAACACCGATGCTGAG
GGGAGACTTATCCTGGCCGATGCGCTCTGCTACGCTCACACTTTTAACCCAAAGGTCATC
ATTAATGCCGCCACCCTGACAGGTGCCATGGACATAGCTTTGGGATCTGGTGCCACTGGG
GTCTTTACCAACTCTTCTTGGCTGTGGAACAAACTATTTGAGGCCAGCATTGAAACAGGA
GACCGTGTCTGGAGGATGCCTCTCTTTGAACATTACACAAGACAGGTTATAGATTGCCAA
CTTGCTGATGTTAATAACATTGGAAAATATAGATCTGCAGGAGCGTGTACAGCTGCAGCA
TTCCTGAAAGAATTTGTGACTCATCCTAAGTGGGCACATTTAGACATAGCAGGTGTGATG
ACCAACAAAGATGAGGTTCCTTATCTTCGCAAAGGCATGGCTGGGAGGCCCACGAGGACC
CTGATTGAATTCCTGTTTCGGTTCAGTCAAGACAGTGCTTAG
Enzyme 1 GenBank Gene ID S65367 Link Image
Enzyme 1 GeneCard ID LAP3 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:4
Enzyme 1 Locus 4p15.32
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 641
Enzyme 2 Name Xaa-Pro aminopeptidase 1
Enzyme 2 Synonyms
  1. X-Pro aminopeptidase 1
  2. X-prolyl aminopeptidase 1, soluble
  3. Cytosolic aminopeptidase P
  4. Soluble aminopeptidase P
  5. sAmp
  6. Aminoacylproline aminopeptidase
Enzyme 2 Gene Name XPNPEP1
Enzyme 2 Protein Sequence >Xaa-Pro aminopeptidase 1
MAPKITSELLRQLRQAMRNLEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSA
GTAIVTEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVD
PLIIPTDYWKKMAKVLRSAGHHLIPVKDNLVDKIWTDRPERPCKPLITLGLDYTGISWKD
KVADLRLKMAERNVVWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAILGLETIMLFIDGD
RIDAPIVKEHLLLDLGLEAEYRIQVLPYKSILSELKILCASLSPREKVWVSDKASYAVSE
AIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEI
SAANKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQY
KDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSG
LDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVV
LVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNSYHLTCRDVIGKEL
QKQGRQEALEWLIRETQPISKQP
Enzyme 2 Number of Residues 623
Enzyme 2 Molecular Weight 69789.2
Enzyme 2 Theoretical pI 5.41
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Amino acid transport and metabolism
Enzyme 2 Specific Function Release of any N-terminal amino acid, including proline, that is linked to proline, even from a dipeptide or tripeptide
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 95767577 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q1JPJ2 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name XPP1_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1872 bp
ATGGCTCCAAAGATAACTTCAGAGCTGCTTCGGCAGCTGAGACAAGCCATGAGGAACTTG
GAGTATGTGACGGAACCAATCCAGGCCTACATCATCCCGTCGGGAGACGCCCATCAGAGT
GAGTACATTGCTCCGTGTGATTGTCGGCGCGCCTTTGTCTCTGGATTTGATGGCTCTGCA
GGCACAGCCATCGTCACAGAAGAACATGCGGCCATGTGGACTGACGGGCGCTACTTTCTC
CAGGCTGCCAAGCAGATGGACAGCAACTGGACACTCATGAAGATGGGTCTGAAGGACACA
CCAACTCAGGAAGACTGGCTGGTGAGTGTACTTCCTGAAGGATCCAGGGTTGGTGTAGAC
CCACTGATCATTCCTACAGATTACTGGAAGAAGATGGCCAAGGTTCTGAGAAGTGCTGGC
CACCACCTCATTCCTGTCAAGGACAACCTAGTGGACAAGATCTGGACAGACCGCCCCGAG
CGTCCCTGCAAACCGCTCATCACACTGGGCCTGGATTACACAGGCATCTCCTGGAAGGAC
AAGGTTGCAGACCTTCGGTTGAAAATGGCTGAGAGGAACGTCGTGTGGTTTGTGGTCACT
GCCCTGGATGAGATTGCGTGGCTATTCAATCTCCGAGGATCAGACGTAGAGCACAATCCT
GTATTTTTCTCCTATGCAATCTTAGGACTAGAGACGATCATGCTCTTCATTGATGGTGAC
CGCATAGACGCCCCCATTGTGAAGGAACACCTACTGCTTGACTTGGGCCTGGAAGCCGAG
TACAGAATCCAGGTGCTTCCGTACAAGTCCATCCTGAGCGAGCTCAAGATCCTGTGTGCC
AGCCTTTCCCCAAGGGAGAAGGTGTGGGTCAGTGACAAGGCCAGCTATGCTGTGAGCGAG
GCCATCCCCAAGGATCATCGCTGCTGTATGCCTTACACCCCCATCTGCATCGCCAAAGCT
GTGAAGAATTCTGCTGAATCAGAAGGCATGAGGCGAGCTCACATTAAAGATGCTGTTGCC
TTGTGTGAACTCTTTAACTGGCTGGAAAAAGAGGTGCCCAAAGGTGGTGTGACAGAGATC
