We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for L-Tyrosine (BMDB00158)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-10-28 12:37:31
Accession Number BMDB00158
Common Name L-Tyrosine
Description Tyrosine is an essential amino acid that readily passes the blood-brain barrier. Once in the brain, it is a precursor for the neurotransmitters dopamine, norepinephrine and epinephrine, better known as adrenalin. These neurotransmitters are an important part of the body's sympathetic nervous system, and their concentrations in the body and brain are directly dependent upon dietary tyrosine. Tyrosine is not found in large concentrations throughout the body, probably because it is rapidly metabolized. Folic acid, copper and vitamin C are cofactor nutrients of these reactions. Tyrosine is also the precursor for hormones, thyroid, catecholestrogens and the major human pigment, melanin. Tyrosine is an important amino acid in many proteins, peptides and even enkephalins, the body's natural pain reliever. Valine and other branched amino acids, and possibly tryptophan and phenylalanine may reduce tyrosine absorption. A number of genetic errors of tyrosine metabolism occur. Most common is the increased amount of tyrosine in the blood of premature infants, which is marked by decreased motor activity, lethargy and poor feeding. Infection and intellectual deficits may occur. Vitamin C supplements reverse the disease. Some adults also develop elevated tyrosine in their blood. This indicates a need for more vitamin C. More tyrosine is needed under stress, and tyrosine supplements prevent the stress-induced depletion of norepinephrine and can cure biochemical depression. However, tyrosine may not be good for psychosis. Many antipsychotic medications apparently function by inhibiting tyrosine metabolism. L-dopa, which is directly used in Parkinson's, is made from tyrosine. Tyrosine, the nutrient, can be used as an adjunct in the treatment of Parkinson's. Peripheral metabolism of tyrosine necessitates large doses of tyrosine, however, compared to L-dopa. (http://www.dcnutrition.com)
Synonyms
  1. (-)-a-Amino-p-hydroxyhydrocinnamate
  2. (-)-a-Amino-p-hydroxyhydrocinnamic acid
  3. (-)-alpha-Amino-p-hydroxyhydrocinnamate
  4. (-)-alpha-Amino-p-hydroxyhydrocinnamic acid
  5. (S)-(-)-Tyrosine
  6. (S)-2-Amino-3-(p-hydroxyphenyl)propionate
  7. (S)-2-Amino-3-(p-hydroxyphenyl)propionic acid
  8. (S)-3-(p-Hydroxyphenyl)alanine
  9. (S)-Tyrosine
  10. (S)-a-Amino-4-hydroxybenzenepropanoate
  11. (S)-a-Amino-4-hydroxybenzenepropanoic acid
  12. (S)-a-amino-4-hydroxy-Benzenepropanoate
  13. (S)-a-amino-4-hydroxy-Benzenepropanoic acid
  14. (S)-alpha-amino-4-hydroxy-Benzenepropanoate
  15. (S)-alpha-amino-4-hydroxy-Benzenepropanoic acid
  16. 2-amino-3-(4-hydroxyphen yl)-2-amino-3-(4-hydroxyphenyl)-Propanoate
  17. 2-amino-3-(4-hydroxyphen yl)-2-amino-3-(4-hydroxyphenyl)-Propanoic acid
  18. 3-(4-Hydroxyphenyl)-L-alanine
  19. 4-hydroxy-L-Phenylalanine
  20. Benzenepropanoate
  21. Benzenepropanoic acid
  22. L-p-Tyrosine
  23. L-tyrosine
  24. Tyr
  25. Tyrosine
  26. p-Tyrosine
  27. (S)-alpha-Amino-4-hydroxybenzenepropanoate
  28. (S)-alpha-Amino-4-hydroxybenzenepropanoic acid
Chemical IUPAC Name 2-amino-3-(4-hydroxyphenyl)-propanoic acid
Chemical Formula C9H11NO3
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Amino Acids
Sub Class
  • NA
Family
  • Mammalian_Metabolite
Species
  • phenol or hydroxyhetarene; primary amine; primary aliphatic amine (alkylamine); carboxylic acid; aromatic compound; alpha-aminoacid
Biofunction
  • Component of Aminoacyl-tRNA biosynthesis; Component of Novobiocin biosynthesis; Component of Phenylalanine metabolism; Component of Phenylalanine, tyrosine and tryptophan biosynthesis; Component of Riboflavin metabolism; Component of Stilbene, coumarine and lignin biosynthesis; Component of Tyrosine metabolism
Application
Source
  • Endogenous
Average Molecular Weight 181.189
Monoisotopic Molecular Weight 181.073898
Isomeric SMILES N[C@@H](CC1=CC=C(O)C=C1)C(O)=O
Canonical SMILES NC(CC1=CC=C(O)C=C1)C(O)=O
KEGG Compound ID C00082 Link Image
BioCyc ID TYR Link Image
BiGG ID 33785 Link Image
Wikipedia Link L-Tyrosine Link Image
METLIN ID 34 Link Image
PubChem Compound 6057 Link Image
PubChem Substance 817487 Link Image
ChEBI ID 17895 Link Image
CAS Registry Number 60-18-4
InChI Identifier InChI=1/C9H11NO3/c10-8(9(12)13)5-6-1-3-7(11)4-2-6/h1-4,8,11H,5,10H2,(H,12,13)/t8-/m0/s1
Synthesis Reference Enei, Hitoshi; Matsui, Hiroshi; Yamashita, Koichi; Okumura, Shinji; Yamada, Hideaki. Microbiological synthesis of L-tyrosine and 3,4-dihydroxyphenyl-L-alanine. I. Distribution of tyrosine phenol lyase in microorganisms. Agricultural and Biological Chemist
Melting Point (Experimental) 343 oC
Experimental Water Solubility 0.479 mg/mL [SEIDELL,A (1941)] Source: PhysProp
Predicted Water Solubility 7.67 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity -2.26 [HANSCH,C ET AL. (1995)] Source: PhysProp
Predicted LogP/Hydrophobicity -2.39 [Predicted by ALOGPS]; -1.8 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID 1WQ4 Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Show Image
Show Peaklist
BMRB Spectrum Show Image
Show Peaklist
Cellular Location
  • Cytoplasm
  • Extracellular
  • mitochondria
Biofluid Location
  • Rumen
  • Blood
  • Breast_Milk
Tissue Location
Tissue References
All Tissues
Concentrations (Normal)
Biofluid Blood
Value 69.6 uM
Age N/A
Sex Both
Condition Normal
Comments Not Available
References
Biofluid Breast_Milk
Value 2 - 11 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. skim.
References
Biofluid Breast_Milk
Value 8444.221 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, Skim.
References
Biofluid Breast_Milk
Value 8057.884 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, fluid, partly skimmed, 1% milkfat.
References
Biofluid Breast_Milk
Value 8720.176 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, fluid, partly skimmed, 2% milkfat.
References
Biofluid Breast_Milk
Value 8444.221 uM
Age N/A
Sex N/A
Condition Normal
Comments Pasteurized. Milk, whole, pasteurized, homogenized, 3.3% milkfat.
References
Biofluid Breast_Milk
Value 8996.131 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, fluid, whole, producer, 3.7% milkfat.
References
Biofluid Breast_Milk
Value 6 +/- 0.12 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by DFI-MS in 2% milk
References
Biofluid Breast_Milk
Value 5 +/- 0.062 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by DFI-MS in 1% milk
References
Biofluid Breast_Milk
Value 5 +/- 0.13 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by DFI-MS in skim milk
References
Biofluid Breast_Milk
Value 5 +/- 0.136 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by DFI-MS in 3.25% milk
References
Biofluid Breast_Milk
Value 8652.0526 uM
Age NA
Sex NA
Condition Normal
Comments Cow whole milk (3.25% fat)
References
Biofluid Breast_Milk
Value 8708.974 uM
Age NA
Sex NA
Condition Normal
Comments Cow reduced fat milk (2% fat) with added vitamin A
References
Biofluid Breast_Milk
Value 8082.839 uM
Age NA
Sex NA
Condition Normal
Comments Cow reduced fat milk (1% fat) with added vitamin A
References
Biofluid Breast_Milk
Value 8458.389 uM
Age NA
Sex NA
Condition Normal
Comments Cow skim milk with added vitamin A
References
Biofluid Rumen
Value 8-12 uM
Age N/A
Sex Both
Condition Normal
Comments Not Available
References
Biofluid Rumen
Value 42.17 +/- 8.29 uM
Age N/A
Sex N/A
Condition Normal
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Biofluid Rumen
Value 60.86 +/- 20.13 uM
Age N/A
Sex N/A
Condition Rumen acidosis
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names
  • Catecholamine Biosynthesis
  • Phenylalanine and Tyrosine Metabolism
  • Transcription Translation
  • Tyrosine Metabolism
HMDB Pathways
Name Catecholamine Biosynthesis
Image Show Link Image
Name Phenylalanine and Tyrosine Metabolism
Image Show Link Image
Name Transcription Translation
Image Show Link Image
Name Tyrosine Metabolism
Image Show Link Image
KEGG Pathways
Name Phenylalanine and Tyrosine Metabolism
Image Show Link Image
Name Tyrosine Metabolism
Image Show Link Image
SimCell Pathways
Name Phenylalanine and Tyrosine Metabolism
Image Show Link Image
Graph
SBML
Name Tyrosine Metabolism
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Dual specificity protein phosphatase 14
  2. Dual specificity protein phosphatase 26
  3. Dual specificity phosphatase DUPD1
  4. Dual specificity protein phosphatase 10
  5. Dual specificity protein phosphatase 18
  6. Putative tyrosine-protein phosphatase auxilin
  7. Eyes absent homolog 2
  8. Dual specificity protein phosphatase 6
  9. Protein-tyrosine sulfotransferase 2
  10. Tyrosine 3-monooxygenase
  11. Phenylalanine-4-hydroxylase
  12. Tubulin--tyrosine ligase
  13. Tyrosinase
  14. Tyrosine aminotransferase
  15. Phosphatidylinositol 3-kinase regulatory subunit alpha
  16. Protein tyrosine phosphatase type IVA 3
  17. Phosphatidylinositol 3-kinase regulatory subunit beta
  18. Tyrosine-protein phosphatase non-receptor type substrate 1
  19. Tyrosyl-tRNA synthetase, cytoplasmic
  20. M-phase inducer phosphatase 1
  21. Reelin
  22. Receptor-type tyrosine-protein phosphatase F
  23. Low molecular weight phosphotyrosine protein phosphatase
  24. Myotubularin
  25. Phosphatidylinositol 3-kinase regulatory subunit gamma
  26. M-phase inducer phosphatase 3
  27. Solute carrier family 22 member 1
  28. Contactin-1
  29. GDNF family receptor alpha-2
  30. Ephrin-A1
  31. Interferon-alpha/beta receptor alpha chain
  32. B-cell antigen receptor complex-associated protein alpha chain
  33. Glucocorticoid modulatory element-binding protein 1
  34. Interferon-alpha/beta receptor beta chain
  35. Angiopoietin-1
  36. General transcription factor II-I
  37. Suppressor of cytokine signaling 3
  38. Scavenger receptor cysteine-rich type 1 protein M130
  39. TYRO protein tyrosine kinase-binding protein
  40. Caveolin-2
  41. Cytokine-inducible SH2-containing protein
  42. Proto-oncogene vav
Enzyme 1 [top]
Enzyme 1 ID 144
Enzyme 1 Name Dual specificity protein phosphatase 14
Enzyme 1 Synonyms Not Available
Enzyme 1 Gene Name DUSP14
Enzyme 1 Protein Sequence >Dual specificity protein phosphatase 14
MSSRGHSTLPRTLMAPRMISEGDLGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNAT
IEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSAT
LCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGI
VPDVYEKESRHLLPYWGI
Enzyme 1 Number of Residues 198
Enzyme 1 Molecular Weight 22236.7
Enzyme 1 Theoretical pI 9.93
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Signal transduction mechanisms
Enzyme 1 Specific Function Involved in the inactivation of MAP kinases. Dephosphorylates ERK, JNK and p38 MAP-kinases
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 109658275 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q17QM8 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name DUS14_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >597 bp
ATGAGCTCCAGAGGTCACAGCACGCTCCCCCGGACTCTCATGGCCCCCCGGATGATTTCT
GAGGGAGACCTGGGAGGCATTGCGCAGATCACCTCCTCGCTCTTCCTGGGCAGAGGCAGC
GTAGCCTCCAACCGGCACCTCCTCCAGGCTCGCGGCATCACCTGCATTGTGAACGCTACC
ATCGAGATCCCCAATTTCAACTGGCCCCAGTTTGAATACGTTAAAGTGCCTCTGGCGGAC
ATGCCTCACGCCCCCATTGGACTGTACTTTGACACCGTGGCCGACAAGATCCACAGCGTG
AGCCGGAAACACGGGGCCACCCTGGTGCACTGTGCTGCGGGGGTCAGCCGCTCGGCCACG
CTCTGCATCGCGTACCTGATGAAATTCCACAACGTGTGCCTGCTGGAGGCCTACAACTGG
GTGAAAGCCCGGAGGCCCGTCATCAGGCCCAACGTCGGCTTCTGGAGGCAGCTGATAGAC
TACGAGCGGCAGCTTTTTGGGAAGTCGACAGTTAAGATGGTACAGACACCGTACGGCATA
GTGCCGGACGTTTACGAGAAGGAGTCCCGACACCTGCTGCCTTACTGGGGGATCTGA
Enzyme 1 GenBank Gene ID BC118267 Link Image
Enzyme 1 GeneCard ID DUSP14 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 17q12
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 160
Enzyme 2 Name Dual specificity protein phosphatase 26
Enzyme 2 Synonyms Not Available
Enzyme 2 Gene Name DUSP26
Enzyme 2 Protein Sequence >Dual specificity protein phosphatase 26
MCPGNWLWASVTFMARFSRSGSRSPVRVRGALEEPPAVQHPFLNVFELERLLYTGKTACN
HADEVWPGLYLGDQEIANNHRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHD
SPAFDMSVHFQAAADFIHRALSQPGGRILVHCAVGVSRSATLVLAYLMLYHRLTLVEAIK
KVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Enzyme 2 Number of Residues 211
Enzyme 2 Molecular Weight 23767.1
Enzyme 2 Theoretical pI 9.97
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Signal transduction mechanisms
Enzyme 2 Specific Function Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 109659353 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q17QJ3 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name DUS26_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >636 bp
ATGTGTCCCGGCAACTGGCTCTGGGCTTCGGTGACATTCATGGCCCGCTTCTCCCGGAGC
GGCTCGAGGTCTCCAGTCCGCGTGAGAGGCGCCCTGGAGGAGCCGCCCGCCGTCCAGCAC
CCCTTCCTCAACGTCTTCGAGTTGGAGAGGCTGCTGTACACCGGGAAGACCGCCTGTAAC
CACGCCGACGAGGTCTGGCCAGGCCTCTACCTCGGAGACCAGGAAATAGCCAACAACCAC
CGGGAGCTGCGTCGCCTGGGCATCACGCACGTCCTCAACGCCTCTCACAGCCGGTGGCGA
GGGACGCCCGAAGCCTACGAGGGGCTGGGCATCCGCTACCTGGGTGTCGAGGCCCATGAC
TCGCCGGCCTTCGACATGAGTGTCCACTTCCAGGCAGCCGCTGACTTCATCCACCGGGCG
CTGAGCCAGCCAGGAGGGAGGATCCTGGTGCACTGCGCCGTGGGAGTGAGCCGCTCGGCC
ACCCTGGTGCTGGCCTACCTCATGCTGTACCACCGCCTCACCCTTGTGGAGGCCATCAAG
AAAGTCAAGGACCACCGAGGCATCATCCCCAACCGGGGCTTCCTGAGGCAGCTCCTGGCC
TTGGACCGCAGGCTGCGGCAGGGGCTGGAGGCGTGA
Enzyme 2 GenBank Gene ID BC118329 Link Image
Enzyme 2 GeneCard ID DUSP26 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:8
Enzyme 2 Locus 8p12
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 167
Enzyme 3 Name Dual specificity phosphatase DUPD1
Enzyme 3 Synonyms Not Available
Enzyme 3 Gene Name DUPD1
Enzyme 3 Protein Sequence >Dual specificity phosphatase DUPD1
MTSGESKTGLKNVYPSAKKLLPKVEEGEAEDYCTPGAFELERLFWKGSPQYTHVNEVWPK
LYIGDETTALDRYGLQKAGFTHVLNAAHGRWNVDTGPDYYRDMAIEYHGVEADDLPSFDL
SVFFYPAAAFIDAALRYDHNKILVHCVMGRSRSATLVLAYLMIHRNMTLVDAIQQVAKNR
CVLPNRGFLKQLRELDRQLVQQRRQAQQGEDAEKCEQEP
Enzyme 3 Number of Residues 219
Enzyme 3 Molecular Weight 24984.1
Enzyme 3 Theoretical pI 6.40
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Signal transduction mechanisms
Enzyme 3 Specific Function Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein Not Available
Enzyme 3 UniProtKB/Swiss-Prot ID P0C591 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name DUPD1_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence Not Available
Enzyme 3 GenBank Gene ID BF074326 Link Image
Enzyme 3 GeneCard ID DUPD1 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 10q22.2
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 181
Enzyme 4 Name Dual specificity protein phosphatase 10
Enzyme 4 Synonyms Not Available
Enzyme 4 Gene Name DUSP10
Enzyme 4 Protein Sequence >Dual specificity protein phosphatase 10
MPPSPLDDRVVVALSRPVRPQDLNLCLDSSYLGSAAPGSTSHPPVIATTVVSLKAANLTY
MPSSSGSARSLNCGCSSASCCTVATYDKDNQAPTQAIAAGTATTAIGSSTTCPASQMVNN
SENAGSLSPSGGVGSPMAGTPKQLASIKIIYPNDLAKKMTKCSKSHLPSQGPVIIDCRPF
MEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENT
NEPSRVVPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLCDNSLQLQECREVGGGA
SAASSMLPQSIPSTPDIENAELTPILPFLFLGNEQDAQDLETMQRLNIGYVINVTTHLPL
YHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVI
AYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVET
VV
Enzyme 4 Number of Residues 482
Enzyme 4 Molecular Weight 52388.4
Enzyme 4 Theoretical pI 7.80
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Signal transduction mechanisms
Enzyme 4 Specific Function Involved in the inactivation of MAP kinases. Has a specificity for the MAPK11/MAPK12/MAPK13/MAPK14 subfamily
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 113911868 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q0IID7 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name DUS10_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >1449 bp
ATGCCTCCGTCTCCTTTAGACGACAGGGTAGTGGTGGCACTGTCTAGGCCCGTTCGACCT
CAGGATCTCAACCTTTGTTTAGACTCTAGCTACCTTGGCTCTGCCGCCCCTGGCAGTACC
AGCCACCCTCCTGTCATCGCCACCACCGTTGTGTCCCTAAAGGCTGCGAATCTGACGTAT
ATGCCCTCATCCAGCGGCTCTGCCCGCTCCCTGAATTGTGGGTGCAGCAGTGCCAGCTGC
TGCACTGTGGCAACCTACGACAAGGACAATCAGGCCCCAACCCAGGCCATTGCCGCTGGC
ACCGCCACCACCGCCATCGGAAGCTCTACCACCTGTCCTGCCAGCCAGATGGTCAACAAC
AGTGAGAATGCAGGCTCTCTAAGTCCATCAGGTGGGGTGGGCAGCCCCATGGCAGGGACC
CCCAAACAGCTAGCCAGCATCAAAATAATCTACCCCAATGACTTGGCCAAGAAGATGACC
AAATGCAGCAAGAGTCACCTGCCAAGCCAGGGCCCTGTCATCATTGACTGCCGGCCCTTC
ATGGAGTACAACAAAAGTCACATCCAAGGAGCTGTCCACATTAACTGTGCCGATAAGATC
AGCCGGCGGAGACTGCAGCAGGGCAAGATCACTGTCTTAGACTTGATTTCCTGTAGGGAA
GGCAAGGACTCTTTCAAGAGGATCTTTTCCAAAGAAATTATAGTTTACGATGAGAATACC
AATGAGCCGAGCCGAGTGGTACCCTCCCAGCCACTCCACATAGTCCTCGAGTCTCTGAAG
AGAGAAGGCAAAGAACCTCTGGTGTTGAAAGGTGGACTTAGCAGTTTTAAGCAGAACCAT
GAAAACCTCTGTGATAACTCCCTCCAGCTCCAAGAGTGCCGGGAGGTGGGGGGCGGCGCG
TCTGCGGCCTCGAGCATGCTACCTCAATCCATCCCCAGCACCCCCGACATCGAGAACGCG
GAGCTGACACCCATCTTGCCCTTCCTGTTCCTTGGCAACGAGCAGGACGCTCAGGACCTG
GAGACGATGCAGCGGCTGAACATTGGCTACGTCATCAACGTCACCACCCACCTGCCCCTC
TACCACTACGAGAAAGGCCTGTTCAACTACAAGCGGCTGCCGGCCACCGACAGCAACAAG
CAGAACCTGCGGCAGTACTTTGAAGAGGCTTTTGAGTTCATCGAGGAAGCTCACCAGTGT
GGGAAGGGGCTACTCATCCACTGTCAGGCGGGCGTGTCCCGCTCTGCCACCATCGTCATC
GCCTACTTGATGAAGCACACGCGGATGACCATGACTGATGCATATAAATTTGTCAAAGGC
AAACGACCAATTATTTCCCCAAACCTTAACTTCATGGGGCAGTTGCTGGAGTTTGAGGAA
GACCTGAACAATGGTGTGACACCACGAATCCTTACACCAAAGCTGATGGGTGTGGAGACA
