We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for L-Alanine (BMDB00161)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-07-07 11:02:31
Accession Number BMDB00161
Common Name L-Alanine
Description Alanine is a nonessential amino acid made in the body from the conversion of the carbohydrate pyruvate or the breakdown of DNA and the dipeptides carnosine and anserine. It is highly concentrated in muscle and is one of the most important amino acids released by muscle, functioning as a major energy source. Plasma alanine is often decreased when the BCAA (Branched Chain Amino Acids) are deficient. This finding may relate to muscle metabolism. Alanine is highly concentrated in meat products and other high-protein foods like wheat germ and cottage cheese. Alanine is an important participant as well as regulator in glucose metabolism. Alanine levels parallel blood sugar levels in both diabetes and hypoglycemia, and alanine reduces both severe hypoglycemia and the ketosis of diabetes. It is an important amino acid for lymphocyte reproduction and immunity. Alanine therapy has helped dissolve kidney stones in experimental animals. Normal alanine metabolism, like that of other amino acids, is highly dependent upon enzymes that contain vitamin B6. Alanine, like GABA, taurine and glycine, is an inhibitory neurotransmitter in the brain. http://www.dcnutrition.com/AminoAcids/)
Synonyms
  1. (2S)-2-Aminopropanoate
  2. (2S)-2-Aminopropanoic acid
  3. (S)-(+)-Alanine
  4. (S)-2-Aminopropanoate
  5. (S)-2-Aminopropanoic acid
  6. (S)-2-amino-Propanoate
  7. (S)-2-amino-Propanoic acid
  8. (S)-Alanine
  9. 2-Aminopropanoate
  10. 2-Aminopropanoic acid
  11. 2-Aminopropionate
  12. 2-Aminopropionic acid
  13. 2-Ammoniopropanoate
  14. Ala
  15. Alanine
  16. L-(+)-Alanine
  17. L-2-Aminopropanoate
  18. L-2-Aminopropanoic acid
  19. L-2-Aminopropionate
  20. L-2-Aminopropionic acid
  21. L-a-Alanine
  22. L-a-Aminopropionate
  23. L-a-Aminopropionic acid
  24. a-Alanine
  25. a-Aminopropionate
  26. a-Aminopropionic acid
  27. alpha-Aminopropanoate
  28. alpha-Aminopropanoic acid
  29. L-alpha-Alanine
  30. L-alpha-Aminopropionate
  31. L-alpha-Aminopropionic acid
  32. alpha-Alanine
  33. alpha-Aminopropionate
  34. alpha-Aminopropionic acid
  35. 2-Ammoniopropanoic acid
Chemical IUPAC Name (2S)-2-aminopropanoic acid
Chemical Formula C3H7NO2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Amino Acids
Sub Class
  • NA
Family
  • Mammalian_Metabolite
Species
  • primary amine; primary aliphatic amine (alkylamine); carboxylic acid; alpha-aminoacid
Biofunction
  • Component of Alanine and aspartate metabolism; Component of Aminoacyl-tRNA biosynthesis; Component of Glutamate metabolism; Component of Glycine, serine and threonine metabolism; Component of Tryptophan metabolism
Application
Source
  • Endogenous
Average Molecular Weight 89.093
Monoisotopic Molecular Weight 89.047676
Isomeric SMILES C[C@H](N)C(O)=O
Canonical SMILES CC(N)C(O)=O
KEGG Compound ID C00041 Link Image
BioCyc ID L-ALPHA-ALANINE Link Image
BiGG ID 33629 Link Image
Wikipedia Link 2-Aminopropanoic acid Link Image
METLIN ID Not Available
PubChem Compound 5950 Link Image
PubChem Substance 700553 Link Image
ChEBI ID 16977 Link Image
CAS Registry Number 56-41-7
InChI Identifier InChI=1/C3H7NO2/c1-2(4)3(5)6/h2H,4H2,1H3,(H,5,6)/t2-/m0/s1
Synthesis Reference Chibata I; Kakimoto T; Kato J Enzymatic production of L-alanine by Pseudomonas dacunhae. Applied microbiology (1965), 13(5), 638-45.