TCAGCTGCCAACAAAGCTGAGGAATTCCGCAGGCAGCAGGCCGACTTTGTGGACCTGAGC
TTCCCAACCATTTCCAGTACGGGACCCAATGGCGCCATCATTCACTACGCGCCGGTCCCT
GAGACGAATAGGACCTTGTCTCTGGATGAGGTGTACCTCATTGACTCGGGTGCTCAATAC
AAGGACGGAACCACAGACGTCACCCGCACCATGCATTTTGGAACTCCTACAGCTTACGAG
AAGGAATGCTTCACATACGTCCTCAAGGGCCACATAGCTGTGAGCGCAGCGGTTTTCCCG
ACTGGAACCAAAGGCCACCTCCTTGACTCCTTTGCCCGCTCAGCGTTATGGGATTCTGGC
CTGGATTACCTGCATGGAACGGGGCATGGTGTTGGGTCTTTTCTGAATGTTCATGAGGGT
CCATGTGGCATCAGTTATAAAACATTCTCTGATGAGCCCTTGGAGGCCGGCATGATCGTC
ACTGATGAGCCAGGGTATTATGAAGATGGGGCTTTTGGAATTCGCATTGAGAATGTTGTC
CTGGTGGTGCCTGTTAAGACCAAGTATAACTTCAACAACCGGGGAAGCCTGACCTTTGAA
CCTCTGACTTTGGTTCCAATACAGACCAAAATGATAGATGTGGATTCTCTAACAGACAAA
GAGTGTGACTGGCTCAACAGCTACCACCTGACCTGCAGGGACGTGATCGGGAAGGAGCTG
CAAAAGCAGGGCCGCCAGGAAGCCCTCGAGTGGCTCATCAGAGAGACGCAGCCCATCTCC
AAACAGCCTTAA
Enzyme 2 GenBank Gene ID BT025361 Link Image
Enzyme 2 GeneCard ID XPNPEP1 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 10q25.3
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 668
Enzyme 3 Name Prolyl 4-hydroxylase subunit alpha-1
Enzyme 3 Synonyms
  1. 4-PH alpha-1
  2. Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-1
Enzyme 3 Gene Name P4HA1
Enzyme 3 Protein Sequence >Prolyl 4-hydroxylase subunit alpha-1
MIWYILVVGILLPQSLAHPGFFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWA
EKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLVLKDMSDGFISNLTIQRQY
FPNDEDQVGAAKALLRLQDTYNLDTDTISKGDLPGVKHKSFLTVEDCFELGKVAYTEADY
YHTELWMEQALRQLDEGEVSTVDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQR
ANGNLKYFEYIMAKEKDANKSSSDDQSDQKTTLKKKGAAVDYLPERQKYEMLCRGEGIKM
TPRRQKKLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRFHDIISDAEIEVVKDLAKPRL
RRATISNPITGDLETVHYRISKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANY
GVGGQYEPHFDFARKDEPDAFKELGTGNRIATWLFYMSDVLAGGATVFPEVGASVWPKKG
TAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWLHERGQEFRRPCTLSELE
Enzyme 3 Number of Residues 534
Enzyme 3 Molecular Weight 61009.7
Enzyme 3 Theoretical pI 5.70
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Involved in iron ion binding
Enzyme 3 Specific Function Catalyzes the post-translational formation of 4- hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • 1-17
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 92097479 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q1RMU3 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name P4HA1_BOVIN Link Image
Enzyme 3 PDB ID 1TJC Link Image
Enzyme 3 PDB File Show
Enzyme 3 3D Structure
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1605 bp
ATGATCTGGTATATTTTAGTTGTAGGGATTCTACTTCCCCAGTCTTTGGCCCATCCAGGC
TTTTTTACTTCTATTGGTCAGATGACTGATTTGATTCATACTGAAAAAGATCTGGTGACT
TCCCTGAAAGACTATATAAAGGCAGAAGAGGACAAATTAGAACAAATAAAAAAATGGGCA
GAGAAATTAGATCGATTAACCAGCACAGCGACAAAAGATCCAGAAGGATTTGTTGGACAC
CCTGTAAATGCATTCAAATTAATGAAACGTCTGAACACTGAGTGGAGTGAGTTGGAGAAT
CTGGTCCTTAAGGATATGTCAGATGGTTTTATCTCTAACCTAACCATTCAGAGACAGTAC
TTCCCTAATGATGAAGATCAGGTTGGGGCAGCCAAAGCTCTGTTGCGTCTACAGGACACC
TACAATTTGGATACAGATACCATCTCAAAGGGTGATCTTCCAGGAGTAAAACACAAATCT
TTTCTAACAGTTGAGGACTGTTTTGAGTTGGGCAAAGTGGCCTACACAGAAGCAGATTAT
TACCATACAGAGCTGTGGATGGAACAAGCACTGAGGCAGCTGGATGAAGGCGAGGTTTCT
ACCGTTGATAAAGTCTCTGTTCTGGATTATTTGAGCTATGCAGTATACCAGCAGGGAGAC
CTGGATAAGGCGCTTTTGCTCACAAAGAAGCTTCTTGAACTAGATCCTGAACATCAGAGA