GTTGTGTGA
Enzyme 4 GenBank Gene ID BC122694 Link Image
Enzyme 4 GeneCard ID DUSP10 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 1q41
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References Not Available
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 187
Enzyme 5 Name Dual specificity protein phosphatase 18
Enzyme 5 Synonyms Not Available
Enzyme 5 Gene Name DUSP18
Enzyme 5 Protein Sequence >Dual specificity protein phosphatase 18
MTASPCAFPVQFRQPSVSGLSQITSSLYISSGVAANNRLMLSSNRISTVINVSVEVVNAL
YEDIHYVQVPVADTPTSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLM
KYHAMSLLDAHTWTKSCRPIIRPNNGFWEQLIHYEFQLFGRNTVHMVSSPVGMIPDIYEK
EVRQMIPL
Enzyme 5 Number of Residues 188
Enzyme 5 Molecular Weight 21028.1
Enzyme 5 Theoretical pI 7.57
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Signal transduction mechanisms
Enzyme 5 Specific Function Can dephosphorylate single and diphosphorylated synthetic MAPK peptides, with preference for the phosphotyrosine and diphosphorylated forms over phosphothreonine
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 60650250 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID Q5BIP9 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name DUS18_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >567 bp
ATGACAGCATCCCCGTGTGCCTTCCCAGTTCAGTTCCGGCAGCCCTCGGTCAGTGGCCTC
TCACAGATCACCAGTAGCCTGTATATCAGCAGCGGGGTGGCCGCCAACAACAGGCTCATG
CTCTCCAGCAACCGCATCAGCACGGTCATCAATGTCTCAGTGGAGGTGGTGAACGCCTTG
TACGAGGACATTCACTATGTGCAGGTGCCCGTGGCCGACACGCCCACCTCGCGGCTCTGT
GACTTCTTCGACCCCATCGCAGACCACATCCACAGCGTGGAGATGAAGCAGGGCCGCACC
CTGCTGCACTGCGCCGCCGGCGTCAGCCGCTCGGCTGCCCTCTGCCTCGCCTATCTCATG
AAGTACCACGCCATGTCCCTGCTGGACGCCCACACGTGGACCAAGTCCTGCCGGCCCATC
ATCCGGCCCAACAACGGCTTTTGGGAGCAGCTCATCCACTATGAGTTCCAGCTATTTGGC
AGGAATACCGTGCACATGGTCAGCTCCCCCGTGGGCATGATCCCTGACATCTACGAGAAG
GAGGTCCGTCAGATGATTCCACTCTGA
Enzyme 5 GenBank Gene ID BT021175 Link Image
Enzyme 5 GeneCard ID DUSP18 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:2
Enzyme 5 Locus 22q12.2
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References
  1. [PubMed Link Image]
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 190
Enzyme 6 Name Putative tyrosine-protein phosphatase auxilin
Enzyme 6 Synonyms
  1. DnaJ homolog subfamily C member 6
Enzyme 6 Gene Name DNAJC6
Enzyme 6 Protein Sequence >Putative tyrosine-protein phosphatase auxilin
MDSSGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVTSYTKGD
LDFTYVTSRIIVMSFPLDSVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFHS
RVSECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFIFCN
LYSTPGPAVRLLYAKRPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSPVPF
FNKQRNGCRPYCDVLIGETKIYTTCADFERMKEYRVQDGKIFIPLSITVQGDVVVSMYHL
RSTIGSRLQAKVTNTQIFQLQFHTGFIPLDTTVLKFTKPELDACDVPEKYPQLFQVTLDV
ELQPHDKVMELTPPWEHYCTKDVNPSILFSSHQEHQDTLVLGGQAPIDIPPDNPRHFGQG
GFFSTLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNANGDKPHAARKPSK
KQQEPAAPAPPEDVDLLGLEGSAVSKNFSSPAAPPSNSELLSDLFGGGGAAGPVQSGQSG
VDDVFHPSGPTSTQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPSGQDLLGSFLNTA
SASSDPFLQPTRSPSPTVHASSTPAVNIQPDVSGAWDWHTKPGGFGMGSKSAATSPTGSS
HGTPTHQNKPQTLDPFADLGTLGGSSFASKPSTPTGLGGGFPPLSSPQKASPQPMGGGWQ
QGGGYNWQQTQSKPQSSMPHSSPQNRPNYNVSFSSMPGGQNERGKAAANLEGKQKAADFE
DLLSGQGFNAHKDKKGPRTIAEMRKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTV
LWAGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSE
FENQGQKPLY
Enzyme 6 Number of Residues 910
Enzyme 6 Molecular Weight 99511.2
Enzyme 6 Theoretical pI 7.27
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Involved in heat shock protein binding
Enzyme 6 Specific Function Recruits HSPA8/HSC70 to clathrin-coated vesicles and promotes uncoating of clathrin-coated vesicles
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 485269 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID Q27974 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name AUXI_BOVIN Link Image
Enzyme 6 PDB ID 1N4C Link Image
Enzyme 6 PDB File Show
Enzyme 6 3D Structure
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >2733 bp
ATGGACAGCTCAGGTGCCTCATCTCCAGACATGGAGCCCAGCTATGGCGGAGGTCTTTTT
GACATGGTGAAAGGAGGGGCAGGGAGGCTCTTTAGCAACCTAAAGGACAACTTGAAAGAC
ACTCTCAAAGACACGTCTTCCAGAGTTATACAATCTGTTACCAGCTACACGAAAGGAGAT
TTAGACTTCACTTATGTTACCTCCAGAATTATTGTGATGTCCTTTCCTCTGGACAGTGTT
GACATAGGATTCAGGAATCAGGTTGATGATATTCGAAGCTTTTTGGATTCCAGACATCTT
GACCACTACACGGTATACAATCTGTCGCCCAAGTCTTATCGAACTGCCAAGTTTCACAGC
AGGGTCTCAGAATGCAGTTGGCCCATCAGGCAGGCCCCCAGCCTGCACAACCTCTTTGCT
GTGTGTCGGAATATGTATAACTGGCTACTACAGAATCCCAAAAACGTCTGTGTTGTCCAC
TGCTTGGATGGACGGGCAGCATCATCGATTCTGGTTGGTGCTATGTTCATTTTCTGTAAT
CTCTACTCTACTCCTGGCCCAGCCGTTCGATTGCTCTACGCAAAGCGACCAGGAATTGGA
CTTTCACCATCCCACAGGAGGTACCTGGGCTACATGTGTGACCTCCTAGCAGACAAACCC
TACCGCCCTCACTTCAAGCCTCTCACAATTAAGTCGATCACTGTCAGTCCAGTTCCTTTT
TTCAACAAACAGAGAAATGGATGTCGCCCTTACTGCGATGTACTGATTGGAGAAACCAAA
ATATATACAACCTGTGCAGATTTTGAACGAATGAAGGAATACCGTGTCCAAGATGGAAAA
ATCTTCATTCCTTTGAGCATCACTGTGCAAGGAGATGTGGTTGTTTCCATGTATCACTTG
AGGTCAACAATTGGAAGCAGGCTACAGGCTAAGGTGACCAACACTCAAATATTTCAGCTT
CAGTTTCATACTGGATTCATTCCACTGGACACAACAGTTTTAAAGTTCACCAAGCCTGAG
TTGGATGCATGTGATGTACCAGAAAAATATCCTCAGCTATTTCAGGTAACTCTGGATGTA
GAACTACAGCCTCACGACAAAGTGATGGAGCTAACCCCACCGTGGGAACATTACTGCACA
AAAGATGTCAACCCCAGCATCCTCTTCTCTTCTCACCAGGAGCATCAAGATACTCTGGTC
TTAGGAGGACAGGCTCCAATAGATATCCCTCCAGATAATCCCAGACATTTTGGGCAAGGT
GGCTTCTTTTCCACTCTCTGCTGGCAAGATCAGAAATCGGAGAAGTCATTCTGCGAGGAG
GACCACGCTGCCCTAGTGAATCAGGAGAGTGAGCAGTCAGACGATGAGCTTCTGACGCTG
TCCAGCCCACATGGCAATGCCAATGGTGACAAACCTCACGCAGCCAGGAAGCCCAGCAAA
AAGCAGCAGGAGCCAGCTGCCCCTGCACCCCCTGAGGATGTGGATCTTCTGGGTCTAGAA
GGGTCTGCTGTGAGTAAGAACTTCTCTTCGCCGGCAGCTCCTCCCTCCAATTCCGAACTT
CTGAGTGACCTGTTCGGGGGCGGAGGTGCAGCCGGTCCCGTCCAGTCTGGACAGTCAGGG
GTGGACGACGTGTTTCACCCGAGTGGACCTACATCCACCCAGTCCACACCACGCCGATCT
GCCACCTCCACCTCTGCATCTCCAACACTGAGAGTAGGAGAAGGTGCCACCTTTGACCCA
TTTGGAGCACCTTCTAAACCATCAGGTCAAGATTTGCTGGGTTCTTTTTTGAACACAGCC
AGTGCTTCCAGTGACCCCTTTCTTCAGCCTACGAGGAGTCCTTCTCCTACAGTGCATGCT
TCTAGTACCCCTGCTGTGAACATTCAGCCAGATGTTTCAGGAGCCTGGGACTGGCATACC
AAACCAGGAGGTTTTGGAATGGGAAGCAAATCAGCTGCCACCAGCCCAACAGGCTCCTCG
CATGGTACTCCCACCCATCAAAACAAACCCCAGACTCTGGACCCTTTTGCTGACCTTGGG
ACATTAGGTGGTTCTTCATTTGCCAGCAAACCTTCCACACCAACTGGATTGGGTGGTGGA
TTTCCACCTCTCAGCTCGCCACAGAAAGCATCTCCCCAGCCCATGGGTGGGGGGTGGCAG
CAGGGAGGGGGCTACAACTGGCAGCAGACACAGTCCAAGCCACAGTCCAGCATGCCCCAC
TCCTCTCCCCAGAACCGGCCCAACTACAACGTGAGCTTCTCATCCATGCCTGGGGGCCAG
AACGAACGTGGGAAAGCAGCAGCTAATTTGGAGGGGAAACAAAAAGCAGCTGACTTTGAA
GACCTGCTCTCTGGTCAAGGTTTTAATGCTCACAAAGACAAAAAGGGACCTCGAACAATA
GCTGAGATGAGAAAGGAGGAAATGGCTAAGGAGATGGATCCTGAGAAGTTAAAGATTCTA
GAATGGATTGAAGGCAAAGAGAGGAATATCAGAGCCCTTCTGTCCACAATGCACACTGTG
CTGTGGGCTGGGGAGACTAAGTGGAAACCTGTTGGCATGGCAGACCTGGTCACCCCGGAG
CAGGTGAAGAAGGTGTACAGGAAGGCTGTGCTAGTGGTGCACCCGGATAAAGCTACTGGG
CAACCCTATGAACAATATGCAAAGATGATTTTCATGGAGCTCAATGATGCCTGGTCAGAA
TTTGAAAATCAAGGCCAAAAGCCCTTGTATTAA
Enzyme 6 GenBank Gene ID U09237 Link Image
Enzyme 6 GeneCard ID DNAJC6 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:1
Enzyme 6 Locus 1pter-q31.3
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References
  1. [PubMed Link Image]
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 194
Enzyme 7 Name Eyes absent homolog 2
Enzyme 7 Synonyms Not Available
Enzyme 7 Gene Name EYA2
Enzyme 7 Protein Sequence >Eyes absent homolog 2
MLELLVSASLTVNSDRPGKLKPSRADADVWTLSDREGITTSARSVSQLFARPCPRVPPGQ
PPSAMAAYSQTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGS
SFSTPASGQSPYTYQMHGTAGIYQGANGLTNAAGFGTVHQDYPSYPGFPQSQYSQYYSSS
YNPPYVPASSICPSPLSTSTYVLQEASHNIPSQSSESLGGEYNTHNGPSTPAKEGDTDRP
PRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTAS
VRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPG
ANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGAPKRETWLQLRAELEALT
DLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKE
SCFERIMQRFGRKAVYIVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL
Enzyme 7 Number of Residues 537
Enzyme 7 Molecular Weight 58806.0
Enzyme 7 Theoretical pI 6.15
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Involved in magnesium ion binding
Enzyme 7 Specific Function Tyrosine phosphatase that specifically dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph). 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Promotes efficient DNA repair by dephosphorylating H2AX, promoting the recruitment of DNA repair complexes containing MDC1. Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis. Coactivates SIX1. Seems to coactivate SIX2, SIX4 and SIX5. Together with SIX1 and DACH2 seem to be involved in myogenesis. May be involved in development of the eye. Interaction with GNAZ and GNAI2 prevents nuclear translocation and transcriptional activity
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • None
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 61554261 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q58DB6 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name EYA2_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >1614 bp
ATGCTAGAACTACTGGTCTCAGCCAGCCTTACTGTAAACAGTGATCGTCCGGGTAAACTG
AAGCCTAGCCGTGCTGATGCTGATGTCTGGACTCTGAGTGACAGAGAAGGCATCACCACA
TCGGCTCGGAGTGTGTCCCAGCTCTTTGCAAGACCTTGCCCGCGTGTCCCACCTGGTCAG
CCTCCCTCGGCCATGGCAGCCTACAGCCAGACACAGTACAGTGCAGGGATCCAGCAAGCT
ACCCCCTACACGGCTTACCCGCCTCCAGCACAAGCCTATGGAATCCCTTCTTACAGCATC
AAGACAGAAGACAGCTTGAACCATTCCCCCGGCCAGAGTGGCTTCCTCAGCTATGGCTCC
AGCTTCAGCACCCCAGCCTCTGGACAGAGCCCGTACACCTACCAGATGCATGGCACGGCC
GGGATCTATCAAGGAGCAAATGGACTGACCAACGCGGCCGGATTCGGAACTGTGCACCAG
GACTATCCTTCCTACCCCGGCTTCCCGCAGAGCCAGTACTCCCAGTATTACAGCTCGTCC
TACAACCCTCCTTACGTCCCAGCCAGCAGCATCTGCCCTTCTCCTCTCTCCACGTCCACC
TACGTCCTCCAAGAGGCATCTCACAACATCCCCAGCCAGAGTTCCGAGTCGCTTGGCGGT
GAATATAACACACACAATGGACCTTCCACACCGGCAAAGGAGGGAGACACAGACAGGCCA
CCCCGGGCCTCCGACGGGAAGCTCCGAGGCCGGTCTAAGCGGAGCAGCGACCCCTCCCCA
GCAGGGGACAATGAGATCGAGCGTGTGTTCGTGTGGGACCTGGATGAGACGATAATTATT
TTCCACTCCTTACTCACGGGGACTTTCGCCTCCAGGTACGGGAAGGACACCACGGCGTCC
GTGCGCATCGGCCTCATGATGGAGGAAATGATCTTCAACCTCGCAGACACACATCTGTTC
TTCAATGACCTGGAGGATTGTGACCAGATCCACGTGGACGATGTCTCATCTGATGACAAT
GGGCAAGATTTAAGCACCTACAACTTCTCCGCCGATGGCTTCCACAGTTCGGCCCCGGGA
GCCAACCTGTGCCTGGGCTCCGGCGTGCACGGCGGCGTGGACTGGATGAGGAAGCTGGCC
TTCCGCTACCGGCGGGTGAAGGAGATGTACAACACCTACAAGAACAACGTCGGCGGCTTG
ATAGGAGCTCCCAAAAGAGAGACCTGGCTACAGCTCAGAGCCGAGCTGGAAGCTCTGACT
GACCTCTGGCTGACCCACTCTCTGAAGGCACTAAACCTCATCAATTCCCGGCCCAATTGT
GTCAACGTGCTGGTCACCACCACTCAACTAATTCCTGCCCTGGCCAAAGTCCTGCTGTAC
GGATTGGGTTCTGTGTTTCCTATTGAGAACATCTACAGTGCAACCAAGACAGGGAAGGAG
AGCTGCTTCGAGAGGATAATGCAGAGGTTTGGCAGAAAGGCCGTCTACATCGTGATCGGC
GATGGAGTGGAAGAGGAGCAGGGAGCCAAAAAGCACAACATGCCTTTCTGGAGGATATCC
TGCCACGCAGACCTGGAGGCGCTGAGGCACGCCCTGGAGCTGGAGTATTTATAG
Enzyme 7 GenBank Gene ID BT021681 Link Image
Enzyme 7 GeneCard ID EYA2 Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:2
Enzyme 7 Locus 20q13.1
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References
  1. [PubMed Link Image]
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 206
Enzyme 8 Name Dual specificity protein phosphatase 6
Enzyme 8 Synonyms Not Available
Enzyme 8 Gene Name DUSP6
Enzyme 8 Protein Sequence >Dual specificity protein phosphatase 6
MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPG
IMLRRLQKGSLPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLK
KLKDEGCRAFYLEGGFSKFQAEFALHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDI
ESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT
PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRS
VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPTQ
QLYFTTPSNQNVYQVDSLQST
Enzyme 8 Number of Residues 381
Enzyme 8 Molecular Weight 42306.3
Enzyme 8 Theoretical pI 4.50
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Signal transduction mechanisms
Enzyme 8 Specific Function Inactivates MAP kinases. Has a specificity for the ERK family
Enzyme 8 Pathways Not Available
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • None
Enzyme 8 Transmembrane Regions
  • None
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 95768752 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID Q2KJ36 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name DUS6_BOVIN Link Image
Enzyme 8 PDB ID 1HZM Link Image
Enzyme 8 PDB File Show
Enzyme 8 3D Structure
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence >1146 bp
ATGATAGATACGCTCAGACCCGTGCCCTTCGCGTCGGAAATGGCGATCAGCAAGACGGTG
GCGTGGCTCAACGAGCAGCTGGAGCTGGGCAACGAGCGGCTGCTGTTGATGGACTGCCGG
CCGCAGGAGCTGTACGAGTCGTCCCACATCGAGTCCGCCATCAACGTGGCCATTCCAGGG
ATCATGCTGCGGCGCCTGCAGAAGGGCAGCCTGCCGGTGCGCGCGCTATTCACGCGCGGC
GAGGACCGGGACCGCTTCACCCGGCGCTGCGGCACCGATACCGTGGTGCTCTACGATGAG
AGCAGCAGCGACTGGAACGAGAATACGGGCGGCGAGTCGGTGCTCGGGCTGCTGCTCAAG
AAGCTCAAGGACGAGGGATGCCGGGCGTTCTACCTGGAAGGTGGTTTCAGTAAGTTCCAA
GCCGAGTTCGCCCTGCACTGCGAGACCAATCTAGACGGCTCGTGTAGCAGCAGCTCGCCA
CCGTTGCCAGTGCTGGGGCTCGGGGGCCTGCGGATCAGCTCCGACTCCTCCTCGGACATT
GAGTCTGACCTTGACCGAGACCCCAATAGTGCAACGGACTCGGATGGCAGCCCGCTGTCC
AACAGTCAGCCTTCTTTCCCTGTGGAGATCTTGCCCTTCCTCTATTTGGGCTGTGCCAAG
GACTCCACCAACCTGGACGTGTTGGAGGAGTTTGGCATCAAGTACATATTGAACGTCACC
CCCAACTTGCCGAATCTCTTTGAGAATGCAGGAGAGTTCAAATACAAGCAGATCCCCATC
TCGGATCACTGGAGCCAAAACCTGTCCCAGTTTTTCCCTGAGGCCATTTCTTTCATAGAT
GAAGCCCGGGGCAAAAACTGTGGCGTCCTGGTGCATTGCTTAGCTGGCATCAGCCGCTCG
GTCACTGTGACTGTGGCTTACCTTATGCAGAAGCTCAATCTGTCGATGAACGATGCTTAT
GACATTGTGAAGATGAAGAAATCCAACATCTCCCCCAACTTCAACTTCATGGGCCAGCTG
CTGGACTTCGAGAGGACGCTGGGACTGAGCAGCCCCTGTGACAACCGCGTCCCCACACAG
CAGCTCTATTTCACCACCCCCTCCAACCAGAATGTCTACCAGGTGGACTCTCTGCAATCC
ACGTGA
Enzyme 8 GenBank Gene ID BT025424 Link Image
Enzyme 8 GeneCard ID DUSP6 Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:1
Enzyme 8 Locus 12q22-q23
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References
  1. [PubMed Link Image]
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 375
Enzyme 9 Name Protein-tyrosine sulfotransferase 2
Enzyme 9 Synonyms
  1. Tyrosylprotein sulfotransferase-2
  2. TPST-2
Enzyme 9 Gene Name TPST2
Enzyme 9 Protein Sequence >Protein-tyrosine sulfotransferase 2
MRLSMRRALLAAGLALALVLAVHLGQRVLECQAVLGGPRGPRRTMRPEQEDLMMVGADHV
EYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREK
LRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLL
MVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGRDKCLPVYYEQ
LVLHPRRSLKVILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSK
WTGHIPGDVLRDMAQIAPMLARLGYDPYANPPNYGNPDPIVINNTHRVLKGDYKTPANLK
GYFQVNLNSTSSHLGSS
Enzyme 9 Number of Residues 377
Enzyme 9 Molecular Weight 41966.5
Enzyme 9 Theoretical pI 9.66
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Involved in protein-tyrosine sulfotransferase activity
Enzyme 9 Specific Function Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides
Enzyme 9 Pathways Not Available
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function Not Available
Enzyme 9 Signals
  • None
Enzyme 9 Transmembrane Regions
  • 9-25
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 74353892 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID Q3SYY2 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name TPST2_BOVIN Link Image
Enzyme 9 PDB ID Not Available
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence >1134 bp
ATGCGCCTGTCGATGCGGAGGGCGCTGCTGGCAGCCGGCCTGGCCCTGGCCCTGGTGCTG
GCCGTCCACCTGGGGCAGCGGGTGCTGGAGTGCCAGGCGGTGCTAGGGGGCCCACGGGGC
CCCCGGCGGACCATGCGGCCCGAGCAGGAGGACCTGATGATGGTGGGCGCAGACCACGTG
GAGTACCGCTACGGGAAGGCCATGCCGCTCATCTTCGTCGGGGGCGTGCCCCGGAGCGGC
ACCACGCTGATGCGGGCCATGCTGGACGCGCACCCCGAGGTGCGCTGCGGCGAGGAGACC
CGCATCATCCCACGCGTGCTGGCCATGCGCCAGGCCTGGTCCAAGTCGGGCCGGGAGAAG
CTGCGGCTGGACGAGGCGGGCGTGACGGACGAGGTGCTGGACGCCGCCATGCAGGCCTTC
ATCCTGGAGGTGATCGCCAAGCACGGCGAGCCGGCCCGTGTGCTCTGCAACAAGGACCCC
TTCACGCTCAAGTCCTCCGTCTACCTGTCGCGCCTCTTCCCCAACTCTAAGTTCCTGCTC
ATGGTGCGCGACGGCCGGGCCTCAGTGCACTCCATGATCACCCGCAAGGTCACCATCGCT
GGCTTCGACCTCAGCAGCTACCGCGACTGCCTCACCAAGTGGAACAAGGCCATCGAGGTG
ATGTACGCGCAGTGCATGGAGGTGGGCAGGGACAAGTGCCTGCCCGTGTACTACGAGCAG
CTGGTGCTACACCCCCGGCGCTCCCTCAAGGTCATCCTCGACTTCCTGGGCATCGCCTGG
AGCGACGCTGTCCTGCACCACGAGGACCTCATCGGCAAGCCGGGCGGCGTCTCCCTGTCC
AAGATTGAACGATCCACAGACCAGGTCATCAAGCCCGTGAACCTAGAAGCTCTCTCCAAG
TGGACTGGCCACATCCCTGGGGACGTGTTGAGGGACATGGCCCAGATCGCCCCCATGCTG
GCCCGGCTCGGCTATGACCCCTATGCAAACCCGCCCAACTACGGCAACCCCGACCCCATT
GTCATCAACAACACACACCGGGTCTTGAAAGGGGACTATAAAACACCAGCCAATCTGAAA
GGCTATTTTCAGGTGAACCTGAACAGCACCTCCTCCCACCTAGGAAGCTCATGA
Enzyme 9 GenBank Gene ID BC103334 Link Image
Enzyme 9 GeneCard ID TPST2 Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Chromosome:2
Enzyme 9 Locus 22q12.1
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References Not Available
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 388
Enzyme 10 Name Tyrosine 3-monooxygenase
Enzyme 10 Synonyms
  1. Tyrosine 3-hydroxylase
  2. TH
Enzyme 10 Gene Name TH
Enzyme 10 Protein Sequence >Tyrosine 3-monooxygenase
MPTPNAASPQAKGFRRAVSELDAKQAEAIMSPRFVGRRQSLIQDARKEREKAEAAASSSE
SAEAAAWLERDGEAVLTLLFALPPTRPPALTRAIKVFETFEAHLHHLETRPAQPLRAGSP
PLECFVRCEVPGPVVPALLSALRRVAEDVRAAGESKVLWFPRKVSELDKCHHLVTKFDPD
LDLDHPGFSDQAYRQRRKLIAEIAFQYKQGDPIPHVEYTAEETATWKEVYSTLRGLYPTH
ACREHLEAFELLERFCGYREDRIPQLEDVSRFLKERTGFQLRPAAGLLSARDFLASLAFR
VFQCTQYIRHASSPMHSPEPECCHELLGHVPMLADRTFAQFSQDIGLASLGVSDEEIEKL
STLYWFTVEFGLCKQNGEVKAYGAGLLSSYGELLHSLSEEPEIRAFDPDAAAVQPYQDQT
YQPVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPHAIRHALDGVQDEM
QALAHALNAIS
Enzyme 10 Number of Residues 491
Enzyme 10 Molecular Weight 55122.8
Enzyme 10 Theoretical pI 5.96