Melting Point (Experimental) 300 oC
Experimental Water Solubility 164.0 mg/mL [YALKOWSKY,SH & DANNENFELSER,RM (1992)]; 204 mg/mL [HMP experimental] Source: PhysProp
Predicted Water Solubility 446.99997 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity -2.85 [SANGSTER (1994)] Source: PhysProp
Predicted LogP/Hydrophobicity -3.05 [Predicted by ALOGPS]; -2.8 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID 1KL6 Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Show Image
Show Peaklist
BMRB Spectrum Show Image
Show Peaklist
Cellular Location
  • Cytoplasm
  • Extracellular
  • lysosome
  • mitochondria
  • peroxisome
Biofluid Location
  • Blood
  • Breast_Milk
  • Rumen
Tissue Location
Tissue References
All Tissues
Concentrations (Normal)
Biofluid Blood
Value 160.5 uM
Age N/A
Sex Both
Condition Normal
Comments Not Available
References
Biofluid Breast_Milk
Value 9 - 91 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. skim.
References
Biofluid Breast_Milk
Value 11673.195 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, Skim.
References
Biofluid Breast_Milk
Value 12234.407 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, fluid, partly skimmed, 1% milkfat.
References
Biofluid Breast_Milk
Value 12795.618 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, fluid, partly skimmed, 2% milkfat.
References
Biofluid Breast_Milk
Value 11673.195 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, whole, pasteurized, homogenized, 3.3% milkfat.
References
Biofluid Breast_Milk
Value 13132.345 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, fluid, whole, producer, 3.7% milkfat.
References
Biofluid Breast_Milk
Value 36 +/- 10 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 2% milk
References
Biofluid Breast_Milk
Value 38 +/- 5 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in skim milk
References
Biofluid Breast_Milk
Value 37 +/- 6 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 1% milk
References
Biofluid Breast_Milk
Value 33 +/- 8 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 3.25% milk
References
Biofluid Breast_Milk
Value 42.5 +/- 2.7 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR and DFI-MS in skim milk
References
Biofluid Breast_Milk
Value 37.45 +/- 2.5 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR and DFI-MS in 1% milk
References
Biofluid Breast_Milk
Value 39.6 +/- 2.9 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR and DFI-MS in 2% milk
References
Biofluid Breast_Milk
Value 32.05 +/- 2.4 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR and DFI-MS in 3.25% milk
References
Biofluid Breast_Milk
Value 11923.425 uM
Age NA
Sex NA
Condition Normal
Comments Cow whole milk (3.25% fat)
References
Biofluid Breast_Milk