GCTAACGGTAACTTAAAATACTTTGAGTATATAATGGCTAAAGAAAAAGATGCCAATAAG
TCTTCTTCAGATGACCAATCTGATCAGAAAACCACACTGAAGAAGAAAGGTGCTGCTGTG
GATTACCTGCCAGAGAGACAGAAGTACGAAATGCTGTGCCGTGGGGAGGGTATCAAAATG
ACTCCTCGGAGACAGAAAAAACTCTTCTGTCGCTACCATGATGGAAACCGGAATCCTAAA
TTTATCCTGGCTCCAGCCAAACAGGAGGATGAGTGGGACAAGCCTCGTATTATCCGCTTC
CATGATATTATTTCTGATGCAGAAATTGAAGTCGTTAAAGATCTAGCAAAACCAAGGCTG
AGGCGAGCCACCATTTCAAACCCAATAACAGGAGACTTGGAGACGGTACATTACAGAATT
AGCAAAAGTGCCTGGCTGTCTGGCTATGAAAACCCTGTGGTGTCACGAATTAATATGAGA
ATCCAAGATCTGACAGGACTAGATGTCTCCACAGCAGAGGAATTACAGGTAGCAAATTAT
GGAGTTGGAGGACAGTATGAACCCCATTTTGATTTTGCACGGAAAGATGAGCCAGATGCT
TTCAAAGAGCTGGGGACAGGAAATAGAATTGCTACATGGCTGTTTTATATGAGTGATGTG
TTAGCAGGAGGAGCCACTGTTTTTCCTGAAGTAGGAGCTAGTGTTTGGCCCAAAAAGGGA
ACTGCTGTTTTCTGGTATAATCTGTTTGCCAGTGGAGAAGGAGATTATAGTACACGGCAT
GCAGCCTGTCCAGTGCTGGTTGGAAACAAATGGGTATCCAATAAATGGCTCCATGAACGT
GGACAGGAATTTCGAAGACCATGCACCTTGTCAGAATTGGAATGA
Enzyme 3 GenBank Gene ID BC114708 Link Image
Enzyme 3 GeneCard ID P4HA1 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 10q21.3-q23.1
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 691
Enzyme 4 Name Prolyl 4-hydroxylase subunit alpha-3
Enzyme 4 Synonyms
  1. 4-PH alpha-3
  2. Procollagen-proline,2-oxoglutarate-4-dioxygenase subunit alpha-3
Enzyme 4 Gene Name P4HA3
Enzyme 4 Protein Sequence >Prolyl 4-hydroxylase subunit alpha-3
MGPAARLAALLAVLAFRAGDPAEVAARGDTFSALTSVARALAPERRLLGLLRRYLRGEEA
RLRDLTRFYHKVLSLHEDSATPVSNPLLAFTLIKRLQSDWKNVVHSLEASENIRALKDGY
ERVEQDLPAFEDLEGAARALMRLQDVYMLNVKGLARGVFQRVTGSAVTDLYSPRRLFSLT
GDDCFQVGKVAYDMGDYYHAIPWLEEAVSLFRGSYGEWKTEDEASLEDALDHLAFAYFQA
GNVLCALNLSREFLLYSPDNKRVARNVLKYEKLLAESPNQAVAETVMQRPNVPHLQTRDT
YEGLCQTLGSQPTHYRIPSLYCSYETSSSPYLLLQPVRKEVIHLEPYVVLYHDFVSDAEA
QTIRGLAEPWLQRSVVASGEKQLPVEYRISKSAWLKDTVDPVLVTLDHRIAALTGLDVQP
PYAEYLQVVNYGIGGHYEPHFDHATSPSSPLYRMNSGNRVATFMIYLSSVEAGGATAFIY
GNFSVPVVKNAALFWWNLHRSGEGDGDTLHAACPVLVGDKWVANKWIHEYGQEFRRPCSS
RPED
Enzyme 4 Number of Residues 544
Enzyme 4 Molecular Weight 61022.6
Enzyme 4 Theoretical pI 6.31
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in iron ion binding
Enzyme 4 Specific Function Catalyzes the post-translational formation of 4- hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • 1-19
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 47115494 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q75UG4 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name P4HA3_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >1635 bp
ATGGGCCCCGCAGCGCGGCTGGCGGCGCTGTTGGCGGTGCTGGCGTTCCGGGCAGGGGAC
CCAGCCGAGGTCGCGGCGCGCGGGGACACGTTCTCGGCGCTGACCAGTGTGGCGCGCGCC
CTGGCGCCCGAGCGCCGGCTGCTGGGACTGCTGCGGCGCTACCTGCGCGGGGAGGAGGCG
CGGCTGCGGGACCTGACCAGATTCTATCACAAGGTGCTATCTTTACATGAAGATTCAGCA
ACCCCTGTGTCTAACCCTCTGCTTGCATTTACTCTCATCAAACGCCTACAGTCTGACTGG
AAGAATGTGGTACATAGTCTGGAGGCCAGTGAGAACATCCGAGCTCTCAAGGATGGTTAT
GAGAGGGTGGAGCAGGACCTGCCAGCCTTTGAGGACCTCGAGGGAGCAGCAAGGGCCCTG
ATGCGGCTGCAGGACGTGTACATGCTCAATGTGAAGGGACTTGCCCGAGGCGTCTTCCAG
AGAGTCACAGGCTCTGCTGTCACTGACTTGTATAGTCCCAGGCGACTTTTCTCCCTCACC
GGGGATGACTGCTTCCAAGTTGGCAAGGTGGCCTATGACATGGGGGATTACTACCATGCC
ATTCCATGGCTGGAGGAGGCCGTCAGTCTCTTCCGAGGCTCTTATGGAGAATGGAAGACA
GAGGATGAGGCAAGTCTTGAGGATGCCTTGGATCACCTGGCCTTCGCCTATTTCCAGGCA
GGAAATGTTTTGTGTGCCCTCAACCTTTCCCGGGAGTTTCTTCTGTACAGCCCAGATAAT
AAAAGGGTGGCCAGAAATGTCTTGAAGTATGAAAAGCTCTTGGCAGAGAGCCCTAACCAG
GCTGTAGCAGAGACTGTCATGCAGAGACCCAATGTGCCCCACCTGCAGACCAGGGACACC