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Amino acid transport and metabolism
Enzyme 10 Specific Function Plays an important role in the physiology of adrenergic neurons
Enzyme 10 Pathways
  • Catecholamine biosynthesis
  • dopamine biosynthesis
  • dopamine from L-tyrosine:step 1/2
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • None
Enzyme 10 Transmembrane Regions
  • None
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 163751 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID P17289 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name TY3H_BOVIN Link Image
Enzyme 10 PDB ID 1TOH Link Image
Enzyme 10 PDB File Show
Enzyme 10 3D Structure
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >1476 bp
ATGCCTACCCCCAACGCCGCCTCGCCGCAGGCCAAGGGCTTCCGCAGGGCCGTCTCCGAG
CTGGACGCCAAGCAGGCTGAGGCCATCATGTCCCCACGCTTCGTCGGGAGGCGGCAGAGC
CTCATCCAGGACGCACGCAAGGAGCGGGAGAAGGCGGAGGCCGCGGCCTCATCCTCGGAG
TCCGCGGAGGCGGCAGCCTGGTTGGAGAGGGACGGGGAGGCGGTGCTGACCCTGCTGTTC
GCCCTGCCGCCCACCAGGCCCCCTGCGCTGACCCGGGCTATCAAGGTGTTTGAGACATTC
GAAGCCCACCTCCACCACCTGGAGACCCGACCGGCCCAGCCACTGCGGGCGGGGAGCCCG
CCCCTGGAGTGCTTCGTGCGCTGTGAGGTGCCCGGCCCAGTGGTGCCCGCCCTGCTGAGC
GCCCTGCGCCGCGTGGCAGAAGATGTGCGTGCCGCCGGGGAGAGCAAAGTCCTCTGGTTC
CCAAGGAAAGTGTCCGAGCTGGACAAGTGTCACCACCTCGTCACCAAGTTTGACCCTGAC
CTGGACTTGGATCATCCCGGCTTCTCCGACCAGGCGTACCGCCAGCGCAGGAAGCTGATC
GCCGAGATCGCCTTCCAGTACAAGCAAGGCGACCCCATTCCCCACGTGGAGTACACAGCC
GAGGAGACAGCCACCTGGAAGGAGGTCTACTCCACGCTGCGGGGCCTGTACCCCACCCAC
GCCTGCCGCGAGCACCTGGAGGCCTTCGAGCTGCTGGAGCGCTTCTGCGGGTACCGCGAG
GACCGAATCCCGCAGCTGGAGGACGTCTCACGCTTCCTGAAGGAGAGGACCGGCTTCCAG
CTGCGGCCCGCGGCCGGCCTGCTGTCCGCGCGGGACTTCCTGGCCAGCCTGGCCTTCCGC
GTGTTCCAGTGCACCCAGTACATCCGCCACGCCTCCTCGCCCATGCACTCCCCGGAGCCG
GAGTGCTGCCACGAGCTGCTGGGGCACGTGCCCATGCTCGCCGACCGGACCTTCGCGCAG
TTTTCCCAGGACATCGGGCTCGCATCCTTGGGAGTGTCGGATGAGGAAATTGAGAAGCTG
TCCACGCTGTACTGGTTCACCGTGGAGTTCGGGCTATGCAAACAGAATGGAGAGGTGAAG
GCCTACGGCGCGGGGCTGCTGTCCTCCTACGGGGAGCTCCTGCACTCCCTTTCCGAGGAG
CCTGAGATCCGGGCCTTCGACCCTGATGCAGCGGCCGTGCAGCCCTATCAGGACCAGACC
TACCAGCCCGTCTACTTCGTGTCTGAGAGCTTCAGCGATGCCAAGGACAAGCTCAGGAGC
TACGCCTCCCGCATCCAGCGCCCCTTCTCTGTGAAGTTTGACCCGTACACACTGGCCATC
GACGTGCTGGACAGTCCCCACGCCATCCGGCACGCCCTGGACGGCGTCCAGGACGAGATG
CAGGCCCTGGCCCATGCTCTGAACGCCATCAGCTAG
Enzyme 10 GenBank Gene ID M36794 Link Image
Enzyme 10 GeneCard ID TH Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:1
Enzyme 10 Locus 11p15.5
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References
  1. [PubMed Link Image]
Enzyme 10 Metabolite References Not Available
Enzyme 11 [top]
Enzyme 11 ID 389
Enzyme 11 Name Phenylalanine-4-hydroxylase
Enzyme 11 Synonyms
  1. PAH
  2. Phe-4-monooxygenase
Enzyme 11 Gene Name PAH
Enzyme 11 Protein Sequence >Phenylalanine-4-hydroxylase
MSALVLESRALGRKLSDFGQETSYIEGNSDQNAVSLIFSLKEEVGALARVLRLFEENDIN
LTHIESRPSRLRKDEYEFFTNLDQRSVPALANIIKILRHDIGATVHELSRDKKKDTVPWF
PRTIQELDNFANQVLSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYTE
EEKKTWGTVFRTLKSLYKTHACYEHNHIFPLLEKYCGFREDNIPQLEEVSQFLQSCTGFR
LRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQ
FSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSDK
PKLLPLELEKTAVQEYTITEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVHYDPYTQRI
EVLDNTQQLKILADSISSEVEILCSALQKLK
Enzyme 11 Number of Residues 451
Enzyme 11 Molecular Weight 51726.2
Enzyme 11 Theoretical pI 6.20
Enzyme 11 GO Classification
Function
Process
Component
Enzyme 11 General Function Amino acid transport and metabolism
Enzyme 11 Specific Function L-phenylalanine + tetrahydrobiopterin + O(2) = L-tyrosine + 4a-hydroxytetrahydrobiopterin
Enzyme 11 Pathways
  • Amino-acid degradation
  • L-phenylalanine degradation
  • acetoacetate and fumarate from L-phenylalanine:step 1/6
Enzyme 11 Reactions Not Available
Enzyme 11 Pfam Domain Function
Enzyme 11 Signals
  • None
Enzyme 11 Transmembrane Regions
  • None
Enzyme 11 Essentiality Not Available
Enzyme 11 GenBank ID Protein 146231900 Link Image
Enzyme 11 UniProtKB/Swiss-Prot ID Q2KIH7 Link Image
Enzyme 11 UniProtKB/Swiss-Prot Entry Name PH4H_BOVIN Link Image
Enzyme 11 PDB ID 2PHM Link Image
Enzyme 11 PDB File Show
Enzyme 11 3D Structure
Enzyme 11 Cellular Location Not Available
Enzyme 11 Gene Sequence >1356 bp
ATGTCAGCTCTGGTCCTGGAGAGCCGAGCCTTGGGCAGGAAACTCAGCGACTTTGGACAG
GAAACGAGCTATATTGAAGGCAACTCTGATCAAAATGCTGTATCGCTGATCTTCTCACTC
AAAGAAGAAGTTGGTGCACTGGCCAGAGTATTACGTTTATTTGAGGAGAATGATATAAAC
CTGACCCACATTGAATCAAGACCTTCACGTTTAAGGAAAGACGAGTATGAATTTTTCACC
AATCTGGATCAACGCAGCGTGCCTGCCCTGGCAAACATCATCAAGATCTTGAGACATGAC
ATTGGTGCCACTGTGCACGAGCTTTCCCGGGATAAGAAGAAAGACACAGTGCCCTGGTTT
CCAAGAACCATTCAGGAACTCGACAACTTTGCCAACCAGGTTCTCAGCTATGGAGCTGAA
CTGGATGCAGATCACCCGGGATTTAAAGATCCTGTATACCGAGCAAGACGGAAGCAATTC
GCTGACATTGCCTACAACTATAGACATGGGCAGCCCATTCCTCGAGTGGAATACACGGAG
GAAGAAAAAAAAACATGGGGGACGGTATTCAGGACCCTGAAGTCCTTGTATAAGACCCAT
GCTTGCTATGAGCACAACCACATTTTCCCCCTTCTGGAAAAGTATTGCGGCTTCCGTGAA
GATAACATTCCCCAGCTCGAAGAGGTTTCTCAGTTTCTGCAGAGTTGCACTGGTTTCCGC
CTCCGACCAGTCGCTGGCCTGCTTTCTTCTCGGGATTTCTTGGGTGGCCTGGCTTTCCGA
GTCTTCCACTGCACTCAGTACATCAGACATGGGTCTAAGCCCATGTATACACCAGAACCG
GACATATGCCATGAGCTCTTGGGACATGTACCTTTGTTTTCAGATCGCAGCTTTGCCCAG
TTTTCGCAGGAGATCGGCCTTGCCTCCCTGGGTGCACCTGATGAGTACATTGAAAAACTT
GCAACAATTTACTGGTTTACTGTGGAGTTTGGGCTCTGCAAGCAAGGAGACTCCATAAAG
GCATATGGTGCTGGGCTCCTGTCATCCTTTGGTGAATTACAGTATTGCCTATCAGACAAG
CCAAAGCTCCTTCCTCTGGAACTGGAGAAGACCGCTGTCCAGGAGTATACGATCACAGAG
TTCCAGCCTCTGTATTATGTGGCTGAGAGTTTTAATGATGCCAAGGAGAAAGTGAGGAAC
TTTGCTGCCACAATCCCACGGCCCTTCTCAGTTCATTATGACCCATACACTCAACGGATT
GAGGTCTTGGACAACACCCAGCAACTTAAGATTTTGGCTGACTCCATCAGTAGTGAAGTT
GAGATCCTTTGCAGTGCCCTCCAGAAATTAAAGTGA
Enzyme 11 GenBank Gene ID BT030585 Link Image
Enzyme 11 GeneCard ID PAH Link Image
Enzyme 11 GenAtlas ID Not Available
Enzyme 11 HGNC ID Not Available
Enzyme 11 Chromosome Location Chromosome:1
Enzyme 11 Locus 12q22-q24.2
Enzyme 11 SNPs SNPJam Report Link Image
Enzyme 11 General References
  1. [PubMed Link Image]
Enzyme 11 Metabolite References Not Available
Enzyme 12 [top]
Enzyme 12 ID 505
Enzyme 12 Name Tubulin--tyrosine ligase
Enzyme 12 Synonyms
  1. TTL
Enzyme 12 Gene Name TTL
Enzyme 12 Protein Sequence >Tubulin--tyrosine ligase
MYTFVVRDENSSVYAEVSRLLLATGHWKRLRRDNPRFNLMLGERNRLPFGRLGHEPGLMQ
LVNYYRGADKLCRKASLVKLIKTSPELAESCTWFPESYVIYPTNLKTPVAPAQDGIHPPL
HSSRTDEREFFLASYNRKKEEGEGNVWIAKSSAGAKGEGILISSDATELLDFIDNQGQVH
VIQKYLERPLLLEPGHRKFDIRSWVLVDHQFNIYLYREGVLRTASEPYHMDNFQDKTCHL
TNHCIQKEYSKNYGKYEEGNEMFFEAFNRYLTSALNITLESSILLQIKHIIRSCLMSVEP
AISTKHLPYQSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDIAIASVFP
PPDAEQQPPQPATFIKL
Enzyme 12 Number of Residues 377
Enzyme 12 Molecular Weight 43270.1
Enzyme 12 Theoretical pI 6.79
Enzyme 12 GO Classification
Function
Process
Component
Enzyme 12 General Function Involved in ATP binding
Enzyme 12 Specific Function Catalyzes the post-translational addition of a tyrosine to the C-terminal end of detyrosinated alpha-tubulin
Enzyme 12 Pathways Not Available
Enzyme 12 Reactions Not Available
Enzyme 12 Pfam Domain Function
Enzyme 12 Signals
  • None
Enzyme 12 Transmembrane Regions
  • None
Enzyme 12 Essentiality Not Available
Enzyme 12 GenBank ID Protein Not Available
Enzyme 12 UniProtKB/Swiss-Prot ID P38584 Link Image
Enzyme 12 UniProtKB/Swiss-Prot Entry Name TTL_BOVIN Link Image
Enzyme 12 PDB ID Not Available
Enzyme 12 Cellular Location Not Available
Enzyme 12 Gene Sequence Not Available
Enzyme 12 GenBank Gene ID Not Available
Enzyme 12 GeneCard ID TTL Link Image
Enzyme 12 GenAtlas ID Not Available
Enzyme 12 HGNC ID Not Available
Enzyme 12 Chromosome Location Chromosome:2
Enzyme 12 Locus 2q13
Enzyme 12 SNPs SNPJam Report Link Image
Enzyme 12 General References
  1. [PubMed Link Image]
Enzyme 12 Metabolite References Not Available
Enzyme 13 [top]
Enzyme 13 ID 662
Enzyme 13 Name Tyrosinase
Enzyme 13 Synonyms
  1. Monophenol monooxygenase
Enzyme 13 Gene Name TYR
Enzyme 13 Protein Sequence >Tyrosinase
MLLAALYCLLWSFRTSAGHFPRACASSKSLTEKECCPPWAGDGSPCGRLSGRGSCQDVIL
STAPLGPQFPFTGVDDRESWPSIFYNRTCQCFSNFMGFNCGSCKFGFRGPRCTERRLLVR
RNIFDLSVPEKNKFLAYLTLAKHTTSPDYVIPTGTYGQMNHGTTPLFNDVSVYDLFVWMH
YYVSRDTLLGDSEVWRDIDFAHEAPGFLPWHRLFLLLWEQEIQKLTGDENFTIPYWDWRD
AENCDVCTDEYMGGRNPANPNLLSPASFFSSWQIVCSRLEEYNSRQALCNGTSEGPLLRN
PGNHDKARTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFADPVTGIADASQS
SMHNALHIYMNGTMSQVPGSANDPIFLLHHAFVDSIFEQWLRKYHPLQDVYPEANAPIGH
NRESYMVPFIPLYRNGDFFISSKDXGYDYSYLQDSEPDIFQDYIKPYLEQAQRIWPWLIG
AAVVGSVLTAVLGGLTSLLCRRKRNQLPEEKQPLLMEKEDYHNLMYQSHL
Enzyme 13 Number of Residues 530
Enzyme 13 Molecular Weight 60249.4
Enzyme 13 Theoretical pI 5.71
Enzyme 13 GO Classification
Function
Process
Component
Enzyme 13 General Function Involved in copper ion binding
Enzyme 13 Specific Function This is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. Catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone
Enzyme 13 Pathways Not Available
Enzyme 13 Reactions Not Available
Enzyme 13 Pfam Domain Function
Enzyme 13 Signals
  • 1-17
Enzyme 13 Transmembrane Regions
  • 474-494
Enzyme 13 Essentiality Not Available
Enzyme 13 GenBank ID Protein 25990265 Link Image
Enzyme 13 UniProtKB/Swiss-Prot ID Q8MIU0 Link Image
Enzyme 13 UniProtKB/Swiss-Prot Entry Name TYRO_BOVIN Link Image
Enzyme 13 PDB ID Not Available
Enzyme 13 Cellular Location Not Available
Enzyme 13 Gene Sequence >1593 bp
ATGCTCCTGGCTGCCCTGTACTGCCTACTGTGGAGTTTCCGAACCTCCGCTGGCCACTTC
CCTCGAGCCTGTGCCTCCTCCAAGAGCCTGACGGAGAAGGAGTGCTGCCCGCCCTGGGCG
GGCGATGGGAGCCCCTGTGGCCGGCTCTCAGGCAGGGGCTCCTGCCAGGACGTCATTCTG
TCCACGGCACCACTCGGACCTCAGTTCCCCTTCACGGGGGTGGACGACCGCGAGTCTTGG
CCCTCCATCTTTTATAACAGAACCTGCCAGTGCTTTAGCAACTTCATGGGATTCAATTGC
GGAAGTTGTAAGTTTGGATTTAGGGGACCCCGCTGCACAGAAAGGCGACTTTTGGTGAGA
AGAAACATCTTTGATTTGAGTGTCCCAGAGAAGAACAAGTTTCTTGCCTATCTCACTTTG
GCAAAACATACCACCAGCCCAGACTACGTCATCCCCACGGGCACCTATGGCCAAATGAAT
CATGGAACAACACCCCTGTTTAATGACGTCAGTGTTTACGACCTCTTTGTCTGGATGCAT
TATTATGTGTCAAGGGACACGCTGCTTGGGGACTCTGAAGTCTGGAGAGACATTGATTTT
GCTCATGAAGCCCCAGGTTTCCTGCCTTGGCATAGACTCTTCCTGCTGCTGTGGGAACAG
GAAATCCAGAAGCTGACCGGGGATGAGAACTTCACGATTCCATACTGGGACTGGAGAGAT
GCAGAAAACTGTGACGTTTGCACAGATGAGTACATGGGAGGGCGCAACCCTGCAAACCCT
AATCTACTCAGCCCAGCATCCTTCTTCTCCTCTTGGCAGATCGTCTGCAGCAGACTGGAG
GAGTACAACAGTCGCCAGGCTTTATGCAACGGGACGTCTGAGGGACCATTACTGCGCAAT
CCTGGAAACCACGACAAAGCCAGGACCCCGAGGCTCCCCTCCTCGGCTGATGTGGAGTTT
TGCCTGAGTTTGACCCAGTATGAATCAGGTTCCATGGATAAAGCTGCCAATTTCAGCTTT
AGAAATACCCTGGAAGGATTTGCTGATCCAGTTACTGGGATAGCAGATGCCTCTCAAAGC
AGTATGCACAATGCCTTGCACATCTACATGAACGGAACGATGTCTCAGGTACCAGGATCT
GCCAATGATCCCATCTTCCTTCTTCATCACGCGTTTGTTGACAGTATTTTTGAACAGTGG
CTTCGAAAGTATCATCCTCTTCAAGATGTTTATCCAGAAGCTAATGCACCCATTGGGCAC
AACCGGGAATCCTACATGGTTCCTTTCATCCCTCTCTACAGAAACGGTGACTTCTTTATT
TCATCCAAAGATNTAGGCTACGACTATAGCTACCTACAAGATTCAGAACCGGACATTTTT
CAAGATTACATTAAGCCCTACTTAGAACAAGCGCAACGAATCTGGCCGTGGCTCATTGGG
GCAGCTGTGGTTGGGTCCGTCCTTACTGCTGTGCTGGGAGGACTTACTAGCCTGTTATGT
CGTCGAAAGAGAAACCAGCTTCCAGAAGAAAAGCAGCCCCTGCTCATGGAAAAAGAGGAT
TACCACAATTTGATGTATCAGAGCCATTTATGA
Enzyme 13 GenBank Gene ID AY046527 Link Image
Enzyme 13 GeneCard ID TYR Link Image
Enzyme 13 GenAtlas ID Not Available
Enzyme 13 HGNC ID Not Available
Enzyme 13 Chromosome Location Chromosome:1
Enzyme 13 Locus 11q14-q21
Enzyme 13 SNPs SNPJam Report Link Image
Enzyme 13 General References
  1. [PubMed Link Image]
Enzyme 13 Metabolite References Not Available
Enzyme 14 [top]
Enzyme 14 ID 859
Enzyme 14 Name Tyrosine aminotransferase
Enzyme 14 Synonyms
  1. TAT
  2. L-tyrosine:2-oxoglutarate aminotransferase
Enzyme 14 Gene Name TAT
Enzyme 14 Protein Sequence >Tyrosine aminotransferase
MQDHGSLPSVLDVHVNVAGRSSVLGKVKSRKARWSVRPSDMSNKTFNPIRAIVDNMKVKP
NPNKTMIALSIGDPTVFGNLPTDPEVTQAMKDALDSGKFNGYVPSIGYLSSREEVASYYH
CPEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILVPRPGFSLYRTLAESMGIEVKLYN
LLPEKNWEIDLKQLESLIDEKTVCLIVNNPSNPCGSVFSRRHLQKILAVAARQCVPILAD
EIYGDMVFSDSKFEPLATLSSKVPILSCGGLAKRWLVPGWRMGWILIHDRRDIFGNEIRD
GLTKLSQRILGPCTLVQGALKSILCRTPRVFYHNTLSFLKSNADLCYGALAAIPGLRPIH
PSGAMYLMVGIEMEHFPEFENDVEFTEQLVAEQSVHCLPATCFEYPNFFRVVITVPEVMM
LEACSRIQEFCEQHYHCAEGSQEECDK
Enzyme 14 Number of Residues 447
Enzyme 14 Molecular Weight 49691.0
Enzyme 14 Theoretical pI 6.43
Enzyme 14 GO Classification
Function
Process
Component
Enzyme 14 General Function Amino acid transport and metabolism
Enzyme 14 Specific Function L-tyrosine + 2-oxoglutarate = 4- hydroxyphenylpyruvate + L-glutamate
Enzyme 14 Pathways
  • Amino-acid degradation
  • L-phenylalanine degradation
  • acetoacetate and fumarate from L-phenylalanine:step 2/6
Enzyme 14 Reactions Not Available
Enzyme 14 Pfam Domain Function
Enzyme 14 Signals
  • None
Enzyme 14 Transmembrane Regions
  • None
Enzyme 14 Essentiality Not Available
Enzyme 14 GenBank ID Protein 61555008 Link Image
Enzyme 14 UniProtKB/Swiss-Prot ID Q58CZ9 Link Image
Enzyme 14 UniProtKB/Swiss-Prot Entry Name ATTY_BOVIN Link Image
Enzyme 14 PDB ID Not Available
Enzyme 14 Cellular Location Not Available
Enzyme 14 Gene Sequence >1344 bp
ATGCAGGATCACGGCAGCCTCCCCTCAGTTCTGGATGTGCATGTCAACGTTGCTGGGAGA
AGCTCTGTGCTGGGAAAAGTGAAAAGCAGGAAGGCCAGATGGTCCGTGAGGCCCTCGGAC
ATGTCCAACAAAACTTTCAATCCCATCCGGGCCATTGTGGACAACATGAAGGTGAAGCCA
AATCCAAACAAGACCATGATTGCTTTGTCGATTGGGGACCCTACTGTATTTGGAAACCTG
CCGACAGATCCTGAAGTTACCCAAGCAATGAAAGATGCCCTCGACTCAGGGAAGTTTAAT
GGCTATGTCCCCTCCATTGGCTACTTATCCAGTCGGGAGGAAGTTGCTTCTTATTACCAC
TGTCCCGAGGCACCCCTGGAAGCTAAGGATGTCATTCTGACAAGTGGCTGCAGTCAGGCT
ATTGAACTGTGTTTGGCTGTGTTGGCCAACCCAGGGCAAAACATCCTAGTTCCGAGACCT
GGCTTCTCTCTCTACAGGACTCTGGCTGAATCTATGGGAATTGAGGTCAAACTCTACAAT
TTATTGCCAGAGAAGAATTGGGAAATTGACCTGAAACAATTAGAATCTCTGATTGATGAA
AAGACAGTTTGTCTTATTGTCAACAATCCATCAAACCCTTGTGGGTCAGTGTTCAGTAGA
CGTCATCTCCAGAAAATTTTGGCAGTGGCTGCAAGGCAATGTGTTCCCATTTTAGCTGAT
GAGATCTATGGAGACATGGTGTTTTCAGATTCCAAATTTGAGCCTCTGGCCACCCTCAGC
AGCAAAGTCCCCATCCTGTCCTGTGGAGGGCTGGCCAAGCGCTGGCTGGTTCCTGGCTGG
AGGATGGGCTGGATCCTTATCCATGACCGAAGAGATATTTTTGGCAATGAGATCCGAGAT
GGGCTGACGAAGCTAAGTCAACGGATCCTGGGCCCCTGCACCCTTGTCCAGGGAGCTCTG
AAAAGCATCCTGTGTCGCACCCCTCGTGTGTTCTACCACAACACTCTAAGCTTCCTCAAG
TCCAATGCGGATCTCTGCTATGGGGCATTGGCTGCCATCCCCGGACTCCGGCCCATTCAC
CCTTCTGGGGCCATGTACCTCATGGTTGGAATTGAGATGGAACATTTCCCAGAATTTGAG
AATGATGTGGAGTTCACGGAGCAGTTAGTTGCTGAGCAATCTGTCCACTGCCTCCCAGCA
ACGTGCTTTGAGTATCCAAATTTCTTCCGAGTGGTAATCACAGTCCCTGAAGTGATGATG
CTGGAGGCCTGTAGCCGGATCCAGGAGTTCTGTGAACAGCACTACCATTGTGCTGAAGGG
AGCCAGGAGGAATGTGACAAATAG
Enzyme 14 GenBank Gene ID BT021798 Link Image
Enzyme 14 GeneCard ID TAT Link Image
Enzyme 14 GenAtlas ID Not Available
Enzyme 14 HGNC ID Not Available
Enzyme 14 Chromosome Location Chromosome:1
Enzyme 14 Locus 16q22.1
Enzyme 14 SNPs SNPJam Report Link Image
Enzyme 14 General References
  1. [PubMed Link Image]
Enzyme 14 Metabolite References Not Available
Enzyme 15 [top]
Enzyme 15 ID 915
Enzyme 15 Name Phosphatidylinositol 3-kinase regulatory subunit alpha
Enzyme 15 Synonyms
  1. PI3-kinase p85 subunit alpha
  2. PtdIns-3-kinase p85-alpha
  3. PI3K
Enzyme 15 Gene Name PIK3R1
Enzyme 15 Protein Sequence >Phosphatidylinositol 3-kinase regulatory subunit alpha
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGPSKTEADSEQQASTLPDLAE
QFAPPDVAPPLLIKLVEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDTASLDLEMFDVH
VLADAFKRYLLDLPNPVIPVAVSSELISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSELFSPLLFRFPAASSENTEHLIKIIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
Enzyme 15 Number of Residues 724
Enzyme 15 Molecular Weight 83496.5
Enzyme 15 Theoretical pI 6.03
Enzyme 15 GO Classification
Function
Process
Component
Enzyme 15 General Function Replication, recombination and repair
Enzyme 15 Specific Function Binds to activated (phosphorylated) protein-tyrosine kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane. Necessary for the insulin-stimulated increase in glucose uptake and glycogen synthesis in insulin-sensitive tissues
Enzyme 15 Pathways Not Available
Enzyme 15 Reactions Not Available
Enzyme 15 Pfam Domain Function
Enzyme 15 Signals
  • None
Enzyme 15 Transmembrane Regions
  • None
Enzyme 15 Essentiality Not Available
Enzyme 15 GenBank ID Protein 163477 Link Image
Enzyme 15 UniProtKB/Swiss-Prot ID P23727 Link Image
Enzyme 15 UniProtKB/Swiss-Prot Entry Name P85A_BOVIN Link Image
Enzyme 15 PDB ID 1PBW Link Image
Enzyme 15 PDB File Show
Enzyme 15 3D Structure
Enzyme 15 Cellular Location Not Available
Enzyme 15 Gene Sequence Not Available
Enzyme 15 GenBank Gene ID M61745 Link Image
Enzyme 15 GeneCard ID PIK3R1 Link Image
Enzyme 15 GenAtlas ID Not Available
Enzyme 15 HGNC ID Not Available
Enzyme 15 Chromosome Location Chromosome:5
Enzyme 15 Locus 5q13.1
Enzyme 15 SNPs SNPJam Report Link Image
Enzyme 15 General References
  1. [PubMed Link Image]
Enzyme 15 Metabolite References Not Available
Enzyme 16 [top]
Enzyme 16 ID 1006
Enzyme 16 Name Protein tyrosine phosphatase type IVA 3
Enzyme 16 Synonyms
  1. Protein-tyrosine phosphatase 4a3
Enzyme 16 Gene Name PTP4A3
Enzyme 16 Protein Sequence >Protein tyrosine phosphatase type IVA 3
MARMNRPAPVEVSYKNMRFLITHNPTNATLSSFIEDLKKYGATTVVRVCEVTYDKAPLEK
DGITVVDWPFDDGAPPPGKVVEDWLSLLKNKFCDDPGSCVAVHCVAGLGRAPVLVALALI
ESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHAHKTKCCIM
Enzyme 16 Number of Residues 173
Enzyme 16 Molecular Weight 19510.6
Enzyme 16 Theoretical pI 9.44
Enzyme 16 GO Classification
Function
Process
Component
Enzyme 16 General Function Signal transduction mechanisms
Enzyme 16 Specific Function Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis. May be involved in the progression of cardiac hypertrophy by inhibiting intracellular calcium mobilization in response to angiotensin II