Value 12849.517 uM
Age NA
Sex NA
Condition Normal
Comments Cow reduced fat milk (2% fat) with added vitamin A
References
Biofluid Breast_Milk
Value 12270.71 uM
Age NA
Sex NA
Condition Normal
Comments Cow reduced fat milk (1% fat) with added vitamin A
References
Biofluid Breast_Milk
Value 11622.892 uM
Age NA
Sex NA
Condition Normal
Comments Cow skim milk with added vitamin A
References
Biofluid Rumen
Value 212.13 +/- 47.03 uM
Age N/A
Sex N/A
Condition Normal
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Biofluid Rumen
Value 480.07 +/- 70.1 uM
Age N/A
Sex N/A
Condition Rumen acidosis
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names
  • Alanine and aspartate metabolism
  • Selenoamino Acid Metabolism
  • Transcription Translation
HMDB Pathways
Name Alanine and aspartate metabolism
Image Show Link Image
Name Selenoamino Acid Metabolism
Image Show Link Image
Name Transcription Translation
Image Show Link Image
KEGG Pathways
Name Alanine and aspartate metabolism
Image Show Link Image
Name Selenoamino Acid Metabolism
Image Show Link Image
SimCell Pathways
Name Alanine and aspartate metabolism
Image Show Link Image
Graph Show Link Image
SBML Download (XML) Link Image
Name Selenoamino Acid Metabolism
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Selenocysteine lyase
  2. Alanine--glyoxylate aminotransferase 2, mitochondrial
  3. Alanine aminotransferase 1
  4. Nuclear inhibitor of protein phosphatase 1
  5. Sodium-coupled neutral amino acid transporter 5
Enzyme 1 [top]
Enzyme 1 ID 539
Enzyme 1 Name Selenocysteine lyase
Enzyme 1 Synonyms Not Available
Enzyme 1 Gene Name SCLY
Enzyme 1 Protein Sequence >Selenocysteine lyase
MEAAGARNRDARSRAEKSPPESRKVYMDYNATTPLEPEVIEAMTEAMREAWGNPSSSYPA
GRKAKEIINTARENLAKMIGGQPQDVIFTSGGTESNNLVIQSVVKHFHKVHAANGDTGGH
PNPVDGALPHIITCTVEHDSIRLPLEHLREERVAEVTFVPVSKVNGQVEAEDILAAVRPA
TCLVTIMLANNETGVIMPVPEISRRVRALNQQRVAGGLPGVLVHTDAAQALGKQRVDVRD
LGVDFLTIVGHKFYGPRIGALYVRGLGEHTPLYPMLFGGGQERNFRPGTENTPMIAGLGK
AAELVAENGEAYEAHMRGVRDYLEERLAAEFGERIHLNSQFPGAERLPNTCNFSIRGPQL
QGRAVLAQCRTLLASVGAACHSDLGDRPSPVLLSCGVPVDVARNAIRLSVGRSSTRAEVD
LVVQDLKQAVARLEGQA
Enzyme 1 Number of Residues 437
Enzyme 1 Molecular Weight 47203.3
Enzyme 1 Theoretical pI 6.99
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Amino acid transport and metabolism
Enzyme 1 Specific Function Catalyzes the decomposition of L-selenocysteine to L- alanine and elemental selenium
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 124829224 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID A2VDS1 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name SCLY_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1314 bp
ATGGAGGCGGCCGGGGCGCGGAACAGGGACGCGCGGAGTCGAGCGGAGAAGAGCCCGCCC