TACGAGGGGTTATGTCAGACCCTGGGTTCCCAGCCTACTCACTACCGGATCCCCAGCCTC
TACTGCTCCTATGAGACCAGTTCCAGTCCTTACCTGCTGCTCCAGCCTGTGCGGAAGGAG
GTCATCCACCTGGAGCCCTATGTTGTTCTCTACCATGACTTTGTCAGTGACGCCGAGGCT
CAGACGATCAGAGGGCTTGCGGAACCATGGTTACAGAGATCCGTGGTGGCGTCAGGTGAA
AAGCAGTTACCAGTGGAGTACCGCATCAGCAAGAGTGCCTGGCTGAAGGACACTGTTGAC
CCAGTGCTGGTGACCCTTGACCATCGCATTGCTGCCCTCACGGGCCTTGATGTCCAGCCT
CCCTACGCAGAGTATCTCCAGGTGGTGAACTATGGAATTGGAGGGCACTATGAGCCTCAC
TTTGACCATGCTACGTCACCAAGCAGCCCACTGTACAGAATGAACTCTGGGAACCGGGTC
GCAACATTTATGATCTATTTGAGCTCGGTGGAAGCCGGAGGAGCCACAGCCTTCATCTAC
GGCAACTTCAGCGTTCCTGTGGTCAAGAATGCAGCACTCTTTTGGTGGAACCTGCATAGG
AGTGGTGAAGGGGATGGTGACACACTTCATGCTGCCTGCCCTGTCCTGGTAGGAGATAAA
TGGGTGGCCAACAAGTGGATACACGAGTATGGACAGGAATTCCGCAGACCCTGCAGCTCG
AGACCTGAAGACTAA
Enzyme 4 GenBank Gene ID AB126035 Link Image
Enzyme 4 GeneCard ID P4HA3 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 11q13.4
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References Not Available
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 873
Enzyme 5 Name Probable proline dehydrogenase 2
Enzyme 5 Synonyms
  1. Probable proline oxidase 2
Enzyme 5 Gene Name PRODH2
Enzyme 5 Protein Sequence >Probable proline dehydrogenase 2
MLQACRVLRSRAGPSPGSWQPLSFDGGAFHLKSIGELTRALLVLRLCAWPPLVTHGLALQ
AWSQRLLGSRLSGALLRASIYGQFVAGETAEEVRSCVLQLQNLGLRPLLAVPTEEEPDSA
VKTGEAWYEGNLSAMLRCVDLSRGLLETPDPTGNALMQLKMTALMSTRLCKQLTSWVRRP
GDSLELSPERLAEAMDSGQDLQVSCLNTEQTRHLQASLSRLHRVVQHARAQRVRLLVDAE
YTSLNPALSLLVAALATRWNSSGEGGPWVWNTYQAYLKDTYERLRWDAEAADRAGLAFGV
KLVRGAYLDKERETARLQGTEDPTQPDYEATSQSYSRCLELMLTQVSHRGPMCHLMVASH
NEDSVRQATKRMWELGIPPDGPVCFGQLLGMCDHVSLALGQAGYAVYKSIPYGSLEEVIP
YLIRRAQENRSVLRGARREQELLSQELRRRLLGRGLRVSPH
Enzyme 5 Number of Residues 461
Enzyme 5 Molecular Weight 51261.2
Enzyme 5 Theoretical pI 8.40
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Amino acid transport and metabolism
Enzyme 5 Specific Function Converts proline to delta-1-pyrroline-5-carboxylate (Probable)
Enzyme 5 Pathways
  • Amino-acid degradation
  • L-proline degradation into L- glutamate
  • L-glutamate from L-proline:step 1/2
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 151554018 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID A6QQ74 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name PROD2_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >1386 bp
ATGCTTCAGGCCTGTCGTGTGCTCCGCTCCCGAGCTGGCCCCTCCCCAGGGAGCTGGCAG
CCCCTCAGCTTTGATGGTGGGGCCTTCCACCTCAAGAGCATAGGAGAACTGACCCGAGCT
TTGCTGGTGCTACGGCTGTGTGCCTGGCCGCCTCTGGTCACCCATGGCCTGGCGCTCCAA
GCCTGGTCTCAGCGACTCCTGGGCTCCCGGCTCTCCGGTGCGCTTCTCCGAGCATCCATC
TACGGGCAGTTTGTGGCTGGTGAGACCGCTGAGGAGGTGAGGAGCTGTGTCCTACAGCTC
CAGAACCTAGGCCTGCGGCCTCTGCTGGCAGTGCCCACTGAGGAGGAGCCAGACTCGGCT
GTCAAGACGGGTGAGGCCTGGTATGAAGGGAACCTCAGTGCGATGCTGCGATGCGTGGAC
CTGTCACGAGGCCTCCTGGAGACCCCTGACCCAACGGGAAATGCCCTGATGCAGCTGAAG
ATGACGGCGCTGATGAGCACTCGGCTCTGTAAGCAGCTCACCTCGTGGGTCCGAAGGCCA
GGGGATTCTTTGGAGCTGAGCCCCGAGAGGCTGGCAGAAGCCATGGACTCTGGACAGGAC
CTCCAGGTCTCCTGCCTCAACACCGAGCAAACACGACACCTCCAGGCCTCCCTGAGTCGT
TTGCACCGGGTGGTACAGCACGCCCGGGCCCAGCGCGTGAGGCTCCTGGTGGATGCCGAG
TACACCTCTCTGAACCCGGCACTCTCTCTGCTGGTGGCTGCCCTGGCCACGCGCTGGAAC
AGCTCCGGGGAAGGCGGGCCCTGGGTGTGGAACACTTACCAGGCCTATCTGAAGGACACC
TATGAGCGGCTGAGGTGGGACGCTGAGGCCGCAGACAGGGCTGGCCTGGCCTTTGGGGTG
AAGTTGGTACGAGGGGCGTATCTGGACAAGGAGAGAGAGACGGCCCGGCTCCAGGGAACC