Enzyme 16 Pathways Not Available
Enzyme 16 Reactions Not Available
Enzyme 16 Pfam Domain Function
Enzyme 16 Signals
  • None
Enzyme 16 Transmembrane Regions
  • None
Enzyme 16 Essentiality Not Available
Enzyme 16 GenBank ID Protein 124829080 Link Image
Enzyme 16 UniProtKB/Swiss-Prot ID A2VDT1 Link Image
Enzyme 16 UniProtKB/Swiss-Prot Entry Name TP4A3_BOVIN Link Image
Enzyme 16 PDB ID 1V3A Link Image
Enzyme 16 PDB File Show
Enzyme 16 3D Structure
Enzyme 16 Cellular Location Not Available
Enzyme 16 Gene Sequence >522 bp
ATGGCGCGGATGAACCGGCCGGCCCCTGTGGAGGTCAGCTACAAGAACATGCGCTTCCTC
ATCACGCACAACCCCACCAATGCCACCCTCAGCAGCTTCATCGAGGACCTGAAGAAGTAC
GGGGCCACCACCGTGGTGCGCGTGTGTGAGGTGACCTACGACAAGGCCCCGCTGGAGAAG
GACGGCATCACGGTTGTGGACTGGCCGTTTGATGATGGGGCACCCCCGCCCGGCAAAGTG
GTGGAGGACTGGCTGAGCCTGCTGAAGAACAAGTTCTGTGATGACCCCGGCAGCTGCGTG
GCTGTGCACTGCGTGGCTGGCCTGGGGCGGGCTCCCGTCCTCGTGGCGCTGGCCCTCATC
GAGAGCGGGATGAAGTATGAGGACGCCATCCAGTTCATCCGACAGAAGCGGCGCGGAGCC
ATCAACAGCAAACAGCTCACCTACCTGGAAAAATACCGGCCGAAGCAGAGACTGCGGTTC
AAGGACCCCCACGCGCACAAGACCAAGTGCTGCATCATGTAG
Enzyme 16 GenBank Gene ID BC133386 Link Image
Enzyme 16 GeneCard ID PTP4A3 Link Image
Enzyme 16 GenAtlas ID Not Available
Enzyme 16 HGNC ID Not Available
Enzyme 16 Chromosome Location Chromosome:8
Enzyme 16 Locus 8q24.3
Enzyme 16 SNPs SNPJam Report Link Image
Enzyme 16 General References Not Available
Enzyme 16 Metabolite References Not Available
Enzyme 17 [top]
Enzyme 17 ID 1230
Enzyme 17 Name Phosphatidylinositol 3-kinase regulatory subunit beta
Enzyme 17 Synonyms
  1. PI3-kinase p85 subunit beta
  2. PtdIns-3-kinase p85-beta
Enzyme 17 Gene Name PIK3R2
Enzyme 17 Protein Sequence >Phosphatidylinositol 3-kinase regulatory subunit beta
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGNERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPILVKLVEAIERTGLDSYRPEPPAVRTDWSLSDVEQWDAAALSDGVKGFLLALPA
PLVTPEAAAEAHRALREAAGPVGPALEPPTLPLHHALTLRFLLQHLGRVAGRAPAPGPAV
RALGATFGPLLLRAPPPPSPPPGGAPDGTEPTPDFPALLVEKLLQEHLEEQEVAPPALPP
KPPKTKPAPTGLANGGSPPSLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGE
YTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLLYP
VSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAF
NETIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQ
ELRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQ
YSLMEDEDDLPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGD
TKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPP
PAAR
Enzyme 17 Number of Residues 724
Enzyme 17 Molecular Weight 81059.0
Enzyme 17 Theoretical pI 6.26
Enzyme 17 GO Classification
Function
Process
Component
Enzyme 17 General Function Involved in phosphoinositide 3-kinase regulator activity
Enzyme 17 Specific Function Binds to activated (phosphorylated) protein-tyrosine kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane
Enzyme 17 Pathways Not Available
Enzyme 17 Reactions Not Available
Enzyme 17 Pfam Domain Function
Enzyme 17 Signals
  • None
Enzyme 17 Transmembrane Regions
  • None
Enzyme 17 Essentiality Not Available
Enzyme 17 GenBank ID Protein 163479 Link Image
Enzyme 17 UniProtKB/Swiss-Prot ID P23726 Link Image
Enzyme 17 UniProtKB/Swiss-Prot Entry Name P85B_BOVIN Link Image
Enzyme 17 PDB ID Not Available
Enzyme 17 Cellular Location Not Available
Enzyme 17 Gene Sequence Not Available
Enzyme 17 GenBank Gene ID M61746 Link Image
Enzyme 17 GeneCard ID PIK3R2 Link Image
Enzyme 17 GenAtlas ID Not Available
Enzyme 17 HGNC ID Not Available
Enzyme 17 Chromosome Location Chromosome:1
Enzyme 17 Locus 19q13.2-q13.4
Enzyme 17 SNPs SNPJam Report Link Image
Enzyme 17 General References
  1. [PubMed Link Image]
Enzyme 17 Metabolite References Not Available
Enzyme 18 [top]
Enzyme 18 ID 1231
Enzyme 18 Name Tyrosine-protein phosphatase non-receptor type substrate 1
Enzyme 18 Synonyms
  1. SHP substrate 1
  2. SHPS-1
  3. Inhibitory receptor SHPS-1
  4. Signal-regulatory protein alpha-1
  5. Sirp-alpha-1
  6. MyD-1 antigen
  7. CD172 antigen-like family member A
  8. CD172a antigen
Enzyme 18 Gene Name SIRPA
Enzyme 18 Protein Sequence >Tyrosine-protein phosphatase non-receptor type substrate 1
MEPARPAPGRLRPLLCLLLAASNAWTGTAGDGELQVIQPERSVSVAAGETATLHCTVTSL
SPVGPIKWFKGTGPGREFIYSQKEAPFPRVTNVSDATKRNNMDFSIRISNITPADAGVYY
CVKFRKEERGDMEFKSGPGTHLTVSAKPSPPVLSGPTVRATPEQTVNFTCTSHGFSPRNI
SLKWFKNGNELSASQTSVDPEDNNVSYSINSTTKVLLATGDVHSQVICEVAHVTLQGGPP
LRGTANLSETIRVPPTLEITGSPSAGNQVNVTCQVNKFYPRHLQLTWLENGNMSRTEAAS
VFVENKDGTFNQTSWFLVNSSAHREAVVLTCQVEHDGQPAVSKNHTLEVSAPQKDQDTGQ
TPGPNDSNWTSIFIVVGVVCALLVALLIAALYLLRIRQNKAKGSTSSTRLHEPEKNTRET
TQIQDNNDITYADLNLPKGKKSTPKANEPNNHTEYASIQARPPPVSEDTLTYADLDMVHL
NRTPKQPAPKPEPSYSEYASVQVQRK
Enzyme 18 Number of Residues 506
Enzyme 18 Molecular Weight 55092.5
Enzyme 18 Theoretical pI 7.81
Enzyme 18 GO Classification
Function
Process
Component
Enzyme 18 General Function Involved in SH3 domain binding
Enzyme 18 Specific Function Immunoglobulin-like cell surface receptor for CD47. Acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. Supports adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. May play a key role in intracellular signaling during synaptogenesis and in synaptic function. Involved in the negative regulation of receptor tyrosine kinase-coupled cellular responses induced by cell adhesion, growth factors or insulin. Mediates negative regulation of phagocytosis, mast cell activation and dendritic cell activation. CD47 binding prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells
Enzyme 18 Pathways Not Available
Enzyme 18 Reactions Not Available
Enzyme 18 Pfam Domain Function
Enzyme 18 Signals
  • 1-29
Enzyme 18 Transmembrane Regions
  • 372-392
Enzyme 18 Essentiality Not Available
Enzyme 18 GenBank ID Protein 2842390 Link Image
Enzyme 18 UniProtKB/Swiss-Prot ID O46631 Link Image
Enzyme 18 UniProtKB/Swiss-Prot Entry Name SHPS1_BOVIN Link Image
Enzyme 18 PDB ID Not Available
Enzyme 18 Cellular Location Not Available
Enzyme 18 Gene Sequence >1521 bp
ATGGAGCCAGCCCGCCCGGCCCCCGGCCGCCTCAGGCCGCTGCTCTGCCTGCTGCTCGCC
GCGTCCAGCGCCTGGACAGGAGCGGCAGGTGACGGGGAGCTGCAGGTGATTCAGCCTGAG
AGGTCAGTGTCAGTTGCAGCAGGAGAGACGGCCACTCTGCACTGCACCGTGACCTCCCTG
CTCCCCGTGGGGCCCATCAAGTGGTTCAGGGGAACTGGGCCAGGTCGGGAGTTCATCTAC
AGTCAAAAAGAAGCTCCTTTCCCCCGAGTAACAAATGTTTCAGATGCCACAAAGAGAAAC
AACATGGACTTTTCCATCCGCATCAGTAACATCACCCCAGCAGACGCTGGTGTCTACCAC
TGTGTGAAGTTCCAGAAAGGAGAACATGGTGACGTGGAGTTTAAGTCTGGACCAGGCACT
CATCTCACTGTGAACGCCAAACCCTCTCCTCCCGTGGTATCCGGCCCTACAGTGAGGGCT
ACACCTGAGCAGACAGTGAACTTCACCTGCACATCCCACGGCTTCTCCCCCAGAAACATC
TCCCTGAAATGGTTCAAAAATGGCAATGAGCTCTCAGCCTCCCAGACCAGCGTGGACCCA
GAGGACGACAACGTTTCCTACAGCATCAACAGCACAACCAAAGTGCTGCTGGCCACGGGA
GACGTTCACTCCCAGGTCATCTGCGAGGTGGCCCACGTCACCCTGCAGGGGGGCCCTCCT
CTCCGTGGGACTGCCAACTTGTCCGAGACCATCCGAGTTCCACCCACCCTGGAGATTACC
AGGTCCCCGTCAGCTGGGAACCAGGTGAACGTCACCTGCCAGGTGAACAAGTTCTACCCC
CGGCACCTACAGCTGACCTGGCTGGAGAACGGAAACATGTCCCGAACGGAAGCAGCCTCA
GTCCTCGTAGAGAACAAGGACGGGACCTTTAACCAGACGAGCTGGCTCCTGGTGAACTCC
TCTGCCCACAGGGAGGCTGTGGTGCTCACCTGCCAGGTGGAGCACGACAGGCAGCCGGCG
GTCTCCAAAAACCATACCCTGGAGGTCTCTGCTCCCCAGAAGGACCAGGACACAGGTCAA
ACCCCTGGCCCGAATGACAACAACTGGACCAGCATCTTCATCGTGGTGGGCGTGGTGTGT
GCCTTGCTGGTGGCCCTGCTGATCGCAGCCCTCTACCTCCTCCGAATCAGACAGAACAAA
GCCAAGGGCTCCACTTCTTCTACAAGGCTGCACGAGCCCGAGAAGAACACCAGAGAAACA
ACTCTGATCCAAGACAACAATGACTTCACATATGCAGAACTGAACCTGCCCAAGGGGAAG
AAATCAACCCCCAAGGCCAATGAACCGAACAACCACACGGAGTATGCCAGCATTCAGGCC
CGCCCGCCACCTGTATCTGAGGACACCCTCACCTACGCTGACCTGGACATGGTCCACCTC
AACCGGACCCCCAAGCAGCCGGCCCCCAAGCCTGAGCCATCCTACTCAGAGTATGCCAGT
GTCCAGGTCCAGAGGAAGTGA
Enzyme 18 GenBank Gene ID Y11045 Link Image
Enzyme 18 GeneCard ID SIRPA Link Image
Enzyme 18 GenAtlas ID Not Available
Enzyme 18 HGNC ID Not Available
Enzyme 18 Chromosome Location Chromosome:2
Enzyme 18 Locus 20p13
Enzyme 18 SNPs SNPJam Report Link Image
Enzyme 18 General References
  1. [PubMed Link Image]
Enzyme 18 Metabolite References Not Available
Enzyme 19 [top]
Enzyme 19 ID 1232
Enzyme 19 Name Tyrosyl-tRNA synthetase, cytoplasmic
Enzyme 19 Synonyms
  1. Tyrosyl--tRNA ligase
  2. TyrRS
Enzyme 19 Gene Name YARS
Enzyme 19 Protein Sequence >Tyrosyl-tRNA synthetase, cytoplasmic
MGDSLSPEEKLSLITRNLQEVLGEEKLKEILKERELKVYWGTATTGKPHVAYFVPMSKIA
DFLKAGCEVTILFADLHAYLDNMKAPWDVLELRTSYYENVIKAMLESIGVPLEKLRFIKG
TDYQLSKEYTLDVYRLSSVVTQHDAKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVD
AQFGGVDQRKIFTFAEKYLPALGYSKRIHLMNPMVPGLTGSKMSSSEEESKIDLLDRKED
VKKKLKKAFCEPGNVENNGVLAFIRHVLFPLKSEFVILRDEKWGGNKTYTAYLDLEKDFA
DEVVHPGDLKNSVEVALNKLLDPIREKFNTPALKKLSSAAYPDPSKQKPAVKGPAKNSEP
EEVIPSRLDIRVGKVISVDKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLV
VVLCNLKPQKMRGVKSQGMLLCASVEGVNRKVEPLDPPAGSAPGERVFVKGYEKGQPDEE
LKPKKKVFEKLQADFKISDEYIAQWKQTNFMTKMGSVSCKSLKGGNIS
Enzyme 19 Number of Residues 528
Enzyme 19 Molecular Weight 59148.9
Enzyme 19 Theoretical pI 7.89
Enzyme 19 GO Classification
Function
Process
Component
Enzyme 19 General Function Translation, ribosomal structure and biogenesis
Enzyme 19 Specific Function Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction:tyrosine is first activated by ATP to form Tyr- AMP and then transferred to the acceptor end of tRNA(Tyr)
Enzyme 19 Pathways Not Available
Enzyme 19 Reactions Not Available
Enzyme 19 Pfam Domain Function
Enzyme 19 Signals
  • None
Enzyme 19 Transmembrane Regions
  • None
Enzyme 19 Essentiality Not Available
Enzyme 19 GenBank ID Protein 3941720 Link Image
Enzyme 19 UniProtKB/Swiss-Prot ID Q29465 Link Image
Enzyme 19 UniProtKB/Swiss-Prot Entry Name SYYC_BOVIN Link Image
Enzyme 19 PDB ID 1Q11 Link Image
Enzyme 19 PDB File Show
Enzyme 19 3D Structure
Enzyme 19 Cellular Location Not Available
Enzyme 19 Gene Sequence >1587 bp
ATGGGGGACTCTCTGAGCCCTGAAGAGAAGCTAAGCCTTATCACCCGGAACCTGCAGGAG
GTTCTCGGGGAAGAGAAGCTGAAGGAGATACTGAAGGAGCGAGAACTTAAAGTTTACTGG
GGGACAGCAACTACAGGCAAGCCACATGTGGCTTACTTTGTGCCCATGTCTAAGATCGCA
GACTTCCTGAAAGCAGGATGTGAGGTAACGATTCTGTTTGCGGACCTGCACGCATACCTG
GATAACATGAAGGCTCCGTGGGACGTTCTAGAACTTCGAACCAGCTATTATGAGAATGTG
ATCAAGGCAATGCTGGAGAGCATTGGGGTCCCCTTAGAGAAGCTCAGGTTCATCAAAGGC
ACTGATTACCAGCTCAGCAAAGAGTACACGCTGGATGTCTACCGCCTCTCTTCTGTGGTC
ACACAGCACGATGCCAAAAAAGCTGGAGCTGAGGTGGTAAAGCAGGTGGAGCACCCTCTG
CTGAGTGGCCTGCTGTACCCCGGGCTGCAGGCCTTGGATGAAGAATACTTGAAAGTGGAT
GCCCAGTTTGGAGGTGTTGATCAGAGAAAGATTTTCACCTTTGCAGAGAAGTACCTCCCT
GCACTTGGTTACTCAAAACGAATCCATCTGATGAATCCTATGGTTCCAGGATTAACTGGC
AGCAAAATGAGCTCTTCAGAAGAGGAGTCCAAGATTGATCTGCTTGATCGGAAAGAGGAT
GTAAAGAAAAAACTGAAGAAGGCCTTCTGTGAGCCAGGGAATGTGGAGAACAACGGCGTT
CTGGCCTTCATCAGACATGTCCTCTTTCCTCTCAAGTCTGAGTTTGTGATCCTTCGAGAT
GAAAAATGGGGTGGAAACAAAACCTACACAGCTTACTTGGACCTGGAAAAGGACTTTGCT
GATGAGGTTGTCCACCCTGGAGACCTCAAGAATTCTGTTGAAGTTGCCCTGAACAAGTTG
CTGGATCCCATCCGGGAGAAGTTTAATACTCCTGCTCTGAAGAAACTGTCCAGCGCTGCC
TACCCAGATCCCTCAAAGCAGAAGCCAGCTGTCAAAGGCCCTGCCAAGAATTCGGAGCCA
GAGGAGGTCATCCCATCCCGGCTGGATATCCGTGTGGGGAAAGTCATTAGTGTGGACAAG
CACCCAGATGCAGACAGCCTGTATGTGGAGAAGATTGATGTGGGGGAAGCTGAGCCACGG
ACTGTGGTGAGTGGCCTGGTGCAGTTTGTGCCCAAGGAGGAACTGCAGGACAGGCTGGTG
GTGGTGCTGTGCAATCTGAAACCCCAGAAGATGAGAGGAGTCAAGTCCCAAGGCATGCTC
CTGTGTGCTTCTGTAGAAGGGGTAAACCGCAAGGTTGAGCCTCTAGACCCTCCTGCAGGC
TCTGCTCCTGGTGAGCGAGTGTTTGTGAAGGGCTATGAGAAGGGCCAACCAGACGAAGAG
CTGAAGCCCAAGAAGAAAGTCTTTGAGAAATTGCAGGCTGACTTTAAAATTTCTGACGAG
TACATTGCACAGTGGAAGCAAACCAACTTCATGACCAAGATGGGGTCCGTCTCCTGTAAA
TCGCTGAAAGGGGGGAACATCAGCTAG
Enzyme 19 GenBank Gene ID AF087021 Link Image
Enzyme 19 GeneCard ID YARS Link Image
Enzyme 19 GenAtlas ID Not Available
Enzyme 19 HGNC ID Not Available
Enzyme 19 Chromosome Location Chromosome:1
Enzyme 19 Locus 1p35.1
Enzyme 19 SNPs SNPJam Report Link Image
Enzyme 19 General References Not Available
Enzyme 19 Metabolite References Not Available
Enzyme 20 [top]
Enzyme 20 ID 1233
Enzyme 20 Name M-phase inducer phosphatase 1
Enzyme 20 Synonyms
  1. Dual specificity phosphatase Cdc25A
Enzyme 20 Gene Name CDC25A
Enzyme 20 Protein Sequence >M-phase inducer phosphatase 1
MELGPEPPHRRRLLFACSPPPAPQPVVKALFGTPAAGGLSPVTNLTVTMDQLQGLGSEYE
QPIEVKNSSLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRINSLPQKLLGCSPALKR
SHSDSLDHDVFQLIDQDENKENQVFEFKKPIRPASRGCLHVHGLEEGKDVFTQRQNSAPA
RMLSSNERDGNEPGNSIPFMPQSPVTPTLSDEDDGFMDLLDGENLKNDEETPSCMASLWT
APLVMRRTNNLGNRCKLFDSPSASCSSTIRSMLKRPDRSLEESPGGSRKRRKSVAGASPE
EAASPEKPQEILHHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKY
ISPEIITSVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEEFLLKKPIVP
TDGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFLKCQS
HCEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL
Enzyme 20 Number of Residues 525
Enzyme 20 Molecular Weight 59141.5
Enzyme 20 Theoretical pI 7.07
Enzyme 20 GO Classification
Function
Process
Component
Enzyme 20 General Function Involved in protein tyrosine phosphatase activity
Enzyme 20 Specific Function Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. Directly dephosphorylates CDC2 and stimulates its kinase activity. Also dephosphorylates CDK2 in complex with cyclin E, in vitro
Enzyme 20 Pathways Not Available
Enzyme 20 Reactions Not Available
Enzyme 20 Pfam Domain Function
Enzyme 20 Signals
  • None
Enzyme 20 Transmembrane Regions
  • None
Enzyme 20 Essentiality Not Available
Enzyme 20 GenBank ID Protein 154425765 Link Image
Enzyme 20 UniProtKB/Swiss-Prot ID A7MBD1 Link Image
Enzyme 20 UniProtKB/Swiss-Prot Entry Name MPIP1_BOVIN Link Image
Enzyme 20 PDB ID 1C25 Link Image
Enzyme 20 PDB File Show
Enzyme 20 3D Structure
Enzyme 20 Cellular Location Not Available
Enzyme 20 Gene Sequence >1578 bp
ATGGAACTGGGCCCGGAGCCCCCGCACCGCCGCCGCCTGCTCTTCGCCTGCAGCCCCCCG
CCCGCACCGCAGCCCGTCGTGAAGGCGCTGTTTGGCACGCCAGCCGCCGGGGGCCTGTCG
CCTGTCACCAACCTGACGGTCACCATGGACCAGCTGCAGGGACTGGGCAGTGAGTATGAA
CAACCCATAGAGGTGAAAAACAGCAGTCTGCAGAGAATGGGCTCCTCCGAATCAACTGAT
TCAGGCTTCTGTCTGGATTCTCCTGGGCCCTTGGATAGTAAAGAAAACCTTGAAAATCCC
ATGAGGAGAATAAATTCCCTACCTCAGAAGCTCTTGGGGTGTAGCCCAGCTCTGAAGAGG
AGCCATTCTGATTCTCTTGACCATGATGTCTTTCAGCTGATTGACCAGGATGAGAACAAG
GAAAATCAAGTCTTTGAGTTTAAGAAGCCAATAAGACCTGCATCTCGAGGCTGCCTACAT
GTTCACGGACTGGAGGAGGGTAAAGATGTCTTCACACAGAGGCAGAACTCCGCCCCAGCT
CGGATGCTTTCCTCAAATGAAAGAGATGGCAATGAACCAGGGAATTCCATTCCTTTTATG
CCCCAGTCACCTGTGACTCCCACTTTGTCTGATGAGGATGATGGCTTCATGGATCTTCTT
GATGGAGAGAATTTGAAGAATGATGAAGAGACCCCATCCTGCATGGCCAGCCTCTGGACA
GCTCCCCTTGTCATGAGAAGAACTAATAACCTAGGCAATCGCTGCAAGCTGTTTGACTCC
CCTTCAGCGTCGTGTAGCTCTACCATCCGGTCAATGTTGAAAAGACCAGACCGATCACTA
GAGGAGTCCCCAGGTGGAAGCAGGAAGCGGAGGAAAAGCGTGGCTGGGGCCAGTCCGGAA
GAGGCAGCTAGTCCAGAGAAGCCCCAGGAGATTCTACATCATCAGTCTTTATCCCTAGCA
TCTTCCCCAAAAGGGACCATTGAGAACATTTTGGATAATGACCCAAGGGACCTTATAGGA
GACTTCTCCAAGGGTTACCTCTTTCATACCGTTGCTGGAAAGCATCAGGATTTAAAATAC
ATCTCTCCAGAAATTATTACATCTGTTTTGAATGGCAAGTTTGCCAACCTCATTAAAGAG
TTTGTCATCATCGACTGCCGATACCCATATGAATATGAGGGAGGCCACATCAAGGGTGCA
GTGAACTTGCACATGGAAGAGGAGGTTGAAGAGTTCTTACTCAAGAAGCCTATCGTACCT
ACGGATGGCAAGCGTGTTATCGTGGTGTTCCACTGCGAGTTCTCTTCTGAGCGCGGCCCT
CGCATGTGCCGATACGTGAGAGAGAGGGATCGGCTCGGTAACGAGTACCCCAAACTCCAC
TACCCAGAGCTGTATGTCCTGAAGGGCGGATACAAGGAGTTCTTCCTGAAATGCCAGTCT
CACTGCGAGCCCCCCAGCTACCGGCCCATGCACCACGAGGACTTTAAAGAAGACCTGAAG
AAATTCCGCACCAAGAGCCGGACCTGGGCCGGGGAGAAGAGCAAGAGGGAGATGTACAGC
CGCCTGAAGAAGCTCTGA
Enzyme 20 GenBank Gene ID BC151493 Link Image
Enzyme 20 GeneCard ID CDC25A Link Image
Enzyme 20 GenAtlas ID Not Available
Enzyme 20 HGNC ID Not Available
Enzyme 20 Chromosome Location Chromosome:3
Enzyme 20 Locus 3p21
Enzyme 20 SNPs SNPJam Report Link Image
Enzyme 20 General References Not Available
Enzyme 20 Metabolite References Not Available
Enzyme 21 [top]
Enzyme 21 ID 1234
Enzyme 21 Name Reelin
Enzyme 21 Synonyms Not Available
Enzyme 21 Gene Name RELN
Enzyme 21 Protein Sequence >Reelin
ENVQFQWKQENLQVGEVYEACWALDNILIINSAHRQVVLEDNLDPVDTGNWL
Enzyme 21 Number of Residues 52
Enzyme 21 Molecular Weight 6068.7
Enzyme 21 Theoretical pI 3.79
Enzyme 21 GO Classification
Function
Process
Component
Enzyme 21 General Function Involved in calcium ion binding
Enzyme 21 Specific Function Extracellular matrix serine protease that plays a role in layering of neurons in the cerebral cortex and cerebellum. Regulates microtubule function in neurons and neuronal migration. Affects migration of sympathetic preganglionic neurons in the spinal cord, where it seems to act as a barrier to neuronal migration. Enzymatic activity is important for the modulation of cell adhesion. Binding to the extracellular domains of lipoprotein receptors VLDLR and ApoER2 induces tyrosine phosphorylation of Dab1 and modulation of Tau phosphorylation
Enzyme 21 Pathways Not Available
Enzyme 21 Reactions Not Available
Enzyme 21 Pfam Domain Function Not Available
Enzyme 21 Signals
  • None
Enzyme 21 Transmembrane Regions
  • None
Enzyme 21 Essentiality Not Available
Enzyme 21 GenBank ID Protein 7582342 Link Image
Enzyme 21 UniProtKB/Swiss-Prot ID Q9N117 Link Image
Enzyme 21 UniProtKB/Swiss-Prot Entry Name RELN_BOVIN Link Image
Enzyme 21 PDB ID Not Available
Enzyme 21 Cellular Location Not Available
Enzyme 21 Gene Sequence Not Available
Enzyme 21 GenBank Gene ID AF232904 Link Image
Enzyme 21 GeneCard ID RELN Link Image
Enzyme 21 GenAtlas ID Not Available
Enzyme 21 HGNC ID Not Available
Enzyme 21 Chromosome Location Chromosome:7
Enzyme 21 Locus 7q22
Enzyme 21 SNPs SNPJam Report Link Image
Enzyme 21 General References Not Available
Enzyme 21 Metabolite References Not Available
Enzyme 22 [top]
Enzyme 22 ID 1235
Enzyme 22 Name Receptor-type tyrosine-protein phosphatase F
Enzyme 22 Synonyms Not Available
Enzyme 22 Gene Name PTPRF
Enzyme 22 Protein Sequence >Receptor-type tyrosine-protein phosphatase F