GAGAGCAGGAAAGTGTATATGGACTATAATGCAACCACTCCCCTGGAGCCAGAAGTCATT
GAGGCCATGACGGAGGCCATGCGGGAAGCCTGGGGAAATCCCAGTAGCTCTTACCCAGCA
GGTAGGAAGGCCAAGGAGATTATCAACACGGCCCGGGAGAACCTCGCCAAGATGATAGGT
GGGCAGCCTCAGGACGTGATCTTCACTTCGGGGGGCACCGAGTCAAATAATTTAGTAATC
CAGTCCGTGGTGAAGCACTTCCACAAAGTCCACGCCGCCAACGGGGACACGGGCGGGCAT
CCCAACCCGGTGGACGGGGCCCTGCCCCACATCATCACCTGCACCGTGGAGCACGACTCC
ATCCGCCTGCCACTGGAGCACCTCAGGGAGGAGCGCGTGGCCGAGGTCACCTTCGTCCCT
GTGTCCAAGGTGAATGGGCAGGTGGAGGCTGAGGACATCCTGGCGGCCGTCCGCCCGGCC
ACGTGCCTGGTGACCATCATGCTGGCCAACAACGAGACGGGTGTCATCATGCCCGTGCCT
GAGATCAGCCGGCGAGTCCGAGCCCTGAACCAACAGCGGGTGGCAGGGGGGCTGCCGGGG
GTGCTTGTGCACACGGATGCTGCCCAGGCCCTGGGGAAGCAGCGCGTGGACGTGCGGGAC
CTGGGCGTGGACTTCCTGACCATCGTGGGGCACAAGTTCTACGGCCCCAGGATCGGAGCG
CTCTACGTCCGAGGGCTTGGTGAGCACACCCCTCTCTACCCGATGCTGTTTGGAGGCGGA
CAAGAGCGGAACTTCAGGCCAGGGACAGAGAACACCCCGATGATTGCCGGCCTTGGGAAG
GCGGCCGAGCTGGTGGCGGAGAACGGCGAGGCCTACGAGGCCCACATGCGGGGCGTGCGC
GACTACCTGGAGGAGAGGCTGGCGGCTGAATTTGGTGAGAGAATCCATCTGAACAGCCAG
TTTCCAGGCGCCGAGCGGCTCCCCAACACCTGTAACTTCTCCATCCGGGGACCCCAGCTC
CAAGGCCGCGCGGTGCTGGCTCAGTGCCGGACTCTGCTGGCCAGCGTGGGGGCCGCCTGC
CACTCGGACCTCGGGGACCGGCCGTCCCCAGTGCTGCTGAGCTGCGGCGTCCCCGTCGAC
GTGGCCAGGAACGCCATCCGGCTGAGCGTGGGCCGCAGCAGCACCCGGGCTGAGGTGGAC
CTCGTCGTGCAGGACCTGAAGCAGGCGGTGGCCCGGCTGGAGGGCCAGGCCTAG
Enzyme 1 GenBank Gene ID BC133375 Link Image
Enzyme 1 GeneCard ID SCLY Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:2
Enzyme 1 Locus 2q37.3
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 793
Enzyme 2 Name Alanine--glyoxylate aminotransferase 2, mitochondrial
Enzyme 2 Synonyms
  1. AGT 2
  2. (R)-3-amino-2-methylpropionate--pyruvate transaminase
  3. Beta-alanine-pyruvate aminotransferase
  4. Beta-ALAAT II
  5. D-AIBAT
Enzyme 2 Gene Name AGXT2
Enzyme 2 Protein Sequence >Alanine--glyoxylate aminotransferase 2, mitochondrial
MTGAWGHLLRSLHLKTLSLWIPKTCFSLKARAFWTSVTRCGLHTKPSMPPCDFTPERYQS
LAYSRVLEIHKQHLSPVHTAYFPEPLLLHQGHVEWLFDHEGNRYLDFFSGIVTVSVGHCH
PKVNAAAQRQLGRLWHTSSVFFHPLIHEYAEKLSALLPEPLKVVFLVNSGSEANDLAMLM
ARAHSNSTDIISFRGAYHGCSPYTLGLTNVGIYKMDLPHGMGCQPTMCPDIFHGPWGGSH
CRDSPVQTIRKCSCAPDCCQAKDQYIEQFKDTLSTSVAKSIAGFFAEPIQGVNGVVQYPK
GFLKEAFELVRERGGVCIADEVQTGFGRLGSHFWGFQTHDVLPDIVTMAKGIGNGFPMAA
VVTTPDIAKSLTKRMLHFNTFGGNPMACAVGSAVLEVIKEENLQENSQEVGTYMLLKLAK
LRDEFEIVGDVRGKGLMIGIEMVKDKESRQPLPREEVNQIHHDCKCMGLLIGRGGLFSQT
FRIAPSMCITKPEVDFAVEVFRSALIQHMERRAK
Enzyme 2 Number of Residues 514
Enzyme 2 Molecular Weight 57225.8
Enzyme 2 Theoretical pI 7.93
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Amino acid transport and metabolism
Enzyme 2 Specific Function L-alanine + glyoxylate = pyruvate + glycine
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 109659373 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q17QF0 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name AGT2_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1545 bp