GAAGATCCCACTCAGCCTGACTATGAGGCTACCAGTCAGAGTTACAGCCGCTGTCTGGAG
CTGATGCTGACCCAGGTGTCCCATCGTGGCCCCATGTGCCACCTCATGGTGGCTTCCCAC
AATGAGGACTCTGTCCGCCAGGCAACCAAGCGCATGTGGGAGCTGGGCATTCCTCCAGAT
GGGCCTGTCTGCTTTGGACAACTTCTGGGGATGTGTGACCATGTCTCCTTGGCACTGGGG
CAGGCTGGCTATGCTGTGTACAAGTCCATCCCCTATGGCTCTCTGGAGGAGGTGATCCCT
TACCTGATCCGGAGGGCCCAGGAGAACCGAAGTGTACTACGGGGTGCCCGCAGAGAACAG
GAGCTGCTCAGCCAAGAACTTCGACGGAGGCTGCTGGGGCGGGGCCTGAGGGTATCCCCC
CATTAG
Enzyme 5 GenBank Gene ID BC149682 Link Image
Enzyme 5 GeneCard ID PRODH2 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:1
Enzyme 5 Locus 19q13.1
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References Not Available
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 924
Enzyme 6 Name Probable proline racemase
Enzyme 6 Synonyms Not Available
Enzyme 6 Gene Name Not Available
Enzyme 6 Protein Sequence >Probable proline racemase
MAGPLTVPWMPPHDPGTPALSVVDMHTGGEPLRIVLAGCPEVVGPTLLAKRRYMRQHLDH
VRRRLMFEPRGHRDMYGAVLVPSELPDAHLGVLFLNNEGYSSMCGHAVLALGRFALDFGL
VPAPPSDAQEALVNIHCPCGLVAAFVECEGCRSRGPVRFHSVPAFVLATDFLVDVPGRGK
VVVDIAYGGAFYAFVSAEKLGLDVCSAKMGDLVAAASAVTEAVKAQFKISHPDSEDLAFL
YGTILTDGKDTYNEEPTTNICVFADEQVDRSPTGSGVTARIALQYHKGLLELNQTRAFKS
SATGSVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIVEDDDPLRDGFLLK
Enzyme 6 Number of Residues 354
Enzyme 6 Molecular Weight 37957.1
Enzyme 6 Theoretical pI 6.08
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Involved in proline racemase activity
Enzyme 6 Specific Function Catalyzes the interconversion of L- and D-proline
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 74356499 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID Q3SX04 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name PRCM_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >1065 bp
ATGGCGGGCCCGCTGACTGTGCCCTGGATGCCTCCACATGACCCGGGGACGCCGGCGCTG
TCGGTGGTGGACATGCACACAGGCGGCGAGCCCCTGCGCATTGTGCTGGCGGGGTGTCCG
GAGGTGGTCGGCCCCACGCTGCTGGCCAAGCGGCGCTACATGCGCCAGCACCTTGACCAT
GTGCGGCGACGGCTCATGTTCGAACCCCGGGGGCACCGGGACATGTACGGAGCTGTGCTG
GTGCCGAGCGAGCTACCCGACGCGCACCTGGGCGTCCTGTTCCTGAACAACGAGGGCTAC
AGTTCTATGTGCGGCCACGCTGTGCTGGCGCTGGGCCGCTTTGCGCTCGACTTCGGGCTG
GTGCCGGCGCCCCCGTCCGACGCCCAAGAGGCCCTGGTCAACATCCATTGCCCGTGCGGG
CTGGTGGCCGCCTTCGTGGAGTGCGAGGGCTGCCGCAGTCGCGGTCCGGTGCGCTTCCAC
AGTGTCCCGGCCTTCGTGCTGGCCACAGATTTCCTGGTGGATGTTCCTGGTCGTGGGAAG
GTGGTGGTGGACATTGCCTATGGTGGTGCATTTTATGCCTTTGTCAGTGCTGAAAAGTTA
GGACTCGATGTTTGTTCTGCAAAGATGGGGGACCTCGTGGCTGCAGCAAGTGCAGTGACA
GAGGCAGTGAAGGCTCAGTTTAAAATTAGTCATCCTGACAGCGAAGACCTTGCTTTTCTA
TATGGAACTATATTAACAGATGGAAAAGACACTTACAATGAGGAACCAACCACCAATATC
TGTGTGTTTGCAGATGAACAGGTTGACAGAAGTCCTACCGGCTCAGGAGTGACAGCCCGA
ATTGCCCTTCAGTATCACAAAGGGCTTCTAGAACTGAACCAGACCAGAGCCTTTAAGAGT
AGTGCAACTGGCTCAGTATTCACAGGGAAGGCTGTGAGGGAAGCAAAATGTGGTGATTTT
AAAGCTGTCATAGTGGAAGTATCCGGACAAGCGCATTACACAGGTACCGCAAGTTTTATA
GTAGAAGATGATGACCCACTGAGGGATGGATTTCTTCTCAAATAA
Enzyme 6 GenBank Gene ID BC104573 Link Image
Enzyme 6 GeneCard ID Not Available
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Not Available
Enzyme 6 Locus Not Available
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References Not Available
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 1016
Enzyme 7 Name Pyrroline-5-carboxylate reductase 3
Enzyme 7 Synonyms
  1. P5C reductase 3
  2. P5CR 3
  3. Pyrroline-5-carboxylate reductase-like protein
Enzyme 7 Gene Name PYCRL