MTPEPAPGRTMVPLVPALVMLGLVAGAHGDSKPVFVKVPEDQTGLSGGVASFVCQATGEP
KPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSA
KLSVLEEEQLPLGFPSIDMGPQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPVDPAAS
NGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSS
QEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPVGRNVLELSNVVRSANYTCVA
ISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSEPVSYYGIQYRPAGAE
GPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRV
QARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPLSAWHKHNTDAGLLTTVGSLLP
GITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAEVDSDTRIQLSWLLPPQERI
VKYELVYWAAEDEGQQHKVTFDPTSSYTVEDLKPDTLYRFQLAARSELGVGVFTPTIEAR
TAQSTPSAPPQKVTCVSVGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRGRHVVD
GIGREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPL
NSTAVRVSWKLPVPSKQHGQIRGYQVTYVRLENGEPRGAPIIQDVMLAEAQETTISGLTP
ETTYSITVAAYTTKGDGARSKPKIVTTTGAVPGRPTMMVSTTAMNTALLQWHPPKELPGE
LLGYRLQYRRADEARPSTIDFGKDDQHFTVTGLHKGATYIFRLTAKNRAGLGEEFEKEIT
TPEDVPSGFPQNLRVIGLTTSTTELIWDPPVLAERNGRITNYTVVYRDINSQQELQNVTA
DTHLTLSGLKPDTTYDIKVRARTSKGAGPLSPSIQSRTMPVEQVFAKNFRVEAAMKTSVL
LSWEVPDSYKSAVPFRILYNGQSVEVDGHSMRKLIADLQPNTEYSFVLMNRGSSAGGLQH
LVSIRTAPDLLPHKPLPASAYIEDGRFTLTMPRVQEPALVRWFYIMVVPIDRMGGSMLAP
QWSTPEELELDELLEAIEQGGGERLRRRRQTERLKPYVAAQVDVLPETFTLGDKKNYQGF
YNRPLSPDLSYQCFVLASLKEPVDQKRYACSPYSDEIVVQVTPAQQQEEPELLWVTGPVL
AVILIVLIVIAILLFKRKRTHSPSSKDEQSIGLKDSLLAHSSDPVEMRRLNYQTPGMRDH
PPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDH
SRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMM
TRLEEKSRVKCDQYWPARGTETYGLIQVTLLDTVELATYTVRTFALYKSGSSEKRELRQF
QFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMK
HEKTVDIYGHVTCMRAQRNYMVQTEDQYVFIHEALLEAAMCGHTEVPARNLYAHIQKLGQ
VPPGESVTAMELEFKLLANSKAHTSRFISANLPCNKFKNRLVNIMPYELTRVCLQPIRGV
EGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTRLREMGREKC
HQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVP
KTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQ
TVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT
Enzyme 22 Number of Residues 1898
Enzyme 22 Molecular Weight 211380.9
Enzyme 22 Theoretical pI 6.48
Enzyme 22 GO Classification
Function
Process
Component
Enzyme 22 General Function Involved in protein binding
Enzyme 22 Specific Function The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one
Enzyme 22 Pathways Not Available
Enzyme 22 Reactions Not Available
Enzyme 22 Pfam Domain Function
Enzyme 22 Signals
  • 1-29
Enzyme 22 Transmembrane Regions
  • 1255-1275
Enzyme 22 Essentiality Not Available
Enzyme 22 GenBank ID Protein 154426084 Link Image
Enzyme 22 UniProtKB/Swiss-Prot ID A7MBJ4 Link Image
Enzyme 22 UniProtKB/Swiss-Prot Entry Name PTPRF_BOVIN Link Image
Enzyme 22 PDB ID 1LAR Link Image
Enzyme 22 PDB File Show
Enzyme 22 3D Structure
Enzyme 22 Cellular Location Not Available
Enzyme 22 Gene Sequence >5697 bp
ATGACCCCTGAGCCAGCCCCAGGGAGGACGATGGTGCCCCTTGTCCCTGCACTTGTGATG
CTTGGTTTGGTGGCAGGTGCCCATGGCGACAGCAAACCTGTCTTTGTCAAGGTCCCCGAG
GACCAGACTGGATTGTCAGGAGGGGTGGCCTCCTTCGTGTGCCAAGCCACGGGGGAACCC
AAGCCGCGCATCACATGGATGAAGAAGGGGAAGAAAGTCAGCTCCCAGCGCTTCGAGGTC
ATCGAGTTTGATGACGGGGCAGGGTCTGTGCTGCGGATCCAGCCACTGCGGGTGCAGCGA
GACGAAGCCATCTATGAGTGCACGGCCACCAACAGTCTGGGGGAGATCAACACCAGTGCC
AAGCTCTCAGTGCTCGAAGAGGAACAGCTGCCCCTTGGGTTCCCCTCCATCGACATGGGG
CCTCAGCTGAAGGTGGTGGAGAAGGCCCGCACGGCCACTATGCTGTGTGCAGCAGGCGGG
AATCCAGACCCTGAGATCTCTTGGTTCAAGGACTTCCTCCCTGTGGACCCCGCCGCGAGC
AACGGCCGCATCAAGCAACTGCGTTCAGGTGCCTTGCAGATTGAGAGCAGCGAGGAGTCG
GACCAAGGCAAGTACGAGTGTGTGGCGACCAACTCTGCAGGCACTCGTTACTCGGCCCCT
GCCAACCTATATGTGCGAGTGCGCCGCGTGGCTCCGCGTTTCTCCATCCCTCCCAGCAGC
CAGGAGGTGATGCCGGGCGGCAGCGTGAACCTGACGTGCGTCGCCGTTGGCGCACCCATG
CCCTACGTGAAGTGGATGATGGGGGCCGAAGAGCTCACCAAGGAGGACGAGATGCCGGTC
GGCCGCAATGTGCTGGAGCTCAGCAACGTGGTGCGCTCCGCCAACTACACTTGCGTGGCC
ATCTCCTCCCTGGGCATGATCGAGGCCACGGCCCAGGTCACCGTGAAAGCCCTGCCGAAG
CCTCCAATTGACCTTGTGGTGACAGAGACAACTGCCACCAGCGTCACTCTGACCTGGGAC
TCTGGGAACTCAGAGCCTGTATCCTACTATGGCATCCAGTACCGCCCAGCGGGCGCGGAG
GGCCCCTTCCAGGAGGTGGACGGCGTGGCCACCACCCGCTACAGCATCGGCGGCCTGAGC
CCTTTCTCAGAGTACGCCTTCCGCGTGCTGGCGGTGAACAGCATCGGGCGCGGGCCGCCC
AGCGAGGCGGTGCGGGCGCGCACGGGGGAGCAGGCGCCCTCCAGCCCCCCGCGCCGCGTG
CAGGCACGCATGCTAAGCGCCAGCACCATGCTGGTGCAGTGGGAGCCGCCCGAGGAGCCT
AACGGCCTGGTGCGGGGCTACCGCGTCTACTACACCCCCGACTCCCGCCGCCCTCTGAGC
GCCTGGCACAAGCACAACACAGACGCCGGGCTCCTCACCACTGTGGGCAGCCTGCTGCCT
GGCATCACCTACAGCCTGCGTGTGCTGGCCTTCACCGCCGTGGGCGACGGCCCCCCCAGC
CCCACCATCCAGGTCAAGACGCAGCAGGGAGTGCCTGCCCAGCCCGCGGACTTCCAGGCC
GAGGTGGACTCAGACACCAGGATCCAGCTCTCGTGGCTGCTGCCCCCGCAGGAGCGGATC
GTCAAGTATGAGCTGGTGTACTGGGCGGCAGAGGACGAGGGCCAGCAGCACAAGGTGACC
TTCGACCCCACGTCCTCCTATACCGTAGAGGACCTGAAGCCCGACACACTGTACCGCTTC
CAGCTGGCCGCCCGCTCTGAGCTGGGGGTGGGAGTCTTCACCCCCACCATTGAGGCTCGC
ACAGCACAGTCCACCCCCTCCGCACCCCCCCAGAAGGTGACGTGTGTGAGCGTGGGCTCC
ACCACCGTCCGGGTAAGTTGGGTCCCGCCGCCGGCCGACAGCCGCAACGGCGTCATCACC
CAGTACTCGGTGGCCTACGAGGCGGTGGACGGCGAGGACCGTGGGCGGCACGTGGTGGAC
GGCATCGGCCGCGAGCACTCCAGCTGGGACCTGGTGGGCCTGGAGAAGTGGACGGAGTAC
CGGGTGTGGGTGCGGGCGCACACGGACGTGGGCCCCGGCCCCGAGAGCAGCCCGGTGCTG
GTCCGCACCGACGAGGACGTGCCCAGTGGGCCACCGCGGAAGGTGGAGGTGGAGCCGCTC
AACTCCACTGCCGTGCGCGTCTCCTGGAAGCTGCCCGTCCCCAGCAAGCAGCATGGCCAG
ATCCGCGGCTACCAGGTCACCTACGTGCGGCTGGAGAATGGCGAGCCCCGCGGCGCCCCC
ATCATCCAGGACGTCATGCTGGCCGAGGCCCAGGAAACCACCATCAGCGGCCTGACCCCG
GAGACCACCTACTCCATCACCGTGGCTGCCTACACCACCAAGGGGGACGGTGCCCGCAGC
AAGCCCAAAATTGTCACGACCACAGGGGCAGTCCCAGGACGGCCCACCATGATGGTCAGC
ACCACGGCCATGAACACGGCGCTGCTCCAGTGGCACCCGCCCAAGGAGCTGCCCGGGGAG
CTCCTGGGCTACCGGCTGCAGTACCGCCGAGCCGACGAGGCGCGGCCCAGCACCATCGAT
TTTGGCAAGGACGACCAGCACTTTACGGTCACTGGCCTGCACAAAGGGGCCACCTACATC
TTCCGGCTCACTGCCAAGAACCGGGCCGGCCTGGGCGAGGAGTTCGAGAAGGAAATCACG
ACCCCCGAGGACGTGCCCAGCGGTTTCCCCCAAAACCTGCGCGTGATAGGGCTGACCACA
TCTACCACGGAACTGATCTGGGACCCCCCAGTGCTGGCGGAGAGGAACGGGCGCATCACC
AACTACACCGTGGTGTACCGTGACATCAACAGCCAGCAGGAGCTTCAGAACGTCACTGCC
GACACCCACCTGACGCTCTCCGGCCTCAAGCCAGACACCACTTACGACATCAAGGTCCGC
GCACGCACCAGCAAGGGCGCCGGCCCGCTCAGCCCCAGCATCCAGTCCCGGACCATGCCC
GTGGAGCAAGTGTTTGCCAAGAACTTCCGTGTGGAGGCTGCAATGAAGACATCTGTGCTG
CTCAGCTGGGAGGTGCCCGACTCCTACAAGTCAGCAGTGCCCTTCAGGATCCTGTACAAT
GGGCAGAGCGTGGAGGTGGACGGGCACTCCATGCGGAAGCTGATTGCAGACCTGCAGCCC
AACACTGAATACTCATTTGTGCTGATGAACCGCGGCAGCAGCGCGGGGGGCCTGCAACAC
CTCGTGTCCATCCGCACGGCCCCCGACCTCCTGCCGCACAAGCCACTGCCAGCCTCGGCC
TACATCGAGGACGGCCGCTTCACCCTCACCATGCCCCGCGTGCAGGAACCCGCACTGGTC
AGGTGGTTCTACATCATGGTGGTGCCCATTGACCGCATGGGAGGGAGCATGCTGGCGCCA
CAGTGGAGCACGCCCGAGGAGCTGGAGCTGGACGAGCTGCTGGAGGCCATCGAGCAGGGC
GGCGGGGAGCGGCTGCGGCGCCGGCGGCAGACGGAGCGGCTGAAGCCATACGTGGCCGCT
CAGGTGGACGTTCTCCCGGAGACCTTCACCTTGGGGGACAAGAAGAACTATCAAGGCTTC
TACAACCGGCCGCTGTCTCCAGACCTGAGCTACCAGTGCTTTGTGCTCGCCTCCCTGAAG
GAACCCGTGGACCAGAAGCGCTATGCCTGCAGCCCCTACTCCGATGAGATCGTGGTCCAG
GTGACACCAGCCCAGCAGCAGGAGGAACCCGAGCTGCTGTGGGTGACGGGCCCCGTCCTG
GCAGTCATTCTCATCGTCCTCATTGTCATCGCCATTCTCCTGTTCAAGAGGAAAAGGACC
CACTCCCCATCGTCCAAGGATGAGCAGTCAATTGGGCTGAAGGACTCCTTGCTGGCCCAC
TCCTCCGACCCTGTGGAGATGCGGCGGCTCAACTACCAGACCCCAGGTATGCGAGACCAC
CCGCCCATCCCCATCACCGACCTAGCTGACAACATCGAGCGCCTCAAAGCCAATGACGGC
CTCAAGTTCTCCCAGGAGTACGAGTCAATTGACCCAGGACAGCAGTTCACGTGGGAGAAT
TCAAACCTGGAGGTGAACAAGCCGAAGAACCGCTATGCCAACGTCATTGCTTACGACCAC
TCTCGAGTCATCCTTACCTCCATCGATGGTGTCCCCGGGAGCGACTACATCAATGCCAAT
TACATCGACGGCTACCGCAAGCAGAACGCCTACATTGCCACGCAGGGCCCGCTGCCTGAG
ACCATGGGCGATTTCTGGCGGATGGTGTGGGAACAGCGCACAGCCACTGTGGTCATGATG
ACGCGGCTGGAGGAGAAGTCCCGGGTGAAATGTGACCAGTACTGGCCAGCTCGTGGCACC
GAGACCTATGGCCTCATCCAGGTGACCCTGCTGGACACGGTGGAGCTGGCCACCTACACT
GTGCGCACCTTCGCGCTCTACAAGAGTGGCTCCAGTGAGAAGCGGGAGCTGCGTCAGTTC
CAGTTCATGGCCTGGCCAGACCACGGAGTCCCCGAGTACCCGACCCCTATCCTGGCCTTC
CTGCGGCGGGTCAAGGCTTGCAACCCCCTGGACGCGGGGCCCATGGTGGTGCACTGCAGC
GCGGGCGTGGGCCGCACGGGCTGCTTCATCGTCATCGACGCCATGCTGGAGCGGATGAAG
CACGAGAAGACAGTGGACATCTACGGCCACGTGACGTGCATGCGGGCGCAGCGCAACTAC
ATGGTGCAGACTGAGGACCAGTACGTGTTCATCCACGAGGCGCTGCTGGAGGCCGCCATG
TGTGGACACACGGAGGTGCCCGCCCGCAACCTCTACGCCCACATCCAGAAGCTGGGCCAA
GTGCCTCCCGGGGAGAGTGTGACTGCCATGGAGCTGGAGTTCAAGTTGCTGGCCAACTCC
AAGGCCCACACATCCCGCTTCATCAGCGCCAACCTGCCCTGCAACAAGTTCAAGAACCGC
CTGGTGAACATCATGCCCTACGAACTGACCCGTGTGTGTCTGCAGCCCATCCGCGGCGTG
GAGGGCTCCGACTACATCAATGCCAGCTTCCTGGATGGCTATCGACAGCAGAAGGCCTAC
ATAGCCACACAGGGGCCTCTGGCGGAGAGCACCGAGGATTTCTGGCGCATGTTATGGGAG
CACAACTCCACCATCATCGTCATGCTGACCAGGCTTCGGGAGATGGGCCGGGAGAAATGC
CACCAGTACTGGCCTGCAGAGCGCTCTGCTCGCTACCAGTACTTTGTCGTCGACCCGATG
GCTGAGTACAACATGCCCCAGTATATTCTCCGTGAGTTCAAGGTCACGGATGCCCGGGAT
GGGCAGTCGAGGACAATCCGGCAGTTCCAGTTCACAGACTGGCCGGAGCAGGGCGTGCCT
AAAACGGGCGAGGGCTTCATCGACTTCATCGGGCAGGTGCACAAGACCAAGGAGCAGTTC
GGGCAGGACGGGCCCATCACGGTGCACTGCAGTGCTGGTGTGGGCCGCACTGGGGTGTTC
ATCACGCTGAGCATTGTCCTGGAGCGGATGCGCTACGAAGGCGTGGTTGACATGTTCCAG
ACCGTGAAGACCCTGCGCACACAGCGCCCAGCCATGGTGCAGACGGAGGACCAGTATCAG
CTGTGCTACCGCGCGGCCCTGGAGTACCTCGGAAGCTTTGACCACTATGCAACGTAA
Enzyme 22 GenBank Gene ID BC151592 Link Image
Enzyme 22 GeneCard ID PTPRF Link Image
Enzyme 22 GenAtlas ID Not Available
Enzyme 22 HGNC ID Not Available
Enzyme 22 Chromosome Location Chromosome:1
Enzyme 22 Locus 1p34
Enzyme 22 SNPs SNPJam Report Link Image
Enzyme 22 General References Not Available
Enzyme 22 Metabolite References Not Available
Enzyme 23 [top]
Enzyme 23 ID 1236
Enzyme 23 Name Low molecular weight phosphotyrosine protein phosphatase
Enzyme 23 Synonyms
  1. LMW-PTPase
  2. LMW-PTP
  3. Low molecular weight cytosolic acid phosphatase
Enzyme 23 Gene Name ACP1
Enzyme 23 Protein Sequence >Low molecular weight phosphotyrosine protein phosphatase
MAEQVTKSVLFVCLGNICRSPIAEAVFRKLVTDQNISDNWVIDSGAVSDWNVGRSPDPRA
VSCLRNHGINTAHKARQVTKEDFVTFDYILCMDESNLRDLNRKSNQVKNCRAKIELLGSY
DPQKQLIIEDPYYGNDADFETVYQQCVRCCRAFLEKVR
Enzyme 23 Number of Residues 158
Enzyme 23 Molecular Weight 18054.3
Enzyme 23 Theoretical pI 7.15
Enzyme 23 GO Classification
Function
Process
Component
Enzyme 23 General Function Signal transduction mechanisms
Enzyme 23 Specific Function Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates
Enzyme 23 Pathways Not Available
Enzyme 23 Reactions Not Available
Enzyme 23 Pfam Domain Function
Enzyme 23 Signals
  • None
Enzyme 23 Transmembrane Regions
  • None
Enzyme 23 Essentiality Not Available
Enzyme 23 GenBank ID Protein 163596 Link Image
Enzyme 23 UniProtKB/Swiss-Prot ID P11064 Link Image
Enzyme 23 UniProtKB/Swiss-Prot Entry Name PPAC_BOVIN Link Image
Enzyme 23 PDB ID 1DG9 Link Image
Enzyme 23 PDB File Show
Enzyme 23 3D Structure
Enzyme 23 Cellular Location Not Available
Enzyme 23 Gene Sequence >477 bp
ATGGCTGAGCAGGTGACCAAGTCGGTGCTGTTCGTGTGTCTGGGTAACATCTGTCGATCG
CCCATCGCAGAAGCGGTTTTCAGGAAACTTGTAACTGATCAAAACATTTCAGATAATTGG
GTCATTGACAGTGGCGCTGTTTCTGACTGGAACGTGGGCCGGTCACCAGATCCAAGAGCT
GTGAGCTGCCTAAGAAATCATGGCATTAACACAGCCCATAAAGCAAGACAGGTTACCAAA
GAAGACTTTGTCACTTTTGATTATATACTATGTATGGATGAGAGCAATCTGAGAGATTTG
AATAGAAAAAGTAATCAAGTTAAAAACTGCAGAGCGAAAATCGAACTGCTCGGGAGCTAT
GATCCACAAAAACAACTTATCATTGAAGATCCCTATTATGGCAACGACGCCGACTTTGAG
ACCGTCTACCAGCAGTGCGTGCGGTGCTGCAGGGCCTTCCTGGAGAAGGTGCGCTGA
Enzyme 23 GenBank Gene ID M83656 Link Image
Enzyme 23 GeneCard ID ACP1 Link Image
Enzyme 23 GenAtlas ID Not Available
Enzyme 23 HGNC ID Not Available
Enzyme 23 Chromosome Location Chromosome:2
Enzyme 23 Locus 2p25
Enzyme 23 SNPs SNPJam Report Link Image
Enzyme 23 General References
  1. [PubMed Link Image]
Enzyme 23 Metabolite References Not Available
Enzyme 24 [top]
Enzyme 24 ID 1237
Enzyme 24 Name Myotubularin
Enzyme 24 Synonyms Not Available
Enzyme 24 Gene Name MTM1
Enzyme 24 Protein Sequence >Myotubularin
MASAPTSKYNSHSLENESIKRTSRDGVNRDVGETLPRLPGEIRITDKEVIYICPFNGPIK
GRVYITNYRLYLRSLETDSALILDVPLGVISRIEKMGGATSRGENSYGLDITCKDLRNLR
FALKQEGHSRRDMFEILTRYAFPLAHSLPIFAFLNEEKFNVDGWTVYNPVEEYRRQGLPN
HHWRITFINKCYKLCDTYPALLVVPYRASDEDLRRVATFRSRNRIPVLSWIHPENKTVIV
RCSQPLVGMSGKRNKEDERYLDVIRETNRQVNKLTIYDARPNVNAVANKATGGGYESDDV
YHNAELFFLDIHNIHVMRESLKKVKDIVYPNVEESHWLSSLESTHWLEHIKLVLTGAIQV
ADRVSSGKSSVVVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEILVQKEWISFGHKFAS
RIGHGDKNHADADRSPIFLQFIDCVWQMSKQFPTAFEFNERFLITILDHLYSCRFGTFLY
NCESAREKQKVTERTVSLWSLINSNKDKFKNPFYTKEINRVLYPVASMRHLELWVNYYIR
WNPRIKQQQPNPVEQRYMELLALRDEYIKRLDELQLANSAKLSDPSASPSSPSQMMPHVQ
THF
Enzyme 24 Number of Residues 603
Enzyme 24 Molecular Weight 70019.2
Enzyme 24 Theoretical pI 8.79
Enzyme 24 GO Classification
Function
Process
Component
Enzyme 24 General Function Involved in protein tyrosine phosphatase activity
Enzyme 24 Specific Function Dual-specificity phosphatase that acts on both phosphotyrosine and phosphoserine
Enzyme 24 Pathways Not Available
Enzyme 24 Reactions Not Available
Enzyme 24 Pfam Domain Function
Enzyme 24 Signals
  • None
Enzyme 24 Transmembrane Regions
  • None
Enzyme 24 Essentiality Not Available
Enzyme 24 GenBank ID Protein 151553963 Link Image
Enzyme 24 UniProtKB/Swiss-Prot ID A6QLT4 Link Image
Enzyme 24 UniProtKB/Swiss-Prot Entry Name MTM1_BOVIN Link Image
Enzyme 24 PDB ID Not Available
Enzyme 24 Cellular Location Not Available
Enzyme 24 Gene Sequence Not Available
Enzyme 24 GenBank Gene ID BC148078 Link Image
Enzyme 24 GeneCard ID MTM1 Link Image
Enzyme 24 GenAtlas ID Not Available
Enzyme 24 HGNC ID Not Available
Enzyme 24 Chromosome Location Not Available
Enzyme 24 Locus Xq28
Enzyme 24 SNPs SNPJam Report Link Image
Enzyme 24 General References Not Available
Enzyme 24 Metabolite References Not Available
Enzyme 25 [top]
Enzyme 25 ID 1238
Enzyme 25 Name Phosphatidylinositol 3-kinase regulatory subunit gamma
Enzyme 25 Synonyms
  1. PI3-kinase p85 subunit gamma
  2. PtdIns-3-kinase p85-gamma
  3. p55PIK
Enzyme 25 Gene Name PIK3R3
Enzyme 25 Protein Sequence >Phosphatidylinositol 3-kinase regulatory subunit gamma
MYNTVWSIDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAITNGIKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELISHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRKEGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIRLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYGSLKELVLHYQRTSLVQHNDSLNVRLAYPVHAQMPTLCR
Enzyme 25 Number of Residues 461
Enzyme 25 Molecular Weight 54388.0
Enzyme 25 Theoretical pI 6.25
Enzyme 25 GO Classification
Function
Process
Component
Enzyme 25 General Function Replication, recombination and repair
Enzyme 25 Specific Function Binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1
Enzyme 25 Pathways Not Available
Enzyme 25 Reactions Not Available
Enzyme 25 Pfam Domain Function
Enzyme 25 Signals
  • None
Enzyme 25 Transmembrane Regions
  • None
Enzyme 25 Essentiality Not Available
Enzyme 25 GenBank ID Protein 2674191 Link Image
Enzyme 25 UniProtKB/Swiss-Prot ID O46404 Link Image
Enzyme 25 UniProtKB/Swiss-Prot Entry Name P55G_BOVIN Link Image
Enzyme 25 PDB ID 1FU6 Link Image
Enzyme 25 PDB File Show
Enzyme 25 3D Structure
Enzyme 25 Cellular Location Not Available
Enzyme 25 Gene Sequence Not Available
Enzyme 25 GenBank Gene ID AF036256 Link Image
Enzyme 25 GeneCard ID PIK3R3 Link Image
Enzyme 25 GenAtlas ID Not Available
Enzyme 25 HGNC ID Not Available
Enzyme 25 Chromosome Location Chromosome:1
Enzyme 25 Locus 1p34.1
Enzyme 25 SNPs SNPJam Report Link Image
Enzyme 25 General References Not Available
Enzyme 25 Metabolite References Not Available
Enzyme 26 [top]
Enzyme 26 ID 1239
Enzyme 26 Name M-phase inducer phosphatase 3
Enzyme 26 Synonyms
  1. Dual specificity phosphatase Cdc25C
Enzyme 26 Gene Name CDC25C
Enzyme 26 Protein Sequence >M-phase inducer phosphatase 3
MSAEFFSSKREEGSLASGPSFRSNQRKILNLLLERDASFSISSDLPTTPVEKKLFGDSAN
LSILSGGTPKRCLDLSNLSSGEMSATQLTASADLDETGHLESTGPEQVRLAGMNYRQHLI
KCSPAQLFCSTPNALEHGRRKKDAICGSSANKENDNGNLVENEMKHLGSPITTVSKLHKN
PELAEDQAEEISDELMEFSLEDQEKAKPPLNWSSLYRSSSLPDSLNSPSLKQVVKFKDST
IPDKLKKKYCSNQKELGKGLGLKKMVSLCDINMTQMLEEDSNQGPLIGDFSKVCALPTVS
GKHQDLKYVNPETVAALLSGEFQGLIEKFYIIDCRYPYEYLGGHIQGALNLHSQEELYNF
FLKKPIVPWDNQKRIVIVFHCEFSSERGPRMCRSLREEDRTLNQYPALYYPELYILKGGY
RDFFPEYMELCEPQSYCPMHHQDHKAELLRCRNQSKAWEGERQLQEQIALLVKDVSP
Enzyme 26 Number of Residues 477
Enzyme 26 Molecular Weight 53793.4
Enzyme 26 Theoretical pI 6.11
Enzyme 26 GO Classification
Function
Process
Component
Enzyme 26 General Function Involved in protein tyrosine phosphatase activity
Enzyme 26 Specific Function Functions as a dosage-dependent inducer in mitotic control. It is a tyrosine protein phosphatase required for progression of the cell cycle. It directly dephosphorylates CDC2 and activate its kinase activity
Enzyme 26 Pathways Not Available
Enzyme 26 Reactions Not Available
Enzyme 26 Pfam Domain Function
Enzyme 26 Signals
  • None
Enzyme 26 Transmembrane Regions
  • None
Enzyme 26 Essentiality Not Available
Enzyme 26 GenBank ID Protein 146186550 Link Image
Enzyme 26 UniProtKB/Swiss-Prot ID A5D7P0 Link Image
Enzyme 26 UniProtKB/Swiss-Prot Entry Name MPIP3_BOVIN Link Image
Enzyme 26 PDB ID Not Available
Enzyme 26 Cellular Location Not Available
Enzyme 26 Gene Sequence >1434 bp
ATGTCTGCAGAATTCTTCTCATCCAAAAGAGAGGAGGGAAGCCTTGCCTCAGGACCTAGT
TTTAGGTCCAATCAGAGGAAGATATTAAACCTGCTCCTTGAGAGAGATGCTTCCTTTTCC
ATCAGTTCAGATCTCCCTACAACTCCAGTGGAGAAGAAACTTTTTGGTGACTCTGCAAAC
CTAAGCATTTTGTCTGGAGGAACCCCAAAACGTTGCCTTGATCTTTCGAATCTTAGCAGC
GGGGAGATGTCTGCCACTCAGCTTACTGCTTCTGCAGACCTTGATGAAACTGGTCATTTG
GAGTCTACAGGACCTGAGCAAGTACGGTTAGCTGGAATGAATTACCGCCAACATCTTATA
AAATGTAGCCCAGCACAGCTGTTTTGTAGCACTCCGAATGCCTTGGAGCATGGCCGCAGG
AAGAAAGATGCAATATGTGGCTCATCTGCAAATAAGGAAAATGACAATGGAAACTTGGTG
GAAAATGAAATGAAACATCTGGGCAGTCCCATTACTACAGTTTCAAAATTACATAAAAAT
CCAGAGCTAGCAGAAGATCAGGCAGAAGAGATATCAGATGAATTGATGGAGTTTTCACTG
GAAGATCAAGAAAAGGCCAAGCCACCTCTGAACTGGAGCTCCCTGTATCGCTCCTCATCA