ATGACAGGAGCCTGGGGACATTTGCTGAGATCTTTGCACCTGAAAACCTTATCTCTCTGG
ATCCCCAAGACGTGCTTTTCCCTTAAGGCCCGTGCTTTCTGGACATCTGTGACCAGGTGC
GGTCTTCATACAAAGCCCAGCATGCCGCCATGTGACTTCACACCCGAAAGATACCAGTCC
CTGGCCTATAGCCGAGTCCTGGAGATCCATAAGCAACATCTCTCTCCTGTGCACACCGCC
TATTTCCCGGAGCCCCTGTTGCTCCACCAGGGACACGTGGAGTGGCTCTTTGATCATGAG
GGAAACAGATACCTGGATTTCTTTTCTGGGATTGTCACTGTCAGTGTTGGTCACTGCCAC
CCAAAAGTAAACGCAGCGGCGCAAAGGCAGCTGGGCCGCCTGTGGCATACAAGTTCTGTC
TTCTTCCACCCTCTGATCCACGAATATGCAGAGAAGCTTTCAGCACTTCTTCCTGAGCCT
TTGAAGGTCGTTTTCTTGGTGAACAGTGGTTCAGAAGCCAATGACCTAGCCATGCTGATG
GCCAGAGCACACTCAAACAGCACAGACATCATTTCTTTCAGAGGAGCCTACCATGGATGC
AGTCCTTACACACTTGGCTTGACAAATGTAGGCATCTATAAGATGGACCTCCCTCATGGG
ATGGGCTGCCAACCAACAATGTGCCCAGACATTTTCCATGGCCCTTGGGGAGGAAGCCAC
TGCCGAGATTCTCCAGTGCAAACAATTAGGAAGTGCAGCTGTGCGCCAGACTGCTGTCAA
GCTAAAGACCAGTATATTGAACAATTCAAAGATACTCTGAGCACTTCTGTGGCCAAATCA
ATTGCTGGATTTTTTGCAGAGCCAATTCAAGGGGTGAATGGCGTTGTTCAGTACCCGAAG
GGGTTTCTAAAGGAAGCCTTCGAGCTGGTGCGCGAGCGGGGAGGCGTGTGCATTGCAGAT
GAAGTGCAGACAGGATTTGGAAGGCTGGGCTCTCACTTCTGGGGCTTCCAAACACACGAT
GTCCTGCCAGATATTGTTACCATGGCTAAAGGGATTGGGAATGGCTTTCCCATGGCAGCA
GTCGTGACAACTCCAGATATTGCCAAGTCCTTAACCAAGCGCATGCTTCACTTCAATACC
TTTGGAGGGAACCCCATGGCCTGCGCCGTTGGTTCAGCAGTGCTTGAGGTGATTAAAGAA
GAAAATCTACAAGAAAATAGCCAAGAAGTTGGCACCTATATGTTGCTGAAGTTGGCTAAG
CTGCGGGATGAATTTGAAATTGTAGGAGATGTCCGAGGCAAAGGTCTCATGATAGGAATA
GAAATGGTGAAGGATAAGGAGAGCCGCCAGCCTCTTCCCCGTGAAGAAGTAAATCAAATC
CACCACGACTGCAAATGCATGGGGCTTCTGATTGGCAGAGGCGGCCTTTTCTCTCAGACT
TTCCGCATTGCGCCCTCAATGTGCATCACTAAACCAGAAGTTGATTTTGCAGTGGAAGTG
TTTCGCTCTGCCTTAATTCAACACATGGAGAGAAGAGCTAAATAA
Enzyme 2 GenBank Gene ID BC118402 Link Image
Enzyme 2 GeneCard ID AGXT2 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:5
Enzyme 2 Locus 5p13
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 858
Enzyme 3 Name Alanine aminotransferase 1
Enzyme 3 Synonyms
  1. ALT1
  2. Glutamic--pyruvic transaminase 1
  3. Glutamate pyruvate transaminase 1
  4. GPT 1
  5. Glutamic--alanine transaminase 1
Enzyme 3 Gene Name GPT
Enzyme 3 Protein Sequence >Alanine aminotransferase 1
MALRAGEHSQEAANGLKEKVLTLDSMNPYVRRVEYAVRGPIVQRALELEQELRQGVKKPF
TEVIRANIGDAQAMGQIPITFPRQVLALCVHPDLLNSPDFPDDAKRRAERILQACGGHSL
GAYSISAGVQMIREDVARYIERRDGGIPADPNNIFLSTGASDAIVTVLKLLVTGEGRTRT
GVLIPIPQYPLYSAALAEFNAVQVDYYLDEERAWALDVAELRRALRQARDHCRPRALCVI
NPGNPTGQVQTRECIEDVIRFAYEEKLFLLADEVYQDNVYAESSQFHSFKKVLTEMGPPY
AAQQELASFHSISKGYMGECGFRGGYVEVVNMDAAVKQQMQKLRSVRLCPPTPGQVLLDV
AVSPPAPSDPSFPRFQAERRAVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPRVQL
PPRAVQRAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPMEKLRPL
LEKLSQFHAKFTREYS
Enzyme 3 Number of Residues 496
Enzyme 3 Molecular Weight 55275.0