Enzyme 7 Protein Sequence >Pyrroline-5-carboxylate reductase 3
MAAAAEESGWRRVGFVGAGRMAEAIAQGLIQAGKVEAEHVLASAPSDRNLCRFRAMGCQT
THSNLEVLHSCSLVFFATKPHILPAVLVEVAPAVTAEHILVSVAAGVSLSTLEKLLPPMA
RVLRVSPNLPCIVQEGAMVMARGCCAGSYEAQLLRSLLEACGQCEEVPEAQVDVHTGLSG
SGVAFVCAFSEALAEGAIKMGMPSGLAHRIAAQTLLGTAKVLLQKGQHPAQLRTDVCTPG
GTTIYGLHVLEQGGLRATAMSAVEAATCRARELSRNPSPVVAQVPSVLQALQGEGALAHR
EHSSVARS
Enzyme 7 Number of Residues 308
Enzyme 7 Molecular Weight 32034.8
Enzyme 7 Theoretical pI 7.26
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Amino acid transport and metabolism
Enzyme 7 Specific Function L-proline + NAD(P)(+) = 1-pyrroline-5- carboxylate + NAD(P)H
Enzyme 7 Pathways
  • Amino-acid biosynthesis
  • L-proline biosynthesis
  • L- proline from L-glutamate 5-semialdehyde:step 1/1
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • None
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 61554949 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q58D08 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name P5CR3_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >927 bp
ATGGCGGCGGCGGCGGAGGAGTCCGGCTGGAGGCGAGTGGGCTTCGTGGGCGCGGGCCGC
ATGGCGGAGGCCATCGCCCAGGGCCTCATCCAAGCAGGAAAAGTGGAAGCTGAGCACGTG
CTGGCCAGCGCGCCCTCCGACAGGAACCTCTGCCGTTTCCGGGCCATGGGCTGCCAGACC
ACCCACTCCAACCTGGAGGTGCTGCATAGCTGCTCCCTCGTCTTCTTCGCCACCAAACCC
CACATCCTGCCGGCTGTGCTGGTGGAGGTGGCTCCTGCCGTCACTGCTGAGCACATCTTG
GTGTCTGTGGCCGCCGGGGTGTCCCTAAGCACCCTGGAGAAGCTGCTGCCCCCGATGGCT
CGGGTGCTCAGGGTCTCACCCAACCTGCCCTGCATCGTCCAGGAGGGTGCCATGGTGATG
GCGCGGGGCTGCTGCGCTGGGAGCTATGAGGCCCAGCTCCTGCGGTCCCTGCTGGAGGCC
TGTGGGCAGTGCGAGGAGGTGCCTGAGGCCCAGGTGGACGTCCATACCGGCCTCAGCGGC
AGCGGCGTAGCCTTTGTGTGTGCCTTCTCCGAGGCCTTGGCCGAAGGTGCCATCAAAATG
GGCATGCCCAGTGGCCTGGCCCACCGCATTGCTGCCCAGACCCTGCTGGGGACGGCCAAG
GTGCTTCTGCAGAAGGGGCAGCACCCAGCTCAGCTGCGGACTGACGTGTGCACGCCGGGC
GGCACTACCATCTACGGGCTCCATGTGCTGGAGCAAGGCGGGCTGCGGGCCACAGCCATG
AGCGCTGTGGAGGCTGCCACCTGCCGGGCCAGGGAGCTCAGCAGGAACCCCTCCCCCGTG
GTGGCTCAGGTCCCCTCTGTCCTGCAAGCCCTGCAGGGAGAAGGGGCCCTGGCCCACAGG
GAACACAGCAGTGTGGCCCGTTCCTAG
Enzyme 7 GenBank Gene ID BT021789 Link Image
Enzyme 7 GeneCard ID PYCRL Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:8
Enzyme 7 Locus 8q24.3
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References
  1. [PubMed Link Image]
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 1018
Enzyme 8 Name Pyrroline-5-carboxylate reductase 2
Enzyme 8 Synonyms
  1. P5C reductase 2
  2. P5CR 2
Enzyme 8 Gene Name PYCR2
Enzyme 8 Protein Sequence >Pyrroline-5-carboxylate reductase 2
MSVGFIGAGQLACALARGFTAAGILSAHKIIASSPEMDLPTVSALRKMGVNLTRSNKETV
RHSDVLFLAVKPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRC
MTNTPVLVREGATVYATGTHALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAY
AFMALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLDSEQHPGQLKDNVCSPGGATIH
ALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVTTL
TPTSSGKLLTRSPVPGGKKD
Enzyme 8 Number of Residues 320
Enzyme 8 Molecular Weight 33629.8
Enzyme 8 Theoretical pI 8.15
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Amino acid transport and metabolism
Enzyme 8 Specific Function L-proline + NAD(P)(+) = 1-pyrroline-5- carboxylate + NAD(P)H
Enzyme 8 Pathways
  • Amino-acid biosynthesis
  • L-proline biosynthesis
  • L- proline from L-glutamate 5-semialdehyde:step 1/1
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • None