TTGCCAGACAGCTTAAACAGTCCAAGTTTGAAGCAGGTGGTAAAATTCAAGGACAGCACA
ATACCAGATAAACTAAAAAAGAAGTATTGTTCAAACCAAAAAGAGCTCGGAAAGGGCTTA
GGTCTAAAGAAAATGGTCTCCCTCTGTGACATCAATATGACTCAGATGCTGGAGGAAGAT
TCAAACCAGGGGCCTCTGATTGGTGATTTCTCCAAGGTATGTGCACTGCCAACCGTGTCA
GGGAAACACCAAGATCTGAAGTACGTCAACCCAGAAACAGTGGCTGCCTTACTATCAGGG
GAGTTCCAGGGTCTGATTGAGAAGTTTTATATCATCGATTGCCGCTATCCATATGAGTAC
CTGGGAGGACACATTCAGGGAGCATTAAACTTGCACAGTCAAGAAGAACTATATAACTTC
TTTCTGAAGAAACCCATTGTCCCTTGGGATAACCAGAAAAGAATAGTCATCGTGTTCCAT
TGTGAATTCTCCTCTGAGAGGGGTCCCCGAATGTGCCGTTCTCTGAGAGAAGAGGACAGG
ACTCTGAACCAGTATCCTGCCCTGTACTACCCAGAGCTATACATCCTCAAAGGGGGCTAC
AGAGACTTCTTTCCAGAATATATGGAGCTGTGTGAACCACAGAGCTACTGCCCGATGCAT
CACCAGGACCATAAGGCTGAGCTGCTGAGGTGTCGAAACCAGAGCAAAGCATGGGAAGGA
GAGCGGCAGCTGCAGGAACAGATTGCCTTACTGGTGAAGGATGTGAGCCCATGA
Enzyme 26 GenBank Gene ID BC140630 Link Image
Enzyme 26 GeneCard ID CDC25C Link Image
Enzyme 26 GenAtlas ID Not Available
Enzyme 26 HGNC ID Not Available
Enzyme 26 Chromosome Location Chromosome:5
Enzyme 26 Locus 5q31
Enzyme 26 SNPs SNPJam Report Link Image
Enzyme 26 General References Not Available
Enzyme 26 Metabolite References Not Available
Enzyme 27 [top]
Enzyme 27 ID 1355
Enzyme 27 Name Solute carrier family 22 member 1
Enzyme 27 Synonyms
  1. Organic cation transporter 1
Enzyme 27 Gene Name SLC22A1
Enzyme 27 Protein Sequence >Solute carrier family 22 member 1
MLTVDDVLEQVGEFGWFQKQTFLILCLLSAAFAPIYVGIVFLAFTPDHRCRSPGVAELSR
RCGWSLAEELNYTVPGPGPESQCLRYEVDWNQSTLGCLDPLASLATNGSPLPLGPCEQGW
VYDTPGSSIVTEFNLVCDDSWKVDLFQSCVNLGFFLGSLGVGYIADRFGRKVCLLATTLT
CASLGVLTAVAPDYTSLLIFRLLQGLVSKGSWTAGYTLITEFVGLGYRRTVAILYQMAFT
VGLVLLSGLAYILPHWRWLQLAVSLPIFLLLFRFWFVPESPRWLLSQKRNTEAIKIMDHI
AQKNGKLPPADLKMLSLEEDVTEKLSPSFIDLFRTPNLRKYTFILMYLWFTSSVVYQGLI
MHVGATGGNLYLDFLYSALVEFPAGFIILVTIDRFGRRYPLATSNLAAGLACFLMIFIPH
DLPWLNIMVACVGRMGITIVFQMVCLVNAELFPTFIRNLGMMVCSSLCDLGGVLTPFLVF
RLMEVWQGSPLILFAALGLVAGGMTLLLPETKGVTLPETIEDAENLQRKAKPKENKIYLQ
VQTSELNTQAAERDASQGTAQQK
Enzyme 27 Number of Residues 563
Enzyme 27 Molecular Weight 62501.6
Enzyme 27 Theoretical pI 5.77
Enzyme 27 GO Classification
Function
Process
Component
Enzyme 27 General Function Carbohydrate transport and metabolism
Enzyme 27 Specific Function Translocates a broad array of organic cations with various structures and molecular weights including the model compounds 1-methyl-4-phenylpyridinium (MPP), tetraethylammonium (TEA), N-1-methylnicotinamide (NMN), 4-(4-(dimethylamino)styryl)- N-methylpyridinium (ASP), the endogenous compounds choline, guanidine, histamine, epinephrine, adrenaline, noradrenaline and dopamine, and the drugs quinine, and metformin. The transport of organic cations is inhibited by a broad array of compounds like tetramethylammonium (TMA), cocaine, lidocaine, NMDA receptor antagonists, atropine, prazosin, cimetidine, TEA and NMN, guanidine, cimetidine, choline, procainamide, quinine, tetrabutylammonium, and tetrapentylammonium. Translocates organic cations in an electrogenic and pH-independent manner. Translocates organic cations across the plasma membrane in both directions. Transports the polyamines spermine and spermidine. Transports pramipexole across the basolateral membrane of the proximal tubular epithelial cells. The choline transport is activated by MMTS. Regulated by various intracellular signaling pathways including inhibition by protein kinase A activation, and endogenously activation by the calmodulin complex, the calmodulin- dependent kinase II and LCK tyrosine kinase
Enzyme 27 Pathways Not Available
Enzyme 27 Reactions Not Available
Enzyme 27 Pfam Domain Function
Enzyme 27 Signals
  • None
Enzyme 27 Transmembrane Regions
  • 22-42 145-165 172-192 197-219 233-253 258-278 343-363 372-392 399-418 424-446 460-480 488-508
Enzyme 27 Essentiality Not Available
Enzyme 27 GenBank ID Protein 154426216 Link Image
Enzyme 27 UniProtKB/Swiss-Prot ID A7MBE0 Link Image
Enzyme 27 UniProtKB/Swiss-Prot Entry Name S22A1_BOVIN Link Image
Enzyme 27 PDB ID Not Available
Enzyme 27 Cellular Location Not Available
Enzyme 27 Gene Sequence >1692 bp
ATGCTCACTGTAGATGATGTACTGGAGCAGGTTGGGGAGTTCGGTTGGTTCCAGAAGCAA
ACCTTCCTGATCCTGTGCCTGCTCTCGGCCGCCTTCGCCCCCATCTACGTGGGCATCGTC
TTCCTGGCCTTCACCCCGGACCACCGCTGCCGGAGCCCCGGGGTGGCGGAGCTGAGCCGG
CGATGCGGCTGGAGCCTGGCGGAGGAGCTCAACTACACGGTGCCAGGCCCGGGACCCGAG
AGCCAGTGCCTCCGCTACGAGGTGGACTGGAACCAGAGCACCCTTGGCTGCCTGGACCCG
CTGGCCAGCCTGGCTACCAACGGCAGCCCCCTGCCCCTGGGCCCCTGCGAGCAGGGCTGG
GTGTACGACACGCCCGGCTCCTCCATCGTGACCGAGTTTAACCTGGTGTGTGATGACTCT
TGGAAGGTGGACCTCTTTCAGTCCTGTGTGAACTTGGGCTTCTTCCTGGGCTCTCTGGGA
GTCGGCTACATCGCAGACAGGTTTGGCCGCAAGGTGTGCCTCTTGGCTACCACCCTCACC
TGCGCCAGCTTGGGCGTCCTGACGGCCGTGGCTCCGGACTACACGTCCCTGCTGATCTTC
CGCCTGCTGCAGGGGCTGGTCAGCAAGGGCAGCTGGACGGCTGGCTACACCCTGATCACG
GAGTTCGTGGGCCTGGGCTACAGACGGACAGTGGCGATCCTCTACCAGATGGCCTTCACC
GTGGGGCTGGTGCTGCTCTCCGGACTGGCCTACATCCTCCCGCACTGGCGCTGGCTGCAG
CTGGCCGTCTCCCTGCCCATCTTCCTGCTCCTCTTCCGCTTCTGGTTTGTGCCCGAGTCC
CCCCGATGGCTGTTATCGCAAAAGAGAAACACTGAGGCGATAAAGATCATGGACCACATT
GCGCAAAAGAACGGGAAGCTGCCTCCTGCTGACCTGAAGATGCTGTCTCTCGAGGAGGAC
GTCACTGAGAAGCTGAGCCCCTCATTCATAGACCTGTTCCGCACGCCCAACCTGAGGAAG
TACACCTTCATCCTGATGTACCTGTGGTTCACCAGCTCCGTGGTCTACCAGGGCCTCATC
ATGCACGTGGGCGCCACCGGCGGGAACCTCTACCTGGACTTCCTCTACTCCGCTCTGGTC
GAGTTCCCCGCAGGCTTCATCATCCTCGTCACCATCGACCGCTTCGGCCGCCGCTACCCG
CTGGCCACGTCCAACTTGGCGGCCGGGCTGGCCTGCTTCCTCATGATCTTTATCCCACAC
GATCTGCCCTGGTTGAATATCATGGTAGCTTGTGTTGGCAGAATGGGGATCACCATCGTG
TTCCAGATGGTGTGCCTGGTCAACGCCGAGCTGTTCCCGACCTTCATCCGGAACCTTGGC
ATGATGGTGTGTTCCTCCCTGTGTGATTTGGGTGGGGTTCTCACCCCGTTCCTGGTCTTC
AGGCTGATGGAGGTTTGGCAAGGCTCGCCGCTCATTTTGTTTGCGGCCTTGGGGCTGGTT
GCCGGGGGAATGACGCTGCTTCTTCCGGAGACCAAGGGGGTCACTTTGCCAGAGACCATC
GAGGATGCCGAGAACCTGCAGAGGAAAGCAAAACCCAAAGAAAACAAGATTTACCTTCAG
GTTCAAACATCAGAACTCAACACACAGGCAGCCGAGAGAGATGCTTCGCAGGGGACCGCG
CAGCAGAAGTGA
Enzyme 27 GenBank Gene ID BC151505 Link Image
Enzyme 27 GeneCard ID SLC22A1 Link Image
Enzyme 27 GenAtlas ID Not Available
Enzyme 27 HGNC ID Not Available
Enzyme 27 Chromosome Location Chromosome:6
Enzyme 27 Locus 6q26
Enzyme 27 SNPs SNPJam Report Link Image
Enzyme 27 General References Not Available
Enzyme 27 Metabolite References Not Available
Enzyme 28 [top]
Enzyme 28 ID 2586
Enzyme 28 Name Contactin-1
Enzyme 28 Synonyms
  1. Neural cell surface protein F3
Enzyme 28 Gene Name CNTN1
Enzyme 28 Protein Sequence >Contactin-1
MKMWLLFSLLVIISFKTCLSEFTWHRRYGHGVSEEDKGFGPIFEEQPINTIYPEESPEGK
VSLNCRARASPFPVYKWRMNNGDIDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNY
GMVRSTEATLSFGYLDPFPPEERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVF
ITMDKRRFVSQTNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPLPERTTKPY
PADIVVQFKDVYALMGQNVTLECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNI
QLEDEGIYECEAENNRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCVATGKPIP
TIRWLKNGYSYHRGELRLYDVTFENAGMYQCIAENTHGAIYANAELKILALAPTFEMNPM
KKKILAAKGGRVIIECKPKAAPKPTFLWSKGTERLVNSSRILIWEDGSLEINNITRSDGG
VYTCFVENNKGKANSTGTLVITDPTRIILAPINADITVGENATMQCAASFDPALDLTFVW
SFNGYVIDFNKENIHYQRNFMLDSNGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVV
RGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKTDPPIIE
GNMEAARAVDLIPWMEYEFRVVATNTLGIGEPSIPSNKIKTDGAAPNVAPSDVGGGGGSN
RELTITWAPLSREYHYFNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHKDETMRPSTAF
QVKVKAFNNKGDGPYSLTAVIHSAQDAPSEAPTAVGVKVLSSSEISVHWEHVVEKIVESY
QIRYWASHDKEAAAHRVQVASQEYSARLENLLPDTQYFVEVRACNSAGCGPPSDMTETFT
KKAPPSQPPRIISSVRSGSRYIITWDHVVALSNESTVTGYKVLYRPDGQHDGKLYSTHKH
SIEVPIPRDGEYVVEVRAHSDGGDGVVSQVKISGASILSPCLLGFLLPALGILVYLEF
Enzyme 28 Number of Residues 1018
Enzyme 28 Molecular Weight 113383.6
Enzyme 28 Theoretical pI 6.15
Enzyme 28 GO Classification
Function
Process
Component
Enzyme 28 General Function Involved in protein binding
Enzyme 28 Specific Function Contactins mediate cell surface interactions during nervous system development. Involved in the formation of paranodal axo-glial junctions in myelinated peripheral nerves and in the signaling between axons and myelinating glial cells via its association with CNTNAP1. Participates in oligodendrocytes generation by acting as a ligand of NOTCH1. Its association with NOTCH1 promotes NOTCH1 activation through the released notch intracellular domain (NICD) and subsequent translocation to the nucleus. Interaction with TNR induces a repulsion of neurons and an inhibition of neurite outgrowth
Enzyme 28 Pathways Not Available
Enzyme 28 Reactions Not Available
Enzyme 28 Pfam Domain Function
Enzyme 28 Signals
  • 1-20
Enzyme 28 Transmembrane Regions
  • None
Enzyme 28 Essentiality Not Available
Enzyme 28 GenBank ID Protein 1060861 Link Image
Enzyme 28 UniProtKB/Swiss-Prot ID Q28106 Link Image
Enzyme 28 UniProtKB/Swiss-Prot Entry Name CNTN1_BOVIN Link Image
Enzyme 28 PDB ID Not Available
Enzyme 28 Cellular Location Not Available
Enzyme 28 Gene Sequence >3057 bp
ATGAAAATGTGGTTACTGTTCAGTCTCCTTGTAATAATATCTTTTAAAACTTGTCTATCA
GAGTTTACATGGCACAGAAGGTATGGTCATGGAGTTTCTGAGGAAGACAAAGGATTTGGA
CCAATTTTTGAAGAACAACCAATCAATACCATTTATCCAGAGGAGTCACCGGAAGGAAAA
GTTTCACTAAACTGTAGGGCACGAGCCAGCCCTTTCCCAGTTTACAAATGGAGAATGAAT
AATGGGGATATTGATCTGACAAGTGATCGGTACAGTATGGTAGGAGGAAACCTTGTTATC
AACAATCCGGACAAACAGAAAGATGCTGGAATATATTACTGTTTAGCATCAAATAACTAT
GGGATGGTCAGAAGCACTGAAGCAACCCTGAGTTTTGGATATCTTGATCCTTTCCCACCT
GAGGAACGTCCTGAGGTCAGAGTGAAAGAAGGGAAGGGAATGGTGCTACTCTGTGACCCT
CCATACCATTTCCCAGATGATCTTAGCTACCGCTGGCTTCTAAATGAATTTCCTGTATTT
ATCACAATGGATAAACGAAGATTTGTGTCTCAGACAAATGGCAATCTCTACATTGCTAAT
GTTGAGGCATCTGACAAAGGCAACTATTCTTGCTTTGTATCCAGTCCCTCTATTACAAAG
AGTGTGTTCAGCAAATTTATCCCACTCATTCCACTACCTGAACGAACAACAAAACCATAT
CCTGCTGATATTGTAGTTCAGTTCAAGGATGTATATGCATTGATGGGCCAAAACGTGACT
TTAGAGTGTTTTGCACTTGGCAATCCTGTTCCTGATATCCGATGGCGAAAAGTCCTAGAA
CCAATGCCAAGCACAGCTGAGATCAGCACCTCTGGAGCTGTCCTCAAGATCTTCAATATT
CAGCTAGAAGATGAAGGCATATATGAATGCGAGGCTGAGAACAATAGAGGAAAGGATAAA
CACCAGGCAAGAATTTATGTTCAAGCATTTCCTGAGTGGGTGGAACACATCAATGACACA
GAAGTGGATATAGGCAGTGATCTCTACTGGCCTTGTGTGGCCACGGGGAAGCCCATTCCT
ACCATCCGATGGCTGAAGAATGGATATTCGTACCATAGAGGGGAACTGAGGCTGTATGAC
GTGACCTTTGAAAACGCTGGCATGTACCAGTGCATAGCTGAAAACACACATGGAGCAATT
TACGCAAATGCCGAGTTGAAGATCCTGGCTTTGGCTCCAACTTTTGAAATGAATCCTATG
AAGAAAAAGATCCTGGCTGCTAAAGGAGGACGGGTTATAATTGAATGCAAACCCAAAGCT
GCACCCAAACCAACATTTTTATGGAGTAAAGGCACAGAGCGGCTTGTCAATAGCAGCAGA
ATACTCATTTGGGAAGATGGTAGCTTAGAAATCAATAACATTACAAGGAGTGATGGAGGT
GTCTATACATGCTTTGTGGAAAATAATAAAGGGAAGGCTAATAGCACTGGGACTCTTGTT
ATCACAGATCCCACACGAATTATCTTGGCCCCGATTAACGCTGATATCACTGTTGGAGAA
AATGCCACCATGCAGTGTGCCGCTTCCTTTGATCCTGCCCTGGATCTGACATTTGTTTGG
TCCTTCAATGGTTATGTGATCGACTTTAACAAAGAGAACATTCATTACCAGCGGAATTTT
ATGCTGGATTCCAATGGGGAGCTGCTCATCCGAAATGCCCAGTTGAAACACGCTGGGAGG
TACACGTGCACAGCTCAGACAATTGTAGACAATTCTTCAGCCTCTGCTGACCTTGTTGTG
CGAGGCCCTCCAGGCCCTCCAGGTGGTCTGCGAATAGAAGACATTAGAGCCACTTCGGTG
GCACTTACTTGGAGCCGTGGTTCAGACAATCATAGTCCTATATCTAAGTACACTATCCAG
ACGAAGACTATTCTTTCGGATGATTGGAAAGATGCGAAGACAGATCCCCCAATTATTGAA
GGAAACATGGAGGCAGCGAGAGCAGTGGATTTAATCCCATGGATGGAATATGAATTTCGT
GTGGTAGCAACCAATACATTGGGTATAGGAGAGCCCAGTATACCATCAAACAAAATTAAA
ACAGATGGCGCTGCACCTAATGTGGCTCCTTCAGATGTAGGAGGTGGAGGTGGAAGCAAC
AGAGAACTGACCATAACATGGGCGCCTTTGTCAAGAGAATACCATTACTTCAACAATTTT
GGTTACATAGTGGCATTTAAGCCATTTGATGGGGAAGAATGGAAAAAAGTGACAGTTACT
AATCCAGATACTGGCCGCTATGTCCATAAAGACGAGACCATGCGCCCTTCCACTGCATTT
CAAGTCAAAGTCAAAGCTTTCAACAACAAAGGAGACGGACCCTACAGTCTCACAGCTGTC
ATCCACTCCGCACAAGACGCTCCCAGTGAAGCCCCAACAGCAGTAGGAGTAAAAGTCTTA
TCATCTTCTGAGATATCTGTTCATTGGGAGCATGTTGTAGAAAAAATAGTAGAAAGCTAT
CAGATTCGGTACTGGGCTTCCCATGACAAAGAAGCAGCTGCACACAGAGTTCAAGTTGCT
AGCCAAGAATACTCGGCCAGGCTGGAGAACCTTCTGCCTGACACCCAGTATTTTGTGGAA
GTCAGGGCGTGCAATAGTGCAGGGTGTGGACCTCCCAGTGATATGACTGAGACCTTCACC
AAGAAAGCACCTCCAAGCCAGCCTCCGCGGATCATCAGTTCCGTAAGGTCTGGTTCACGC
TACATAATCACCTGGGATCATGTGGTTGCACTGTCAAATGAATCTACAGTGACGGGATAT
AAGGTACTCTATAGACCTGATGGCCAGCATGATGGCAAGCTGTATTCAACTCATAAACAC
TCCATAGAAGTCCCAATCCCCAGGGATGGAGAATATGTTGTAGAGGTTCGTGCACACAGT
GATGGAGGAGATGGAGTGGTGTCTCAAGTCAAAATTTCAGGTGCATCCATCCTATCACCA
TGTCTTCTCGGCTTCCTGCTGCCTGCCCTTGGCATCCTTGTCTACTTGGAATTCTGA
Enzyme 28 GenBank Gene ID D32135 Link Image
Enzyme 28 GeneCard ID CNTN1 Link Image
Enzyme 28 GenAtlas ID Not Available
Enzyme 28 HGNC ID Not Available
Enzyme 28 Chromosome Location Chromosome:1
Enzyme 28 Locus 12q11-q12
Enzyme 28 SNPs SNPJam Report Link Image
Enzyme 28 General References
  1. [PubMed Link Image]
Enzyme 28 Metabolite References Not Available
Enzyme 29 [top]
Enzyme 29 ID 2587
Enzyme 29 Name GDNF family receptor alpha-2
Enzyme 29 Synonyms
  1. GFR-alpha-2
Enzyme 29 Gene Name GFRA2
Enzyme 29 Protein Sequence >GDNF family receptor alpha-2
MILANAFCLFFFLDETLRSLASPSSPQGPELHGWRPPVDCVRANELCAAESNCSSRYRTL
RQCLAGRDRNTMLANKECQAALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGE
EFYEASPYEPVTARLSDIFRLASIFSGTGADPAVSTKSNHCLDAAKACNLNDNCKKLRSS
YISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPS
CSYEDKEKPNCLDLRSLCRTDHLCRSRLADFHANCRASYQTLTSCPTDNYQACLGSYAGM
IGFDITPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLKDFTENPCLRNAIQAFGNGTD
VNLSPKSPPFQATQAPRVDKTPSLPDDLSDSTSLGTSVISTCTSVQDQGLKANNSKELSM
CFTELTTNIIPGSKRVIKPNSGPRRTRPSAALTAASFLMLKLAL
Enzyme 29 Number of Residues 464
Enzyme 29 Molecular Weight 51658.0
Enzyme 29 Theoretical pI 7.88
Enzyme 29 GO Classification
Function
Process
Component
Enzyme 29 General Function Involved in receptor activity
Enzyme 29 Specific Function Receptor for neurturin. Mediates the NRTN-induced autophosphorylation and activation of the RET receptor. Also able to mediate GDNF signaling through the RET tyrosine kinase receptor
Enzyme 29 Pathways Not Available
Enzyme 29 Reactions Not Available
Enzyme 29 Pfam Domain Function
Enzyme 29 Signals
  • 1-21
Enzyme 29 Transmembrane Regions
  • None
Enzyme 29 Essentiality Not Available
Enzyme 29 GenBank ID Protein 59857965 Link Image
Enzyme 29 UniProtKB/Swiss-Prot ID Q5E9X0 Link Image
Enzyme 29 UniProtKB/Swiss-Prot Entry Name GFRA2_BOVIN Link Image
Enzyme 29 PDB ID Not Available
Enzyme 29 Cellular Location Not Available
Enzyme 29 Gene Sequence >1395 bp
ATGATCTTGGCAAACGCCTTCTGCCTCTTCTTCTTTTTAGACGAGACCCTCCGCTCTTTG
GCCAGCCCTTCCTCCCCGCAGGGCCCCGAGCTCCACGGCTGGCGCCCCCCAGTGGACTGT
GTCCGGGCCAATGAGCTGTGCGCGGCCGAATCCAACTGCAGCTCCCGCTACCGCACGCTG
CGCCAGTGCCTGGCCGGCCGGGACCGCAACACTATGCTGGCCAACAAGGAGTGCCAGGCA
GCCCTGGAGGTGCTGCAGGAGAGCCCGCTCTACGACTGCCGCTGCAAGCGGGGCATGAAG
AAGGAGCTGCAGTGCTTGCAGATCTACTGGAGCATCCACCTGGGGCTGACCGAGGGCGAG
GAGTTTTATGAAGCCTCACCTTATGAGCCAGTGACCGCCCGCCTCTCGGACATCTTCAGG
CTTGCTTCAATCTTCTCAGGGACAGGGGCAGACCCGGCGGTCAGCACCAAGAGCAACCAC
TGCCTGGATGCCGCCAAGGCCTGTAACCTGAACGATAACTGCAAGAAGCTGCGCTCCTCC
TACATCTCCATCTGCAACCGTGAGATCTCGCCCACGGAGCGCTGCAATCGCCGCAAGTGC
CACAAGGCCCTGCGCCAGTTCTTTGACCGCGTACCCAGCGAGTACACCTACCGCATGCTC
TTCTGCTCCTGTCAGGACCAGGCGTGCGCCGAGCGCCGCCGCCAGACCATCCTGCCCAGC
TGCTCCTACGAGGACAAGGAGAAGCCCAACTGCCTGGACCTCCGCAGCCTGTGCCGGACA
GACCACCTGTGCAGGTCCCGCCTGGCGGACTTCCATGCCAACTGCCGTGCCTCCTACCAG
ACGCTCACCAGCTGCCCCACCGACAATTACCAAGCGTGTCTGGGCTCCTACGCTGGCATG
ATCGGGTTTGATATAACACCCAACTACGTGGACTCCAGCCCCACGGGCATCGTGGTGTCC
CCCTGGTGCAGCTGTCGTGGGAGTGGAAACATGGAGGAAGAGTGTGAGAAGTTTCTGAAG
GATTTCACAGAGAACCCATGCCTCCGGAATGCCATCCAGGCCTTTGGCAATGGTACAGAT
GTGAACCTGTCCCCTAAAAGCCCCCCATTCCAGGCCACACAGGCCCCTCGGGTAGACAAA
ACGCCTTCGTTGCCAGATGACCTCAGTGATAGCACCAGCCTGGGGACCAGTGTCATCAGT
ACCTGCACATCTGTCCAGGATCAGGGGCTGAAGGCCAATAACTCCAAAGAGTTAAGCATG
TGCTTCACAGAGCTCACAACCAATATCATCCCAGGGAGTAAAAGGGTGATCAAACCTAAC
TCAGGCCCCCGCAGAACCAGACCGTCGGCTGCCTTGACTGCTGCATCCTTCCTGATGCTG
AAGCTGGCCTTGTAG
Enzyme 29 GenBank Gene ID BT020800 Link Image
Enzyme 29 GeneCard ID GFRA2 Link Image
Enzyme 29 GenAtlas ID Not Available
Enzyme 29 HGNC ID Not Available
Enzyme 29 Chromosome Location Chromosome:8
Enzyme 29 Locus 8p21.3
Enzyme 29 SNPs SNPJam Report Link Image
Enzyme 29 General References
  1. [PubMed Link Image]
Enzyme 29 Metabolite References Not Available
Enzyme 30 [top]
Enzyme 30 ID 2588
Enzyme 30 Name Ephrin-A1
Enzyme 30 Synonyms Not Available
Enzyme 30 Gene Name EFNA1
Enzyme 30 Protein Sequence >Ephrin-A1
MEFFWASLLGLCCSLAAANRHTVFWNSSNPKFWNEDYTVHVRIDDYLDIICPHYEDNSVP
DAAMEQYTLYLVEHEQYQLCQPQPKDHARWFCKSPKAKHGPEKLSEKFHRFTGFTLSKDF
KEGHSYYYISKPIHHQEDRCLRLKVMIAGKITHSPQAHPNAQEKRLPADDPEVQVLHSIG
HSAAPRLFPLAWAVLLLPFLLLQIP
Enzyme 30 Number of Residues 205
Enzyme 30 Molecular Weight 23838.1
Enzyme 30 Theoretical pI 7.20
Enzyme 30 GO Classification
Function
Process
Component
Enzyme 30 General Function Not Available
Enzyme 30 Specific Function Not Available
Enzyme 30 Pathways Not Available
Enzyme 30 Reactions Not Available
Enzyme 30 Pfam Domain Function
Enzyme 30 Signals
  • 1-18
Enzyme 30 Transmembrane Regions
  • None
Enzyme 30 Essentiality Not Available
Enzyme 30 GenBank ID Protein 73587207 Link Image
Enzyme 30 UniProtKB/Swiss-Prot ID Q3ZC64 Link Image
Enzyme 30 UniProtKB/Swiss-Prot Entry Name EFNA1_BOVIN Link Image
Enzyme 30 PDB ID Not Available
Enzyme 30 Cellular Location Not Available
Enzyme 30 Gene Sequence >618 bp
ATGGAGTTCTTCTGGGCCTCTCTCTTGGGTCTGTGCTGCAGTCTGGCCGCTGCTAACCGC
CACACCGTCTTCTGGAACAGTTCAAACCCCAAGTTTTGGAATGAGGACTACACAGTACAT
GTGCGGATAGATGACTACCTGGACATCATCTGTCCTCATTACGAGGATAACTCTGTGCCA
GATGCGGCCATGGAGCAGTACACACTGTACCTGGTGGAGCACGAGCAGTACCAGCTGTGC
CAACCCCAACCCAAGGACCATGCCCGCTGGTTCTGCAAGAGTCCCAAAGCCAAGCATGGC
CCGGAGAAGCTGTCTGAGAAGTTCCACCGCTTCACAGGGTTTACCCTCAGCAAGGATTTC
AAAGAGGGACACAGCTACTACTACATCTCCAAGCCCATCCACCACCAGGAAGACCGTTGC
TTGAGGCTGAAGGTGATGATCGCTGGCAAAATCACTCACAGCCCTCAGGCTCATCCCAAT
GCACAAGAGAAGAGACTTCCAGCAGATGACCCGGAGGTGCAGGTTCTGCATAGCATCGGG
CACAGCGCCGCTCCTCGCCTCTTCCCACTAGCCTGGGCTGTGCTGCTCCTGCCATTCCTG
CTGCTGCAAATCCCGTGA
Enzyme 30 GenBank Gene ID BC102889 Link Image