Enzyme 3 Theoretical pI 7.42
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Amino acid transport and metabolism
Enzyme 3 Specific Function Participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles
Enzyme 3 Pathways
  • Amino-acid degradation
  • L-alanine degradation via transaminase pathway
  • pyruvate from L-alanine:step 1/1
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 134024764 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID A4IFH5 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name ALAT1_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1491 bp
ATGGCCTTGAGGGCAGGTGAGCACAGCCAGGAGGCAGCAAATGGGCTGAAGGAGAAGGTG
CTGACACTGGACTCCATGAATCCTTATGTCCGGAGGGTGGAGTATGCGGTGCGAGGCCCC
ATCGTTCAGCGGGCACTGGAGCTGGAGCAGGAGCTGCGCCAGGGCGTAAAGAAGCCCTTC
ACCGAGGTCATCCGCGCCAACATCGGGGACGCACAGGCCATGGGGCAGATCCCTATCACC
TTCCCGCGCCAGGTCCTGGCCCTCTGCGTCCATCCCGATCTCCTGAACAGCCCCGACTTC
CCCGACGACGCCAAGAGGAGGGCGGAGCGCATCTTGCAGGCGTGTGGGGGCCACAGCCTG
GGGGCCTACAGCATCAGCGCTGGCGTCCAGATGATCCGTGAGGATGTGGCGCGGTACATC
GAGCGGCGCGATGGAGGCATTCCTGCCGACCCCAATAACATCTTTCTGTCCACGGGGGCC
AGCGATGCCATTGTGACGGTGCTGAAGTTGCTGGTAACCGGCGAGGGTCGCACGCGCACG
GGCGTGCTTATCCCTATCCCTCAGTATCCACTCTACTCCGCCGCGCTGGCCGAGTTCAAT
GCGGTGCAGGTGGACTACTACCTGGACGAGGAGCGTGCCTGGGCGCTCGATGTGGCCGAG
CTGCGGCGCGCGCTGCGCCAGGCGCGTGACCACTGCCGCCCCCGCGCGCTCTGCGTCATC
AACCCCGGGAACCCCACCGGGCAGGTGCAGACCCGCGAGTGCATCGAGGACGTGATCCGC
TTCGCCTATGAGGAGAAGCTTTTCCTATTGGCCGATGAGGTGTACCAAGACAACGTGTAT
GCCGAGAGCTCGCAGTTCCACTCGTTCAAGAAGGTGCTCACGGAGATGGGGCCGCCGTAC
GCGGCGCAACAGGAGCTCGCCTCCTTCCACTCGATCTCCAAGGGCTACATGGGCGAGTGC
GGCTTCCGCGGCGGCTACGTGGAGGTGGTGAATATGGACGCTGCGGTGAAGCAGCAGATG
CAGAAGCTGCGGAGCGTGCGGCTGTGCCCACCCACCCCGGGCCAGGTCCTGCTCGACGTG
GCTGTCAGCCCGCCGGCGCCCTCAGACCCCTCCTTCCCGCGGTTCCAGGCGGAGAGGAGG
GCGGTGCTGGCCGAGCTGGCTGCCAAGGCCAAGCTCACGGAGCAGGTCTTCAACGAAGCT
CCCGGCATCCGCTGCAATCCGGTGCAGGGCGCCATGTATTCGTTCCCGCGCGTGCAGCTG
CCCCCGCGTGCGGTGCAGCGCGCTCAGGAGCTGGGCCTGGCTCCCGACATGTTCTTCTGC
CTGCGCCTCCTAGAGGAGACTGGCATCTGCGTGGTGCCTGGGAGTGGCTTTGGACAACGG
GAAGGCACCTACCACTTTCGGATGACTATTCTGCCCCCCATGGAGAAGCTACGGCCCCTG
CTGGAGAAGCTGAGCCAGTTCCATGCGAAGTTCACCCGCGAGTACTCCTGA
Enzyme 3 GenBank Gene ID BC134583 Link Image
Enzyme 3 GeneCard ID GPT Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:8
Enzyme 3 Locus 8q24.3
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 911
Enzyme 4 Name Nuclear inhibitor of protein phosphatase 1
Enzyme 4 Synonyms
  1. NIPP-1
  2. Protein phosphatase 1, regulatory inhibitor subunit 8
Enzyme 4 Gene Name PPP1R8
Enzyme 4 Protein Sequence >Nuclear inhibitor of protein phosphatase 1
MAAAANSGSSLPLFDCPTWAGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDF
TIDHQSCSRVHAALVYHKHLKRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGAS
TRAYTLREKPQTLPSAVKGDEKMGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTL
TIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEG
PGSLVLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPD
VDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
Enzyme 4 Number of Residues 351
Enzyme 4 Molecular Weight 38520.6
Enzyme 4 Theoretical pI 7.42
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in DNA binding
Enzyme 4 Specific Function Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1). It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Seems to be required for cell proliferation
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 1082086 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q28147 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name PP1R8_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >1056 bp
ATGGCGGCAGCCGCGAACTCCGGCTCCAGCCTCCCGCTGTTCGACTGCCCGACCTGGGCA
GGTAAACCCCCTCCTGGTTTACATCTGGATGTAGTCAAAGGAGACAAGCTAATTGAGAAA
CTGATTATCGATGAGAAGAAGTATTACTTATTTGGGCGAAACCCTGATTTGTGCGACTTC
ACAATTGACCACCAGTCTTGCTCTCGGGTCCATGCTGCCTTGGTCTACCACAAGCATCTG
AAGAGAGTTTTCCTTATAGATCTCAACAGTACACACGGCACTTTCTTGGGTCACATTCGG
TTGGAGCCTCACAAGCCTCAGCAAATTCCCATCGACTCCACGGTCTCATTTGGTGCATCC
ACACGGGCATACACTCTCCGTGAGAAGCCTCAGACATTGCCATCAGCTGTGAAAGGAGAT
GAGAAGATGGGTGGAGAGGATGATGAACTCAAGGGCTTACTGGGGCTTCCCGAGGAGGAG
ACAGAACTTGATAACCTGACAGAATTCAACACTGCCCACAACAAGCGGATTTCCACTCTC
ACCATTGAGGAGGGGAATCTGGACATTCAGAGACCAAAGAGGAAGAGGAAGAACTCACGG
GTGACCTTTAGTGAGGATGATGAGATCATCAACCCAGAGGATGTGGATCCCTCGGTTGGT
CGCTTTCGGAACATGGTGCAGACTGCAGTGGTCCCAGTCAAGAAGAAGCGGGTGGAGGGC
CCTGGCTCCCTGGTCCTGGAGGAATCCGGGAGCAGGCGCATGCAGAACTTTGCCTTCAGT
GGAGGACTCTACGGGGGCCTGCCCCCCACGCACAGTGAAGCTGGCTCCCAGCCACACGGC
ATCCATGGGACAGCACTCATTGGTGGCTTGCCCATGCCATACCCGAACCTTGCTCCTGAT
GTGGACTTGACCCCTGTTGTGCCATCAGCAGTGAACATGAACCCTGCACCAAACCCTGCC
GTCTATAACCCCGAAGCTGTCAACGAACCCAAGAAGAAGAAATACGCAAAAGAGGCGTGG
CCGGGCAAGAAGCCCACACCTTCCTTACTGATTTGA
Enzyme 4 GenBank Gene ID Z50748 Link Image
Enzyme 4 GeneCard ID PPP1R8 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 1p35
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 2092
Enzyme 5 Name Sodium-coupled neutral amino acid transporter 5
Enzyme 5 Synonyms
  1. System N transporter 2
  2. Solute carrier family 38 member 5
Enzyme 5 Gene Name SLC38A5
Enzyme 5 Protein Sequence >Sodium-coupled neutral amino acid transporter 5
MAISSAEGMELQDPKMNGALPGNAVEQEHEGFLPSHSPSPGRKPAQFMDFEGKTSFGMSV
FNLSNAIMGSGILGLAYAMAHTGILLFLALLLCIALLSSYSIHLLLTCAGVVGIRAYEQL
GQRALGPAGKVVVAAVICLHNVGAMSSYLFIIKSELPLVIATFLDMDPEGDWFLKGNLLI
IIVSVLIILPLALMRHLGYLGYTSGLSLTCMLFFLISVIYKKFQLGCTVGHNGTAVESKS
SPSLPIHGLNTSCEAQMFTADSQMFYTVPIMAFAFVCHPEVLPIYTELCRPSKRRMQAVA
NVSIGAMFCMYGLTATFGYLTFYSSVEAEMLHMYSQHDLLILCVRLAVLLAVTLTVPVVL