Enzyme 8 Transmembrane Regions
  • None
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 109659198 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID Q17QJ7 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name P5CR2_BOVIN Link Image
Enzyme 8 PDB ID Not Available
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence >963 bp
ATGAGCGTGGGTTTCATCGGCGCCGGCCAGCTGGCCTGCGCCTTGGCGCGGGGCTTCACG
GCCGCAGGCATCCTGTCGGCTCACAAAATAATAGCCAGCTCCCCGGAAATGGACCTGCCC
ACGGTGTCCGCTCTCAGGAAGATGGGTGTGAACCTGACCCGGAGCAACAAGGAGACGGTC
AGGCACAGTGACGTCCTGTTCCTGGCCGTGAAGCCACACATCATCCCCTTTATCCTGGAC
GAGATCGGTGCCGACGTCCAGGCCAGGCACATCGTGGTGTCCTGTGCGGCTGGCGTCACC
ATCAGCTCTGTGGAAAAGAAGCTGATGGCGTTCCAGCCGGCACCCAAAGTGATCCGCTGC
ATGACCAACACACCTGTGTTGGTGCGGGAGGGTGCAACAGTGTATGCCACAGGCACCCAC
GCCTTGGTGGAGGACGGGCAGCTCCTGGAGCAGCTCATGAGCAGCGTGGGCTTCTGCACG
GAGGTGGAGGAGGACCTGATCGATGCCGTCACAGGGCTCAGCGGCAGCGGGCCTGCCTAT
GCGTTCATGGCCCTGGACGCATTGGCTGACGGTGGGGTGAAGATGGGCCTGCCACGGCGC
CTGGCCGTCCGACTGGGGGCCCAGGCCTTGCTGGGAGCTGCCAAGATGCTGCTGGACTCA
GAACAGCATCCCGGCCAGCTCAAGGACAACGTGTGCTCCCCTGGGGGGGCCACCATCCAC
GCCCTGCACTTCCTAGAGAGCGGGGGCTTCCGCTCCCTGCTCATCAATGCGGTTGAGGCC
TCCTGTATCCGAACACGAGAGCTGCAGTCCATGGCTGACCAAGAGAAGATCTCCCCAGCT
GCCCTCAAGAAGACCCTCCTGGACAGAGTGAAGCTGGAATCCCCCACAGTGACCACACTG
ACCCCAACCAGCTCAGGGAAGCTCCTCACGAGAAGCCCAGTCCCAGGAGGCAAGAAGGAC
TAA
Enzyme 8 GenBank Gene ID BC118324 Link Image
Enzyme 8 GeneCard ID PYCR2 Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:1
Enzyme 8 Locus 1q42.12
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References Not Available
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 1024
Enzyme 9 Name Pyrroline-5-carboxylate reductase 1, mitochondrial
Enzyme 9 Synonyms
  1. P5C reductase 1
  2. P5CR 1
Enzyme 9 Gene Name PYCR1
Enzyme 9 Protein Sequence >Pyrroline-5-carboxylate reductase 1, mitochondrial
MSVGFIGAGQLAFALAKGFTAAGVVAAHKIMASSPDMDLATVSALRKMGVNLTHHNKETV
QHSDVLFLAVKPHIIPFILDEIAANIEARHIVVSCAAGVTISSIEKKLTAFQPAPKVIRC
MTNTPVVVREGATVYATGTHAQVEDGRLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAY
AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLDSEQHPGQLKDNVCSPGGATIH
ALHVLESGGFRSLLIKAVEASCTRTRELQSMADQEKVSPAAIKKTILDKVKLDSPPGTSL
APSGHSKLLPRSMAPAGKQD
Enzyme 9 Number of Residues 320
Enzyme 9 Molecular Weight 33453.5
Enzyme 9 Theoretical pI 7.97
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Amino acid transport and metabolism
Enzyme 9 Specific Function Involved in the cellular response to oxidative stress
Enzyme 9 Pathways
  • Amino-acid biosynthesis
  • L-proline biosynthesis
  • L- proline from L-glutamate 5-semialdehyde:step 1/1
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • None
Enzyme 9 Transmembrane Regions
  • None
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 61553164 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID Q58DT4 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name P5CR1_BOVIN Link Image
Enzyme 9 PDB ID Not Available
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence >963 bp
ATGAGCGTGGGCTTCATCGGGGCTGGCCAGTTGGCCTTTGCGCTGGCCAAGGGCTTCACA
GCAGCAGGTGTTGTTGCTGCCCACAAGATAATGGCCAGTTCTCCAGACATGGACCTGGCC
ACCGTTTCTGCCCTCAGGAAGATGGGGGTGAACCTCACGCATCACAACAAGGAGACCGTG
CAGCACAGCGACGTGCTCTTCCTGGCCGTGAAGCCACACATCATCCCCTTCATCCTGGAT
GAGATCGCCGCCAACATTGAGGCTCGGCACATCGTGGTGTCCTGTGCAGCCGGTGTCACC
ATCAGCTCCATTGAGAAGAAGCTGACGGCGTTCCAGCCAGCTCCCAAAGTCATCCGCTGC