Enzyme 30 GeneCard ID EFNA1 Link Image
Enzyme 30 GenAtlas ID Not Available
Enzyme 30 HGNC ID Not Available
Enzyme 30 Chromosome Location Chromosome:1
Enzyme 30 Locus 1q21-q22
Enzyme 30 SNPs SNPJam Report Link Image
Enzyme 30 General References Not Available
Enzyme 30 Metabolite References Not Available
Enzyme 31 [top]
Enzyme 31 ID 2589
Enzyme 31 Name Interferon-alpha/beta receptor alpha chain
Enzyme 31 Synonyms
  1. IFN-alpha-REC
Enzyme 31 Gene Name IFNAR1
Enzyme 31 Protein Sequence >Interferon-alpha/beta receptor alpha chain
MLALLGATTLMLVAGRWVLPAASGEANLKPENVEIHIIDDNFFLKWNSSSESVKNVTFSA
DYQILGTDNWKKLSGCQHITSTKCNFSSVELENVFEKIELRIRAEEGNNTSTWYEVEPFV
PFLEAQIGPPDVHLEAEDKAIILSISPPGTKDSIMWAMDRSSFRYSVVIWKNSSSLEERT
ETVYPEDKIYKLSPEITYCLKVKAELRLQSRVGCYSPVYCINTTERHKVPSPENIQINAD
NQIYVLKWDYPYENATFQAQWLRAFFKKIPGNHSDKWKQIPNCENVTSTHCVFPREVSSR
GIYYVRVRASNGNGTSFWSEEKEFNTEMKTIIFPPVISVKSVTDDSLHVSVGASEESENM
SVNQLYPLIYEVIFWENTSNAERKVLEKRTNFIFPDLKPLTVYCVKARALIENDRRNKGS
SFSDTVCEKTKPGNTSKTWLIVGTCTALFSIPVVIYVVSVFLRCVKYVFFPSSKPPSSVD
EYFSDQPLRNLLLSTSEEQTERCFIIENASIITEIEETDEIDEVHKKYSSQTSQDSGNYS
NEDENSGSKISEEFPQQDSV
Enzyme 31 Number of Residues 560
Enzyme 31 Molecular Weight 63818.3
Enzyme 31 Theoretical pI 4.82
Enzyme 31 GO Classification
Function
Process
Component
Enzyme 31 General Function Not Available
Enzyme 31 Specific Function Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta- subunits themselves
Enzyme 31 Pathways Not Available
Enzyme 31 Reactions Not Available
Enzyme 31 Pfam Domain Function Not Available
Enzyme 31 Signals
  • 1-24
Enzyme 31 Transmembrane Regions
  • 438-458
Enzyme 31 Essentiality Not Available
Enzyme 31 GenBank ID Protein 432 Link Image
Enzyme 31 UniProtKB/Swiss-Prot ID Q04790 Link Image
Enzyme 31 UniProtKB/Swiss-Prot Entry Name INAR1_BOVIN Link Image
Enzyme 31 PDB ID Not Available
Enzyme 31 Cellular Location Not Available
Enzyme 31 Gene Sequence >1683 bp
ATGCTCGCTCTCCTGGGCGCGACGACCCTGATGCTGGTCGCTGGGAGATGGGTGCTGCCC
GCCGCCTCAGGGGAAGCAAATCTGAAGCCTGAAAATGTCGAGATCCACATCATTGATGAC
AATTTTTTCCTGAAGTGGAACAGCAGCAGTGAGTCTGTCAAGAATGTGACTTTTTCAGCA
GATTATCAAATACTAGGAACGGATAACTGGAAGAAATTGTCTGGATGTCAACATATTACT
AGTACCAAATGCAACTTTTCTTCAGTCGAGCTTGAAAATGTTTTTGAAAAAATTGAATTG
CGCATAAGAGCAGAAGAAGGAAACAACACTTCCACATGGTATGAGGTTGAGCCATTTGTA
CCATTTCTAGAAGCTCAGATTGGTCCCCCAGATGTGCATTTAGAAGCTGAAGATAAGGCA
ATAATACTGAGTATCTCTCCCCCTGGAACAAAAGATAGTATCATGTGGGCTATGGATCGT
TCAAGCTTTAGGTATAGCGTCGTTATCTGGAAAAACTCTTCAAGTCTAGAAGAAAGAACG
GAAACTGTTTATCCCGAAGATAAAATTTATAAACTGTCACCAGAGATTACTTATTGTTTA
AAAGTTAAAGCAGAACTGCGTTTACAAAGTAGAGTTGGTTGCTATAGTCCAGTGTATTGT
ATAAATACCACAGAGAGACATAAAGTACCTTCACCAGAAAATATACAAATCAATGCTGAC
AACCAGATCTATGTTCTTAAGTGGGATTACCCATATGAAAACGCAACTTTTCAAGCTCAG
TGGCTCCGTGCCTTTTTTAAAAAGATTCCTGGGAATCATTCAGACAAATGGAAACAAATA
CCGAACTGTGAAAATGTCACAAGTACCCACTGTGTCTTTCCTCGAGAGGTTTCCTCAAGG
GGAATTTACTATGTCCGTGTACGAGCATCTAATGGAAATGGTACCTCTTTTTGGTCTGAA
GAGAAGGAATTTAATACTGAAATGAAAACTATCATATTTCCTCCAGTCATCAGCGTGAAA
TCCGTTACTGATGATTCACTGCATGTCAGTGTTGGTGCTTCAGAAGAGTCTGAAAACATG
TCTGTGAATCAGCTCTACCCGCTAATTTATGAAGTAATTTTTTGGGAAAACACTTCAAAT
GCTGAGAGAAAAGTTCTAGAGAAAAGAACCAATTTTATCTTTCCTGACTTGAAACCGCTG
ACTGTGTATTGTGTCAAAGCCAGAGCACTCATTGAAAATGACAGGCGGAATAAAGGGAGC
AGTTTTAGTGATACTGTGTGTGAGAAAACAAAACCAGGAAATACTTCCAAAACCTGGCTT
ATAGTTGGAACTTGCACTGCATTGTTTTCTATTCCTGTGGTCATTTATGTTGTGAGCGTC
TTCTTGAGATGTGTCAAGTATGTGTTCTTTCCATCAAGTAAACCTCCTTCCTCTGTTGAC
GAGTATTTCTCCGATCAGCCACTAAGGAATCTACTCCTTTCCACTTCTGAGGAACAAACG
GAAAGATGTTTTATAATTGAAAATGCAAGCATTATTACTGAAATAGAAGAGACTGATGAA
ATTGATGAAGTTCACAAAAAGTACAGTTCCCAAACTAGTCAAGATTCAGGAAACTATTCA
AACGAAGATGAAAACAGTGGAAGCAAAATAAGCGAAGAGTTTCCGCAACAGGACAGTGTG
TGA
Enzyme 31 GenBank Gene ID X68443 Link Image
Enzyme 31 GeneCard ID IFNAR1 Link Image
Enzyme 31 GenAtlas ID Not Available
Enzyme 31 HGNC ID Not Available
Enzyme 31 Chromosome Location Chromosome:2
Enzyme 31 Locus 21q22.1|21q22.11
Enzyme 31 SNPs SNPJam Report Link Image
Enzyme 31 General References
  1. [PubMed Link Image]
Enzyme 31 Metabolite References Not Available
Enzyme 32 [top]
Enzyme 32 ID 2590
Enzyme 32 Name B-cell antigen receptor complex-associated protein alpha chain
Enzyme 32 Synonyms
  1. Ig-alpha
  2. MB-1 membrane glycoprotein
  3. Surface IgM-associated protein
  4. Membrane-bound immunoglobulin-associated protein
  5. CD79a antigen
Enzyme 32 Gene Name CD79A
Enzyme 32 Protein Sequence >B-cell antigen receptor complex-associated protein alpha chain
MPEGPQALQSPPATIFLLLISAAGLGPGCQALWVEWGPPSVTVSVGEEVRLQCTHNGSNT
NVTWWHVLQSNSSWPPVMYRGDVGAGGELIIKPVNKTHRGMYRCQVSDGKKIQRSCGTYL
RVRDPLPRPFLDMGEGTKNNIITAEGIILLICAVVPGTLLLFRKRWQNMKFGADIQDDYE
DENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLHIGDAQLEKP
Enzyme 32 Number of Residues 223
Enzyme 32 Molecular Weight 24629.9
Enzyme 32 Theoretical pI 5.04
Enzyme 32 GO Classification
Function
Process
Component
Enzyme 32 General Function Involved in protein binding
Enzyme 32 Specific Function Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src- family tyrosine kinases. Represses BCR signaling during development of immature B cells
Enzyme 32 Pathways Not Available
Enzyme 32 Reactions Not Available
Enzyme 32 Pfam Domain Function
Enzyme 32 Signals
  • 1-31
Enzyme 32 Transmembrane Regions
  • 141-161
Enzyme 32 Essentiality Not Available
Enzyme 32 GenBank ID Protein 465393 Link Image
Enzyme 32 UniProtKB/Swiss-Prot ID P40293 Link Image
Enzyme 32 UniProtKB/Swiss-Prot Entry Name CD79A_BOVIN Link Image
Enzyme 32 PDB ID Not Available
Enzyme 32 Cellular Location Not Available
Enzyme 32 Gene Sequence >672 bp
ATGCCTGAGGGTCCCCAAGCCCTGCAAAGCCCGCCTGCCACCATCTTTCTCCTCCTGATC
TCCGCTGCTGGCCTGGGCCCCGGGTGCCAGGCCCTGTGGGTGGAGTGGGGCCCACCCTCG
GTGACGGTGAGCGTGGGGGAGGAGGTGCGCCTCCAGTGCACGCACAATGGCAGCAACACC
AACGTTACGTGGTGGCACGTCCTCCAAAGCAACTCCTCATGGCCCCCTGTGATGTATCGC
GGGGACGTGGGTGCCGGGGGCGAGCTGATCATCAAACCAGTGAACAAGACTCACAGGGGC
ATGTATAGGTGCCAAGTCAGTGATGGCAAGAAGATTCAGCGCTCCTGCGGGACGTACCTC
CGCGTGCGAGACCCGCTCCCTAGGCCCTTCCTGGACATGGGGGAGGGCACCAAGAACAAC
ATCATCACCGCCGAGGGCATCATCCTCCTCATCTGCGCCGTGGTGCCTGGAACACTGCTG
CTCTTCCGGAAACGATGGCAGAACATGAAATTCGGGGCTGATATCCAGGATGACTACGAA
GACGAAAATCTCTATGAGGGCCTGAACCTTGATGACTGCTCCATGTATGAGGACATCTCC
CGGGGCCTCCAGGGTACCTACCAGGACGTGGGCAGCCTCCACATCGGAGATGCTCAGCTG
GAGAAGCCGTGA
Enzyme 32 GenBank Gene ID D16412 Link Image
Enzyme 32 GeneCard ID CD79A Link Image
Enzyme 32 GenAtlas ID Not Available
Enzyme 32 HGNC ID Not Available
Enzyme 32 Chromosome Location Chromosome:1
Enzyme 32 Locus 19q13.2
Enzyme 32 SNPs SNPJam Report Link Image
Enzyme 32 General References
  1. [PubMed Link Image]
Enzyme 32 Metabolite References Not Available
Enzyme 33 [top]
Enzyme 33 ID 2591
Enzyme 33 Name Glucocorticoid modulatory element-binding protein 1
Enzyme 33 Synonyms
  1. GMEB-1
Enzyme 33 Gene Name GMEB1
Enzyme 33 Protein Sequence >Glucocorticoid modulatory element-binding protein 1
MANAEVSVPVGDVVVVPTEGNEGENPEDTKTQVILQLQPVQQGIYEAGSENNTAVVAVET
HTIHKIEEGIDASTIEANEDMEIAYPITCGESKAILLWKKFVCPGINVKCVKFNDQLISP
KHFVHLAGKSTLKDWKRAIRLGGIMLRKMMDSGQIDFYQHDKVCSNTCRSTKFDLLISSA
RAPVPGQQTSVVQTPTSADGSITQIAISEESMEEAGLEWNSALTAAVTMATEEGVKKDSE
EISQDTLMFWKGIADVGLMEEVVCNIQKEIEELLRGVQQRLIQAPFQVTDAAVLNNVAHT
FGLMDTVKKVLDNRKNQVEQGEEQFLYTLTDLERQLEEQKKQAQDHRLKSQTVQNVVLMP
VSTPKPPKRPRLQRPASTTVLSPSPPVHQPQFTVISPITITPVGQSFSMGNIPVATLSQG
SSPVTVHTLPSGPQLFRYATVVSSAKSSSPDTVTIHPSSSLALLSSTAMQDGSTLGNMTT
MVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEE
KVVAEMEEHQHQVHNVEIVVLED
Enzyme 33 Number of Residues 563
Enzyme 33 Molecular Weight 61321.1
Enzyme 33 Theoretical pI 4.49
Enzyme 33 GO Classification
Function
Process
Component
Enzyme 33 General Function Involved in zinc ion binding
Enzyme 33 Specific Function Trans-acting factor that binds to glucocorticoid modulatory elements (GME) present in the TAT (tyrosine aminotransferase) promoter and increases sensitivity to low concentrations of glucocorticoids. Binds also to the transferrin receptor promoter
Enzyme 33 Pathways Not Available
Enzyme 33 Reactions Not Available
Enzyme 33 Pfam Domain Function
Enzyme 33 Signals
  • None
Enzyme 33 Transmembrane Regions
  • None
Enzyme 33 Essentiality Not Available
Enzyme 33 GenBank ID Protein 87578301 Link Image
Enzyme 33 UniProtKB/Swiss-Prot ID Q2HJ87 Link Image
Enzyme 33 UniProtKB/Swiss-Prot Entry Name GMEB1_BOVIN Link Image
Enzyme 33 PDB ID 1OQJ Link Image
Enzyme 33 PDB File Show
Enzyme 33 3D Structure
Enzyme 33 Cellular Location Not Available
Enzyme 33 Gene Sequence >1692 bp
ATGGCTAATGCAGAAGTGAGTGTCCCAGTGGGAGATGTGGTTGTGGTACCCACTGAAGGA
AATGAAGGGGAGAACCCTGAAGACACTAAAACCCAAGTGATCTTGCAGTTACAGCCTGTG
CAACAAGGGATTTATGAAGCTGGATCTGAGAACAATACGGCAGTTGTGGCAGTAGAAACT
CACACAATACACAAAATTGAAGAAGGGATTGATGCAAGCACTATAGAAGCAAATGAGGAT
ATGGAAATTGCTTACCCCATAACTTGTGGGGAGAGCAAAGCCATTCTCCTTTGGAAGAAG
TTTGTATGTCCAGGAATAAATGTAAAGTGTGTCAAGTTCAATGATCAGTTGATCAGCCCC
AAGCATTTTGTTCATCTGGCTGGCAAATCCACCTTGAAGGACTGGAAGAGAGCTATTCGT
CTGGGTGGAATCATGCTCAGGAAAATGATGGACTCCGGACAGATTGATTTTTACCAACAT
GACAAGGTTTGCTCCAATACCTGCAGAAGCACCAAATTTGATCTTCTTATCAGCAGTGCG
AGAGCTCCAGTGCCAGGACAGCAGACAAGTGTGGTGCAGACGCCCACATCGGCCGATGGT
AGCATCACACAGATTGCCATCTCAGAAGAGAGCATGGAAGAGGCAGGGCTGGAATGGAAC
TCGGCTCTCACTGCTGCTGTCACCATGGCCACAGAGGAGGGCGTGAAGAAAGACTCAGAG
GAAATTTCACAGGACACTTTGATGTTCTGGAAAGGAATAGCTGATGTTGGACTGATGGAA
GAGGTTGTCTGCAATATACAGAAGGAAATAGAGGAGCTACTTAGGGGAGTTCAGCAGCGG
CTCATCCAGGCTCCCTTCCAGGTCACAGATGCTGCTGTTCTTAACAATGTAGCACATACA
TTTGGCCTAATGGACACAGTTAAGAAGGTTTTGGACAACAGGAAGAACCAAGTAGAACAG
GGAGAAGAGCAGTTTCTCTATACTCTCACAGACTTGGAACGCCAGTTGGAAGAACAGAAG
AAGCAAGCCCAGGATCACAGGCTGAAATCCCAGACAGTTCAAAATGTGGTACTGATGCCT
GTGAGCACTCCTAAGCCTCCCAAAAGGCCCCGGCTCCAGCGGCCAGCCTCCACCACCGTC
CTGAGCCCTTCTCCTCCTGTCCACCAGCCTCAGTTCACGGTCATCTCACCCATCACCATC
ACACCAGTGGGTCAGTCATTTTCCATGGGCAATATTCCAGTGGCCACCCTCAGCCAGGGC
TCCAGTCCTGTGACTGTCCACACACTGCCTTCTGGCCCTCAGCTCTTCCGTTATGCCACA
GTGGTCTCCTCAGCCAAGAGCAGCTCACCAGACACAGTGACCATCCACCCTTCGTCTAGC
TTGGCACTGCTGAGCTCCACCGCCATGCAGGATGGGAGTACCCTGGGCAACATGACCACC
ATGGTGAGCCCTGTGGAGCTGGTGGCCATGGAGTCTGGCCTAACCTCGGCCATCCAGGCA
GTTGAAAGCACCTCAGAGGATGGGCAGACCATCATTGAGATTGACCCAGCCCCAGACCCA
GAGGCCGAGGATACTGAGGGCAAAGCAGTCATTTTGGAGACCGAACTGAGGACTGAGGAG
AAAGTCGTGGCTGAGATGGAAGAACACCAGCATCAAGTCCACAATGTGGAGATTGTGGTC
TTAGAAGATTAA
Enzyme 33 GenBank Gene ID BC113252 Link Image
Enzyme 33 GeneCard ID GMEB1 Link Image
Enzyme 33 GenAtlas ID Not Available
Enzyme 33 HGNC ID Not Available
Enzyme 33 Chromosome Location Chromosome:1
Enzyme 33 Locus 1p35.3
Enzyme 33 SNPs SNPJam Report Link Image
Enzyme 33 General References Not Available
Enzyme 33 Metabolite References Not Available
Enzyme 34 [top]
Enzyme 34 ID 2592
Enzyme 34 Name Interferon-alpha/beta receptor beta chain
Enzyme 34 Synonyms
  1. Interferon alpha/beta receptor 2
  2. IFN-alpha-REC
  3. Type I interferon receptor
  4. IFN-R
Enzyme 34 Gene Name IFNAR2
Enzyme 34 Protein Sequence >Interferon-alpha/beta receptor beta chain
MLLSQNVSAIGPLNLYPMVHISLVFGISYVAPVLSDEHCTLKMRFRNFQSVLSWELKNHS
IVPTHYTLWYTIMSKREDMKVVKDCINVTRSFCDLTDVWVNTTDMYIPQVVGFRENAKLV
ICMGSFFLVPDKPLDPPEFEIVGFTNHISVNVKFQFDSPGILSEELQFYLAFIEEHAGNS
VKRHQPQITGNITKNFNYVIDKLIPNTNYCISVYFEPKDPRKINRSPLKCTLFRPRRESE
SSESATIGGIITLFLITAVFISTVMILKRIGYICLRNDFPKVLNFYKLSVWVFAELPPLE
KVATVEVIHVNRKKKVWNYNYDDENDIENEAAPHLISGGYTKHGLTGKLCPTSTTSPSLE
DCSLEDCSEPSAEEPYLPEPKGDAETPMAPGPGLWQSEGTSGGYQTRGTLWQDPTSEEDS
DSTEGSEGRIVFNVNLNSVCVRALEDDKDSEVTLMSPSCPEETVELEDLNETESSVLVAS
EEGTQLPFTNPSTECPRPQDAPSDKSDTSDPDVDMGDGYIVRQVNLKKFN
Enzyme 34 Number of Residues 530
Enzyme 34 Molecular Weight 59583.9
Enzyme 34 Theoretical pI 4.52
Enzyme 34 GO Classification
Function
Process
Component
Enzyme 34 General Function Not Available
Enzyme 34 Specific Function Receptor for interferons alpha and beta. Probably involved in signal transduction by interacting with the tyrosine kinase, JAK1
Enzyme 34 Pathways Not Available
Enzyme 34 Reactions Not Available
Enzyme 34 Pfam Domain Function
Enzyme 34 Signals
  • 1-26
Enzyme 34 Transmembrane Regions
  • 247-267
Enzyme 34 Essentiality Not Available
Enzyme 34 GenBank ID Protein 2612839 Link Image
Enzyme 34 UniProtKB/Swiss-Prot ID Q95141 Link Image
Enzyme 34 UniProtKB/Swiss-Prot Entry Name INAR2_BOVIN Link Image
Enzyme 34 PDB ID Not Available
Enzyme 34 Cellular Location Not Available
Enzyme 34 Gene Sequence >1593 bp
ATGCTTTTGAGCCAGAATGTGTCAGCGATTGGACCACTGAATTTGTATCCCATGGTGCAC
ATCAGCCTCGTGTTTGGTATTTCGTATGTTGCGCCTGTTCTTTCAGATGAACATTGCACT
TTAAAGATGAGATTCCGAAATTTCCAGTCAGTCTTATCATGGGAATTAAAAAACCATTCA
ATTGTACCAACTCACTATACATTATGGTACACAATCATGAGTAAACGAGAAGATATGAAG
GTCGTCAAGGACTGTATAAACGTCACAAGATCGTTTTGTGACCTCACAGACGTGTGGGTA
AACACGACGGACATGTACATCCCCCAGGTGGTTGGATTCAGAGAGAATGCAAAGCTGGTC
ATTTGTATGGGCTCTTTCTTCCTGGTGCCAGACAAGCCTTTGGACCCACCAGAGTTTGAG
ATTGTTGGTTTTACAAACCACATCAGTGTGAATGTGAAATTTCAATTCGACAGTCCCGGG
ATACTAAGTGAAGAATTACAGTTTTACTTAGCATTTATTGAAGAGCATGCAGGGAACAGT
GTTAAGAGGCATCAACCCCAAATAACTGGAAACATCACCAAAAATTTCAATTATGTCATC
GACAAGTTAATTCCAAACACAAACTACTGTATATCCGTTTATTTTGAGCCTAAAGATCCA
AGAAAAATAAACAGATCTCCCTTAAAATGTACCCTCTTTCGACCCAGACGAGAATCAGAG
TCATCAGAATCTGCTACAATAGGAGGAATAATTACTCTGTTTTTAATAACTGCTGTCTTC
ATAAGCACTGTAATGATACTGAAACGGATTGGCTATATATGCTTAAGAAATGATTTCCCC
AAAGTTTTGAATTTTTATAAACTGTCAGTCTGGGTGTTTGCCGAGCTGCCCCCGTTGGAA
AAAGTGGCTACCGTGGAAGTCATTCACGTCAACAGGAAGAAGAAAGTGTGGAATTATAAT
TATGACGATGAAAATGACATCGAAAATGAGGCAGCTCCCCACTTAATTTCAGGTGGTTAC
ACCAAGCATGGACTAACGGGCAAGCTGTGTCCAACTTCCACCACTTCACCCAGCTTGGAG
GACTGCAGCTTGGAGGACTGCAGTGAGCCCAGTGCTGAGGAGCCGTATCTGCCTGAGCCC
AAGGGGGACGCCGAGACCCCCATGGCACCAGGGCCCGGCCTCTGGCAGTCGGAAGGCACA
AGTGGGGGCTACCAGACGAGAGGGACTCTGTGGCAGGACCCCACTTCCGAGGAGGACAGT
GACTCCACGGAGGGGTCTGAGGGCAGAATCGTCTTCAACGTGAATTTGAACTCTGTGTGT
GTGAGAGCCCTTGAGGATGACAAGGACTCAGAAGTCACTCTAATGTCCCCATCTTGTCCA
GAAGAGACAGTCGAGCTGGAGGACCTCAACGAGACAGAATCAAGCGTTTTGGTGGCCAGT
GAAGAAGGGACACAGCTGCCCTTCACCAACCCCTCTACGGAGTGCCCGAGGCCCCAAGAT
GCTCCTTCTGATAAAAGTGACACTTCCGATCCAGATGTTGACATGGGGGATGGGTATATA
GTAAGACAAGTGAATCTAAAAAAATTTAATTAA
Enzyme 34 GenBank Gene ID U75304 Link Image
Enzyme 34 GeneCard ID IFNAR2 Link Image
Enzyme 34 GenAtlas ID Not Available
Enzyme 34 HGNC ID Not Available
Enzyme 34 Chromosome Location Chromosome:2
Enzyme 34 Locus 21q22.1|21q22.11
Enzyme 34 SNPs SNPJam Report Link Image
Enzyme 34 General References
  1. [PubMed Link Image]
Enzyme 34 Metabolite References Not Available
Enzyme 35 [top]
Enzyme 35 ID 2593
Enzyme 35 Name Angiopoietin-1
Enzyme 35 Synonyms
  1. ANG-1
Enzyme 35 Gene Name ANGPT1
Enzyme 35 Protein Sequence >Angiopoietin-1
MTVFLSFAFLAAILTHIGCSNQRRSPENGGRRYNRIQHGQCAYTFILPEHDGNCRESTTD
QYNTNALQRDAPHVEQDFSSQKLQHLEHVMENYTQWLQKIENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIHEKNSLLEHKIFEMEGKHKEELDTLKEEKENLQGLVTRQTYIIQELEKQLNRA
TTNNSVLQKQQLELMDTVHNLVNLCTKEVLLKGGKKEEEKPFRDCADVYQAGFNKSGIYT
IYINNMPEPKKVFCNMDLNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEF
IFAITSQRQYTLRIELLDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILH
GADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKG
PSYSLRSTTMMIRPLDF
Enzyme 35 Number of Residues 497
Enzyme 35 Molecular Weight 57428.5
Enzyme 35 Theoretical pI 6.75
Enzyme 35 GO Classification
Function
Process
Component
Enzyme 35 General Function Involved in receptor binding
Enzyme 35 Specific Function Binds and activates TIE2 receptor by inducing its tyrosine phosphorylation. Implicated in endothelial developmental processes later and distinct from that of VEGF. Appears to play a crucial role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme. Mediates blood vessel maturation/stability. It may play an important role in the heart early development
Enzyme 35 Pathways Not Available
Enzyme 35 Reactions Not Available
Enzyme 35 Pfam Domain Function
Enzyme 35 Signals
  • 1-15
Enzyme 35 Transmembrane Regions
  • None
Enzyme 35 Essentiality Not Available
Enzyme 35 GenBank ID Protein 115305176 Link Image
Enzyme 35 UniProtKB/Swiss-Prot ID O18920 Link Image
Enzyme 35 UniProtKB/Swiss-Prot Entry Name ANGP1_BOVIN Link Image
Enzyme 35 PDB ID Not Available
Enzyme 35 Cellular Location Not Available
Enzyme 35 Gene Sequence >1494 bp
ATGACAGTTTTCCTTTCCTTTGCTTTCCTCGCTGCTATTCTGACTCACATAGGGTGCAGC
AACCAGCGCCGAAGTCCAGAAAACGGTGGGAGAAGATATAACCGGATTCAACATGGGCAA
TGTGCCTACACTTTCATTCTTCCAGAACACGACGGTAACTGTCGTGAGAGTACGACAGAC
CAGTACAACACAAACGCTCTGCAGAGAGATGCTCCACACGTGGAACAGGATTTCTCTTCC
CAGAAACTTCAACATCTGGAGCATGTGATGGAAAATTATACTCAGTGGCTGCAAAAAATT
GAGAATTACATTGTGGAAAATATGAAGTCGGAGATGGCTCAGATACAGCAGAATGCAGTT
CAGAACCACACGGCCACCATGCTCGAGATAGGGACCAGCCTCCTCTCTCAGACCGCAGAG
CAGACCAGAAAGCTGACAGATGTAGAGACCCAGGTACTAAATCAAACATCTCGACTTGAA
ATACAACTGCTGGAGAATTCATTATCAACCTACAAGCTAGAGAAACAACTTCTTCAACAG
ACAAATGAAATCTTAAAGATTCATGAGAAAAACAGTTTATTAGAACACAAAATCTTTGAA
ATGGAGGGAAAGCACAAGGAAGAATTGGACACCTTAAAGGAAGAGAAAGAGAATCTTCAA
GGCTTGGTTACTCGTCAGACGTACATAATCCAGGAACTGGAGAAACAGTTGAACAGAGCC
ACCACCAATAACAGTGTCCTTCAGAAGCAGCAGCTGGAGCTCATGGACACAGTGCACAAC
CTCGTCAACCTCTGCACTAAAGAAGTTTTACTAAAGGGAGGAAAAAAAGAGGAAGAAAAG
CCATTTAGAGACTGTGCAGATGTATATCAAGCTGGTTTTAATAAAAGTGGAATCTACACT
ATTTATATTAATAATATGCCAGAACCCAAAAAGGTATTTTGCAATATGGATCTCAACGGG
GGAGGTTGGACTGTAATACAGCATCGTGAAGACGGAAGTCTAGATTTCCAAAGAGGTTGG
AAAGAATATAAAATGGGTTTTGGAAATCCCTCTGGTGAATATTGGTTGGGGAACGAGTTT
ATTTTTGCCATAACCAGTCAGAGGCAGTACACTCTAAGAATTGAGTTATTGGACTGGGAA
GGAAACCGAGCCTATTCACAGTATGACAGATTCCACATAGGAAATGAAAAGCAGAACTAC
AGGTTGTATTTGAAGGGTCACACTGGGACAGCAGGAAAACAGAGCAGCCTGATCTTGCAT
GGTGCTGATTTCAGCACTAAAGATGCTGATAACGACAACTGCATGTGCAAATGTGCCCTC
ATGCTAACAGGAGGCTGGTGGTTTGATGCCTGTGGCCCATCCAATCTAAATGGAATGTTT
TATACAGCGGGACAGAACCATGGAAAACTGAATGGAATAAAATGGCATTATTTCAAAGGG
CCCAGTTACTCCTTACGTTCCACAACTATGATGATTCGACCTTTGGACTTTTGA