FPIRRALQQLLFPSKAFSWPRHVAIALILLVLVNVLVICVPTIRDIFGVIGSTSAPSLIF
ILPSIFYLRIVPSEVEPLYSWPKIQALCFGVLGVLFMAISLGFMFANWATGQSHVSGH
Enzyme 5 Number of Residues 478
Enzyme 5 Molecular Weight 51957.3
Enzyme 5 Theoretical pI 7.51
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Amino acid transport and metabolism
Enzyme 5 Specific Function Functions as a sodium-dependent amino acid transporter which countertransport protons. Mediates the saturable, pH- sensitive, and electrogenic cotransport of several neutral amino acids including glycine, asparagine, alanine, serine, glutamine and histidine with sodium
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • 58-80 94-114 132-152 173-193 199-219 264-284 302-322 341-361 383-403 406-426 446-466
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 59858047 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID Q5E9S9 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name S38A5_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >1437 bp
ATGGCCATCTCGTCTGCTGAGGGGATGGAACTGCAGGATCCAAAGATGAACGGAGCCCTC
CCTGGGAATGCTGTGGAGCAGGAGCATGAGGGCTTCCTGCCTAGCCATAGTCCTTCTCCT
GGGAGGAAACCGGCCCAGTTCATGGATTTCGAGGGGAAGACATCGTTTGGAATGTCAGTG
TTCAACCTCAGCAACGCCATCATGGGCAGCGGCATCCTGGGGCTGGCCTATGCCATGGCC
CACACGGGGATCCTCCTCTTCCTGGCTTTGTTGCTGTGCATCGCTCTTCTGTCTTCGTAC
TCCATCCATCTCCTGCTGACCTGTGCTGGTGTTGTAGGCATCCGAGCCTATGAACAGCTG
GGACAGAGGGCGCTGGGGCCTGCGGGGAAAGTAGTGGTGGCGGCGGTCATCTGTCTGCAC
AATGTTGGGGCCATGTCCAGTTACCTGTTCATCATCAAATCCGAACTTCCCCTGGTTATC
GCCACTTTCCTGGACATGGACCCTGAGGGGGACTGGTTCTTGAAGGGAAACCTCCTTATC
ATCATTGTCAGTGTTTTAATCATCCTGCCACTGGCCCTCATGAGACACTTGGGCTACCTG
GGGTATACCAGTGGTCTCTCTCTGACCTGTATGCTGTTTTTCCTCATTTCGGTCATCTAT
AAGAAGTTCCAGCTTGGCTGCACTGTAGGCCACAATGGAACAGCAGTGGAGAGCAAGAGC
TCCCCAAGCCTTCCCATCCATGGGCTCAACACAAGCTGTGAGGCCCAGATGTTCACAGCT
GACTCACAGATGTTCTACACAGTGCCCATTATGGCTTTTGCCTTTGTCTGCCACCCTGAA
GTGCTGCCCATCTACACAGAACTCTGCCGGCCCTCCAAGCGCAGAATGCAGGCTGTGGCC
AACGTGTCCATTGGGGCCATGTTCTGCATGTATGGGCTCACGGCGACCTTTGGATACCTC
ACCTTCTACAGCAGCGTGGAGGCGGAGATGCTGCACATGTACAGCCAGCATGACCTGCTC
ATCCTCTGTGTGCGTCTAGCGGTGCTGCTCGCTGTGACTCTCACGGTGCCAGTTGTGCTG
TTCCCTATCCGCCGGGCTCTGCAGCAGCTACTTTTTCCAAGCAAGGCCTTCAGCTGGCCA
CGCCATGTGGCCATAGCACTGATCCTGCTTGTCTTGGTCAATGTTCTTGTCATCTGTGTG
CCAACCATCCGGGATATCTTTGGGGTTATCGGGTCTACCTCAGCCCCCAGCCTCATTTTC
ATCCTTCCCAGCATCTTCTACCTCCGCATTGTGCCCTCTGAGGTGGAGCCCCTCTACTCC
TGGCCCAAGATCCAGGCTCTGTGTTTTGGTGTCTTGGGGGTCCTCTTCATGGCGATCAGC
CTAGGTTTCATGTTTGCCAACTGGGCCACAGGCCAGAGCCATGTATCTGGACACTGA
Enzyme 5 GenBank Gene ID BT020841 Link Image
Enzyme 5 GeneCard ID SLC38A5 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Not Available
Enzyme 5 Locus Xp11.23
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References
  1. [PubMed Link Image]
Enzyme 5 Metabolite References Not Available