ATGACCAACACGCCGGTCGTGGTGCGGGAAGGGGCCACAGTGTATGCCACAGGCACCCAT
GCCCAGGTGGAGGACGGCAGGCTCCTGGAGCAGCTCATGAGCAGCGTGGGCTTCTGCACG
GAGGTGGAGGAGGACCTGATTGATGCCGTCACAGGGCTCAGTGGCAGTGGCCCAGCCTAT
GCATTCACAGCCCTGGACGCACTGGCTGATGGAGGTGTGAAGATGGGACTTCCAAGACGC
CTGGCAGTCCGCCTCGGGGCCCAGGCTCTGCTGGGGGCTGCCAAGATGCTACTGGACTCT
GAACAGCACCCAGGCCAACTCAAGGACAACGTCTGCTCACCAGGCGGGGCCACGATCCAT
GCGTTGCACGTGCTGGAGAGTGGGGGCTTTCGCTCGCTGCTCATCAAGGCCGTGGAGGCC
TCCTGCACCCGCACACGAGAGCTGCAGTCCATGGCCGACCAGGAGAAGGTCTCACCAGCT
GCCATCAAGAAAACCATCCTGGACAAGGTGAAACTGGACTCCCCTCCCGGCACCTCGCTG
GCCCCTTCTGGCCACTCCAAGCTGCTGCCCCGCAGCATGGCCCCAGCAGGCAAACAGGAC
TGA
Enzyme 9 GenBank Gene ID BT021513 Link Image
Enzyme 9 GeneCard ID PYCR1 Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Chromosome:1
Enzyme 9 Locus 17q25.3
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References
  1. [PubMed Link Image]
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 1254
Enzyme 10 Name Cathepsin Z
Enzyme 10 Synonyms Not Available
Enzyme 10 Gene Name CTSZ
Enzyme 10 Protein Sequence >Cathepsin Z
MASSGPLVPPLLLLLVLLAGAARAGLHFRPGRGCYRPLRGDRLTQLGRRTYPRPHEYLSP
SDLPKSWDWRNVNGVNYASVTRNQHIPQYCGSCWAHGSTSAMADRINIKRKGAWPSTLLS
VQHVIDCGDAGSCEGGNDLPVWEYAHRHGIPDETCNNYQAKDQECDKFNQCGTCTEFKEC
HVIKNYTLWKVGDYGSLSGREKMMAEIYTNGPISCGIMATEKMSNYTGGIYSEYNDQAFI
NHIVSVAGWGVSDGMEYWIVRNSWGEPWGEHGWMRIVTSTYKGGEGARYNLAIEESCTFG
DPIV
Enzyme 10 Number of Residues 304
Enzyme 10 Molecular Weight 33885.9
Enzyme 10 Theoretical pI 7.01
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Involved in cysteine-type endopeptidase activity
Enzyme 10 Specific Function Exhibits carboxy-monopeptidase as well as carboxy- dipeptidase activity
Enzyme 10 Pathways Not Available
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • 1-24
Enzyme 10 Transmembrane Regions
  • None
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 113912012 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID P05689 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name CATZ_BOVIN Link Image
Enzyme 10 PDB ID Not Available
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >915 bp
ATGGCGTCGTCCGGGCCGCTGGTGCCTCCGCTGCTGCTGCTGCTCGTGCTGCTGGCGGGC
GCGGCGCGGGCCGGCCTCCACTTCCGCCCGGGCCGCGGCTGCTACCGGCCTCTTCGGGGA
GACCGGCTCACCCAACTGGGGCGCAGGACGTACCCCCGGCCTCATGAGTACCTGTCCCCG
TCGGATCTCCCCAAGAGCTGGGACTGGCGCAATGTGAATGGGGTCAACTACGCCAGTGTC
ACCAGAAACCAGCACATCCCCCAGTACTGTGGCTCCTGCTGGGCACATGGCAGCACCAGT
GCCATGGCGGACCGGATCAACATCAAGAGGAAGGGGGCGTGGCCGTCCACACTGTTGTCG
GTGCAGCACGTGATCGACTGTGGCGACGCGGGCTCTTGTGAGGGGGGCAACGACCTGCCG
GTGTGGGAGTATGCCCACCGGCACGGCATCCCCGACGAGACCTGCAACAACTACCAGGCC
AAGGACCAAGAGTGTGACAAGTTTAACCAGTGTGGGACGTGCACTGAATTCAAAGAGTGC
CATGTCATCAAGAACTACACCCTCTGGAAGGTCGGTGACTACGGCTCCCTTTCGGGGAGG
GAGAAGATGATGGCAGAAATCTACACCAACGGCCCCATCAGCTGTGGCATAATGGCAACC
GAAAAGATGTCTAACTACACTGGTGGCATCTACTCCGAATACAACGACCAGGCCTTCATA
AACCACATCGTCTCCGTGGCCGGGTGGGGTGTCAGCGATGGCATGGAGTACTGGATTGTC
CGGAACTCGTGGGGAGAACCATGGGGCGAGCACGGCTGGATGCGGATCGTGACCAGCACC
TACAAAGGTGGGGAGGGCGCCCGTTACAACCTGGCCATCGAGGAGAGCTGCACGTTTGGG
GACCCCATTGTTTAA
Enzyme 10 GenBank Gene ID BC122603 Link Image
Enzyme 10 GeneCard ID CTSZ Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:2
Enzyme 10 Locus 20q13
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References
  1. [PubMed Link Image]
Enzyme 10 Metabolite References Not Available