Enzyme 35 GenBank Gene ID BC123628 Link Image
Enzyme 35 GeneCard ID ANGPT1 Link Image
Enzyme 35 GenAtlas ID Not Available
Enzyme 35 HGNC ID Not Available
Enzyme 35 Chromosome Location Chromosome:8
Enzyme 35 Locus 8q22.3-q23
Enzyme 35 SNPs SNPJam Report Link Image
Enzyme 35 General References
  1. [PubMed Link Image]
Enzyme 35 Metabolite References Not Available
Enzyme 36 [top]
Enzyme 36 ID 2594
Enzyme 36 Name General transcription factor II-I
Enzyme 36 Synonyms
  1. GTFII-I
  2. TFII-I
Enzyme 36 Gene Name GTF2I
Enzyme 36 Protein Sequence >General transcription factor II-I
MAQVAVSTLPVEDEESSESRMVVTFLMSALESMCKELAKSKAEVACIAVYETDVFVVGTE
RGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTAQANRMSVDAVEIETLRKTVEDYF
CFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGI
SFIIKRPFLEPKKHLGGRVMVTDAERSMISPSGSCGPVKVKTEPSEDSGISLEMAAVTVK
EESEDPDYYQYNIQAGPSETDDVDDKLPLSKSLQGSHHSSEGNEGTEMEVPAEDDDYPPP
AKRPKSSEPPQPPVTEPANAGKRKVREFNFEKWNARITDLRKQVEELFERKYAQAIKAKG
PVTIPYPLFQSHVEDLYVEGLPEGIPFRRPSTYGIPRLERILLAKERIRFVIKKHELLNS
TREDLQLDKPASGVKEEWYARITKLRKMVDQLFCKKFAEALGSTEAKAVPYQKFEAHPND
LYVEGLPENIPFRSPSWYGIPRLEKIIQVGNRIKFVIKRPELLTHSTTEVTQPRTNTPVK
EDWNVRITKLRKQVEEIFNLKFAQALGLTEAVKVPYPVFESNPEFLYVEGLPEGIPFRSP
TWFGIPRLERIVRGSNKIKFVVKKPELVISYLPPGMASKINTKALQSPKRPRSPGSNSKV
PEIEVTVEGPNNSNPQTSAVRTPTQTNGSNVPFKPRGREFSFEAWNAKITDLKQKVENLF
NEKCGEALGLKQAVKVPFALFESFPEDFYVEGLPEGVPFRRPSTFGIPRLEKILRNKAKI
KFIIKKPEMFETAIKESTSSSKSPPRKINSSPSVNTTASGVEDLNIIQVTIPDDDNERLS
KVEKARQLREQVNDLFSRKFGEAIGMGFPVKVPYRKITINPGCVVVDGMPPGVSFKAPSY
LEISSMRRILDSAEFIKFTVIRPFPGLVINNQLVDQNESEGPVIQESAEPTQLEVPATEE
IKETDGNSQIKQEPDPTW
Enzyme 36 Number of Residues 978
Enzyme 36 Molecular Weight 110124.2
Enzyme 36 Theoretical pI 7.47
Enzyme 36 GO Classification
Function
Process
Component
Enzyme 36 General Function Not Available
Enzyme 36 Specific Function Interacts with the basal transcription machinery by coordinating the formation of a multiprotein complex at the C-FOS promoter, and linking specific signal responsive activator complexes. Promotes the formation of stable high-order complexes of SRF and PHOX1 and interacts cooperatively with PHOX1 to promote serum-inducible transcription of a reporter gene deriven by the C- FOS serum response element (SRE). Acts as a coregulator for USF1 by binding independently two promoter elements, a pyrimidine-rich initiator (Inr) and an upstream E-box. Required for the formation of functional ARID3A DNA-binding complexes and for activation of immunoglobulin heavy-chain transcription upon B-lymphocyte activation
Enzyme 36 Pathways Not Available
Enzyme 36 Reactions Not Available
Enzyme 36 Pfam Domain Function
Enzyme 36 Signals
  • None
Enzyme 36 Transmembrane Regions
  • None
Enzyme 36 Essentiality Not Available
Enzyme 36 GenBank ID Protein 154426134 Link Image
Enzyme 36 UniProtKB/Swiss-Prot ID A7MB80 Link Image
Enzyme 36 UniProtKB/Swiss-Prot Entry Name GTF2I_BOVIN Link Image
Enzyme 36 PDB ID 1Q60 Link Image
Enzyme 36 PDB File Show
Enzyme 36 3D Structure
Enzyme 36 Cellular Location Not Available
Enzyme 36 Gene Sequence >2937 bp
ATGGCCCAAGTAGCAGTGTCTACCCTGCCTGTCGAAGACGAGGAGTCCTCAGAGAGCAGG
ATGGTGGTGACGTTCCTCATGTCTGCTCTTGAGTCCATGTGTAAAGAACTGGCCAAGTCC
AAGGCGGAAGTAGCGTGCATCGCAGTGTATGAGACAGACGTGTTTGTTGTTGGAACCGAG
AGAGGACGTGCTTTTGTCAACACTAGAAAGGACTTTCAGAAAGATTTTGTAAAATACTGT
GTTGAAGAAGAAGAAAAGGCTGCAGAGATGCATAAAATGAAATCTACAGCCCAGGCAAAT
CGGATGAGTGTCGATGCTGTGGAGATAGAAACACTCAGAAAAACAGTTGAGGACTATTTC
TGCTTTTGCTATGGGAAAGCTTTAGGCAAGTCAACAGTGGTGCCTGTTCCATATGAAAAG
ATGCTCCGAGATCAGTCGGCCGTGGTGGTGCAGGGGCTTCCAGAAGGAGTAGCCTTCAAA
CACCCTGAAAACTATGATCTTGCAACCCTGAAGTGGATTTTGGAGAACAAAGCAGGGATT
TCATTTATCATTAAAAGACCTTTCCTAGAGCCAAAGAAGCACCTAGGTGGTCGTGTGATG
GTTACAGATGCTGAAAGGTCAATGATATCTCCAAGTGGAAGCTGTGGCCCCGTCAAAGTA
AAAACAGAACCCTCAGAGGATTCTGGCATTTCTCTGGAAATGGCAGCTGTGACAGTGAAG
GAAGAATCTGAAGATCCTGATTACTATCAATATAACATTCAAGCAGGCCCTTCTGAAACT
GATGATGTTGATGACAAACTCCCCCTTTCGAAGTCTTTGCAAGGAAGCCATCATTCTTCA
GAGGGCAATGAAGGAACAGAAATGGAAGTACCAGCAGAAGATGATGACTATCCTCCACCT
GCCAAGAGACCAAAGAGCAGTGAACCTCCCCAGCCACCCGTCACAGAACCTGCGAATGCC
GGCAAACGGAAAGTGAGGGAGTTCAACTTCGAGAAATGGAATGCTCGAATTACTGATCTG
CGTAAACAAGTTGAAGAGTTGTTTGAAAGAAAGTATGCTCAAGCTATAAAAGCCAAAGGT
CCTGTGACGATCCCGTACCCTCTTTTCCAGTCCCATGTGGAAGATCTTTATGTAGAAGGA
CTTCCAGAAGGAATCCCCTTTAGAAGGCCATCAACTTATGGAATCCCTCGCCTTGAGAGG
ATATTACTTGCAAAGGAAAGGATTCGTTTTGTGATTAAGAAGCATGAACTTTTGAATTCA
ACACGTGAAGACTTACAGCTTGATAAACCAGCTTCAGGAGTCAAGGAAGAGTGGTATGCC
AGAATCACTAAGTTACGAAAGATGGTAGATCAGCTTTTCTGTAAAAAATTTGCTGAAGCC
TTAGGGAGCACCGAAGCTAAGGCTGTACCTTACCAGAAATTTGAAGCACACCCTAATGAC
CTCTACGTGGAAGGACTGCCAGAAAACATTCCTTTTAGAAGTCCCTCGTGGTATGGGATC
CCAAGGCTGGAAAAGATTATTCAAGTGGGCAATCGAATTAAATTTGTTATTAAAAGACCA
GAGCTTCTGACGCACAGCACTACTGAAGTTACTCAGCCCAGAACGAATACACCAGTCAAA
GAAGATTGGAATGTCAGAATTACCAAGCTACGGAAGCAAGTGGAAGAGATTTTTAATTTG
AAATTTGCTCAAGCTCTTGGACTCACAGAAGCAGTAAAAGTACCATACCCGGTGTTTGAA
TCAAACCCCGAGTTCCTCTATGTAGAAGGCTTGCCAGAAGGAATTCCCTTTCGAAGCCCT
ACCTGGTTTGGAATTCCAAGACTGGAAAGGATTGTCCGTGGAAGTAATAAAATCAAGTTT
GTTGTTAAAAAACCTGAACTAGTTATTTCCTACTTGCCTCCTGGAATGGCTAGTAAAATA
AACACTAAAGCTTTGCAGTCCCCGAAAAGACCACGAAGCCCCGGGAGTAATTCGAAAGTT
CCTGAAATTGAGGTCACTGTGGAAGGCCCTAATAATAGCAATCCTCAAACCTCAGCCGTT
CGAACCCCTACCCAGACGAATGGTTCTAATGTTCCCTTCAAGCCTCGAGGGAGAGAGTTT
TCCTTTGAGGCCTGGAATGCCAAAATCACAGACCTAAAACAGAAAGTTGAAAATCTTTTC
AATGAAAAATGTGGTGAAGCTCTTGGCCTTAAACAAGCTGTGAAAGTGCCGTTCGCGTTA
TTTGAGTCTTTCCCAGAAGACTTTTATGTGGAAGGCTTACCCGAGGGTGTGCCATTCCGA
CGACCGTCTACTTTTGGCATTCCAAGGCTGGAGAAGATACTCAGAAACAAAGCCAAAATT
AAGTTCATCATTAAAAAGCCAGAAATGTTTGAGACTGCAATTAAGGAGAGCACCTCCTCA
TCTAAGAGCCCTCCAAGAAAAATCAATTCATCACCCAGTGTTAATACTACTGCATCAGGT
GTTGAAGACCTTAACATCATTCAGGTGACAATTCCAGACGATGATAATGAAAGACTATCA
AAAGTTGAAAAAGCTCGACAGCTAAGAGAGCAAGTTAATGACCTCTTCAGTCGAAAATTT
GGTGAAGCCATTGGGATGGGTTTCCCCGTGAAGGTTCCTTACAGGAAAATCACAATTAAC
CCTGGCTGTGTGGTGGTTGATGGCATGCCCCCCGGAGTGTCATTCAAAGCCCCCAGCTAT
CTGGAAATCAGCTCCATGAGAAGGATCTTAGATTCTGCTGAGTTCATTAAATTCACAGTC
ATTAGACCATTTCCAGGACTTGTGATTAATAACCAGTTGGTTGATCAGAATGAGTCAGAA
GGCCCAGTGATCCAAGAATCAGCTGAGCCAACCCAGTTGGAGGTTCCTGCAACCGAAGAA
ATAAAGGAGACTGATGGAAACTCCCAAATCAAGCAAGAACCAGACCCTACGTGGTAG
Enzyme 36 GenBank Gene ID BC151387 Link Image
Enzyme 36 GeneCard ID GTF2I Link Image
Enzyme 36 GenAtlas ID Not Available
Enzyme 36 HGNC ID Not Available
Enzyme 36 Chromosome Location Chromosome:7
Enzyme 36 Locus 7q11.23
Enzyme 36 SNPs SNPJam Report Link Image
Enzyme 36 General References Not Available
Enzyme 36 Metabolite References Not Available
Enzyme 37 [top]
Enzyme 37 ID 2595
Enzyme 37 Name Suppressor of cytokine signaling 3
Enzyme 37 Synonyms
  1. SOCS-3
Enzyme 37 Gene Name SOCS3
Enzyme 37 Protein Sequence >Suppressor of cytokine signaling 3
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSTVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPAAGAPSFSQPPAEPSSSPSSEVPEQPPAQPLSGNPPRRAYYIYSGGEKIPL
VLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Enzyme 37 Number of Residues 229
Enzyme 37 Molecular Weight 25134.2
Enzyme 37 Theoretical pI 9.08
Enzyme 37 GO Classification
Function
Process
Component
Enzyme 37 General Function Involved in intracellular signaling cascade
Enzyme 37 Specific Function SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin and leptin receptors. Inhibits JAK2 kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo. Probable substrate recognition component of a SCF-like ECS (Elongin BC- CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize IL6ST
Enzyme 37 Pathways
  • Protein modification
  • protein ubiquitination
Enzyme 37 Reactions Not Available
Enzyme 37 Pfam Domain Function
Enzyme 37 Signals
  • None
Enzyme 37 Transmembrane Regions
  • None
Enzyme 37 Essentiality Not Available
Enzyme 37 GenBank ID Protein 12963889 Link Image
Enzyme 37 UniProtKB/Swiss-Prot ID Q9BEG9 Link Image
Enzyme 37 UniProtKB/Swiss-Prot Entry Name SOCS3_BOVIN Link Image
Enzyme 37 PDB ID Not Available
Enzyme 37 Cellular Location Not Available
Enzyme 37 Gene Sequence Not Available
Enzyme 37 GenBank Gene ID AY026859 Link Image
Enzyme 37 GeneCard ID SOCS3 Link Image
Enzyme 37 GenAtlas ID Not Available
Enzyme 37 HGNC ID Not Available
Enzyme 37 Chromosome Location Chromosome:1
Enzyme 37 Locus 17q25.3
Enzyme 37 SNPs SNPJam Report Link Image
Enzyme 37 General References Not Available
Enzyme 37 Metabolite References Not Available
Enzyme 38 [top]
Enzyme 38 ID 2596
Enzyme 38 Name Scavenger receptor cysteine-rich type 1 protein M130
Enzyme 38 Synonyms
  1. CD163 antigen
  2. Soluble CD163
  3. sCD163
Enzyme 38 Gene Name CD163
Enzyme 38 Protein Sequence >Scavenger receptor cysteine-rich type 1 protein M130
MVLHDNSGSAGFKRCSVHFGPFTLAVVSVLYACLITSALGGTDKELRLVAGQTKCSGRVE
VKVQEEWGTVCNTGWDLAAVSVVCKQLGCPSVIKATGWTNSSAGTGRIWMDHVSCRGNES
ALWDCKHEGWGKHNCTHQQDVGVTCSDGSDLEMRLMNGGNRCSGRIEIKFQGQWGTVCDD
NFNLDHASVVCKQLGCGSAVSFSGSANFGEGSGPIWFDDLVCHGNESALWNCRHEGWGKH
NCDHAEDAGVICLEGADLSLRLVDGVTKCSGRLEVRFQGEWGTVCDDGWDSDDAAVACQQ
LGCPTAITAVGRVNASEGTGHIWLDSVSCQGHESAVWQCRHHEWGKHYCNHNEDAGVTCS
DGSDLELRLKGGGSRCAGTVEVEIQKLIGKVCDRSWGLKEADVVCKQLGCGSALRTSYQV
YSKIQATNTWLFLNNCNGNETSIWDCKNWQWGGLSCEHYHEAKVTCSAHREPRLVGGDIP
CSGRVEVKHGDTWGTICDSDFSLESASVLCRELECGSVVSILGGAHFGEGNGQIWAEEFQ
CEGNESHLSLCPVAPRLDGTCSHSKDIGVVCSRYTEVRLVGGNTPCEGRVEVKILGTWGP
LCNSHWDMEDAHVLCQQLKCGVAASIPGRAPFGKGSGQPWRHMFHCTGTEQHMGDCPVTA
LGASLCPEGQVASVICSGNRSQTLYPCNSSSSDPESSVVLEENGVPCIGSGQLRLVNGGG
RCAGRIEVYHEGSWGTICDDSWDLDDAHVVCRQLGCGVAINATGSAHFGEGSGPIWLDEV
NCNGKEPRISQCRSHGWGRQNCRHKEDAGVICSEFMSLRLISDSSSETCAGRLEVFYNGA
WGSVGKSDMSATTVGVVCRQLGCTDKGSIRPAPSDKVENRYMWVDNVRCPKGPETLWQCP
SSPWKRRLASPSEETWITCADKIRLQEGTTNCSGRVEVWHGGSWGTVCDDSWDLNDAQVV
CRQLGCGLALEAGKEAAFGQGTGPIWLNEVKCKGNESSLWDCPARSWGHSDCGHKEDASV
KCSEIAESKGSVKAAGHSSTVALGILGVILLAFLIATLLWIQRRRQRQRLAVSSRGENSV
HEIQYREMNSCLKADDLDLYNSSGLWVLRGSIALGFRLVTAAEAERHST
Enzyme 38 Number of Residues 1129
Enzyme 38 Molecular Weight 121805.6
Enzyme 38 Theoretical pI 5.93
Enzyme 38 GO Classification
Function
Process
Component
Enzyme 38 General Function Involved in scavenger receptor activity
Enzyme 38 Specific Function After shedding, the soluble form (sCD163) may play an anti-inflammatory role
Enzyme 38 Pathways Not Available
Enzyme 38 Reactions Not Available
Enzyme 38 Pfam Domain Function
Enzyme 38 Signals
  • 1-40
Enzyme 38 Transmembrane Regions
  • 1040-1060
Enzyme 38 Essentiality Not Available
Enzyme 38 GenBank ID Protein 242133646 Link Image
Enzyme 38 UniProtKB/Swiss-Prot ID P85521 Link Image
Enzyme 38 UniProtKB/Swiss-Prot Entry Name C163A_BOVIN Link Image
Enzyme 38 PDB ID Not Available
Enzyme 38 Cellular Location Not Available
Enzyme 38 Gene Sequence Not Available
Enzyme 38 GenBank Gene ID GQ184570 Link Image
Enzyme 38 GeneCard ID CD163 Link Image
Enzyme 38 GenAtlas ID Not Available
Enzyme 38 HGNC ID Not Available
Enzyme 38 Chromosome Location Chromosome:1
Enzyme 38 Locus 12p13.3
Enzyme 38 SNPs SNPJam Report Link Image
Enzyme 38 General References
  1. [PubMed Link Image]
Enzyme 38 Metabolite References Not Available
Enzyme 39 [top]
Enzyme 39 ID 2597
Enzyme 39 Name TYRO protein tyrosine kinase-binding protein
Enzyme 39 Synonyms
  1. DNAX-activation protein 12
Enzyme 39 Gene Name TYROBP
Enzyme 39 Protein Sequence >TYRO protein tyrosine kinase-binding protein
MEGLRPSDRLLSLLLTVGGLSLVLAQSECNCSSVSPGVLAGIVLGDLMLTLLIALAVYYL
GRLVPRGRGATEVTRKQHIPETESPYQELQGQRTDVYSDLNTQRPYYK
Enzyme 39 Number of Residues 108
Enzyme 39 Molecular Weight 11835.6
Enzyme 39 Theoretical pI 7.25
Enzyme 39 GO Classification
Function
Process
Component
Enzyme 39 General Function Not Available
Enzyme 39 Specific Function Non-covalently associates with activating receptors of the CD300 family. Cross-linking of CD300-TYROBP complexes results in cellular activation
Enzyme 39 Pathways Not Available
Enzyme 39 Reactions Not Available
Enzyme 39 Pfam Domain Function Not Available
Enzyme 39 Signals
  • 1-25
Enzyme 39 Transmembrane Regions
  • 37-57
Enzyme 39 Essentiality Not Available
Enzyme 39 GenBank ID Protein 16945318 Link Image
Enzyme 39 UniProtKB/Swiss-Prot ID Q95J79 Link Image
Enzyme 39 UniProtKB/Swiss-Prot Entry Name TYOBP_BOVIN Link Image
Enzyme 39 PDB ID Not Available
Enzyme 39 Cellular Location Not Available
Enzyme 39 Gene Sequence >327 bp
ATGGAGGGCCTTAGACCCTCCGACAGGCTCCTATCTCTCCTTCTGACTGTGGGTGGTCTC
AGCCTCGTCCTGGCCCAGAGTGAATGCAACTGCTCCTCGGTGAGCCCGGGCGTGCTGGCA
GGGATCGTGTTGGGGGACCTGATGCTGACCCTCCTCATCGCTCTGGCTGTGTACTACCTG
GGTCGGCTGGTCCCTCGGGGGCGAGGGGCTACGGAGGTGACCCGGAAACAGCACATCCCG
GAGACAGAGTCGCCTTATCAGGAGCTCCAAGGCCAGAGGACAGATGTCTACAGCGACCTC
AACACACAGAGGCCGTATTACAAATGA
Enzyme 39 GenBank Gene ID AJ419227 Link Image
Enzyme 39 GeneCard ID TYROBP Link Image
Enzyme 39 GenAtlas ID Not Available
Enzyme 39 HGNC ID Not Available
Enzyme 39 Chromosome Location Chromosome:1
Enzyme 39 Locus 19q13.1
Enzyme 39 SNPs SNPJam Report Link Image
Enzyme 39 General References Not Available
Enzyme 39 Metabolite References Not Available
Enzyme 40 [top]
Enzyme 40 ID 2598
Enzyme 40 Name Caveolin-2
Enzyme 40 Synonyms Not Available
Enzyme 40 Gene Name CAV2
Enzyme 40 Protein Sequence >Caveolin-2
MGLETEKADVQLFMDDDSYSRHSSVDYADPDKFVDPGSDRDPHRLNSHLKVGFEDVIAEP
VSTHSFDKVWICSHALFEMSKYVIYKFLTVFLAIPLAFAAGILFATLSCLHIWIIMPFVK
TCLMVLPSVQTIWKSVTDVVIAPLCTSIGRSFSSVSLQLSHD
Enzyme 40 Number of Residues 162
Enzyme 40 Molecular Weight 18159.8
Enzyme 40 Theoretical pI 5.46
Enzyme 40 GO Classification
Function
Process
Component
Enzyme 40 General Function Not Available
Enzyme 40 Specific Function May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. Acts as an accessory protein in conjunction with CAV1 in targeting to lipid rafts and driving caveolae formation. Positive regulator of cellular mitogenesis of the MAPK signaling pathway. Required for the insulin-stimulated nuclear translocation and activation of MAPK1 and STAT3, and the subsequent regulation of cell cycle progression. May be involved in synaptic transduction in the retina
Enzyme 40 Pathways Not Available
Enzyme 40 Reactions Not Available
Enzyme 40 Pfam Domain Function
Enzyme 40 Signals
  • None
Enzyme 40 Transmembrane Regions
  • 87-107
Enzyme 40 Essentiality Not Available
Enzyme 40 GenBank ID Protein 51512145 Link Image
Enzyme 40 UniProtKB/Swiss-Prot ID Q66WT7 Link Image
Enzyme 40 UniProtKB/Swiss-Prot Entry Name CAV2_BOVIN Link Image
Enzyme 40 PDB ID Not Available
Enzyme 40 Cellular Location Not Available
Enzyme 40 Gene Sequence Not Available
Enzyme 40 GenBank Gene ID AY699947 Link Image
Enzyme 40 GeneCard ID CAV2 Link Image
Enzyme 40 GenAtlas ID Not Available
Enzyme 40 HGNC ID Not Available
Enzyme 40 Chromosome Location Chromosome:7
Enzyme 40 Locus 7q31.1
Enzyme 40 SNPs SNPJam Report Link Image
Enzyme 40 General References
  1. [PubMed Link Image]
Enzyme 40 Metabolite References Not Available
Enzyme 41 [top]
Enzyme 41 ID 2599
Enzyme 41 Name Cytokine-inducible SH2-containing protein
Enzyme 41 Synonyms
  1. CIS
Enzyme 41 Gene Name CISH
Enzyme 41 Protein Sequence >Cytokine-inducible SH2-containing protein
MVLCVQGLCPLLAVEQIGQRPLWAQSLELPQQVMQPLSAGAFLEEAVEESPAQPEREPKV
VDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCAADTRSDSPDLAT
TPALPTPKEDAPGDPALPATAVHLKLVQPFVRRSSTRSLQHLCRLVINRLVVDVDCLPLP
RRMADYLRQYPFQL
Enzyme 41 Number of Residues 254
Enzyme 41 Molecular Weight 28396.3
Enzyme 41 Theoretical pI 6.03
Enzyme 41 GO Classification
Function
Process
Component
Enzyme 41 General Function Involved in intracellular signaling cascade
Enzyme 41 Specific Function SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. CIS is involved in the negative regulation of cytokines that signal through the JAK-STAT5 pathway such as erythropoietin, prolactin and interleukin 3 (IL3) receptor. Inhibits STAT5 trans-activation by suppressing its tyrosine phosphorylation. May be a substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity)
Enzyme 41 Pathways
  • Protein modification
  • protein ubiquitination
Enzyme 41 Reactions Not Available
Enzyme 41 Pfam Domain Function
Enzyme 41 Signals
  • None
Enzyme 41 Transmembrane Regions
  • None
Enzyme 41 Essentiality Not Available
Enzyme 41 GenBank ID Protein 87578319 Link Image
Enzyme 41 UniProtKB/Swiss-Prot ID Q2HJ53 Link Image
Enzyme 41 UniProtKB/Swiss-Prot Entry Name CISH_BOVIN Link Image
Enzyme 41 PDB ID Not Available
Enzyme 41 Cellular Location Not Available
Enzyme 41 Gene Sequence >765 bp
ATGGTCCTCTGCGTTCAGGGACTTTGTCCTTTGCTGGCCGTGGAGCAGATTGGGCAGCGG
CCCCTGTGGGCCCAGTCCCTGGAGCTGCCCCAGCAAGTTATGCAGCCTTTGTCTGCTGGC
GCCTTCCTGGAGGAGGCAGTAGAGGAGTCCCCAGCCCAGCCAGAGAGGGAGCCCAAGGTG
GTGGACCCCGAGGAGGACCTGCTGTGCATAGCCAAGACCTTCTCCTACCTTCGGGAATCT
GGCTGGTACTGGGGTTCCATTACGGCCAGTGAGGCCCGGCAACACCTTCAGAAGATGCCA
GAGGGCACCTTCCTGGTACGTGACAGCACCCACCCCAGCTACCTGTTCACACTGTCCGTC
AAGACCACCCGCGGGCCCACCAACGTGCGCATTGAGTACGCCGACTCCAGCTTCCGCCTG
GACTCCAACTGCCTGTCCAGGCCTCGCATCCTGGCCTTCCCAGATGTGGTGAGCCTGGTC
CAGCACTACGTGGCCTCCTGTGCTGCAGACACCCGGAGTGACAGTCCCGACCTTGCCACC
ACCCCGGCCCTGCCCACCCCGAAGGAAGATGCGCCCGGTGACCCAGCCCTGCCCGCCACG
GCCGTTCACCTGAAACTGGTACAGCCCTTTGTGCGCAGGAGCAGCACCCGGAGCCTGCAG
CACCTGTGCCGCCTGGTCATCAACCGCCTGGTGGTCGACGTGGACTGCCTGCCGCTTCCC
CGGCGCATGGCTGACTACCTCCGACAATACCCCTTCCAGCTCTGA
Enzyme 41 GenBank Gene ID BC113307 Link Image
Enzyme 41 GeneCard ID CISH Link Image
Enzyme 41 GenAtlas ID Not Available
Enzyme 41 HGNC ID Not Available
Enzyme 41 Chromosome Location Chromosome:3
Enzyme 41 Locus 3p21.3
Enzyme 41 SNPs SNPJam Report Link Image
Enzyme 41 General References Not Available
Enzyme 41 Metabolite References Not Available
Enzyme 42 [top]
Enzyme 42 ID 2600
Enzyme 42 Name Proto-oncogene vav
Enzyme 42 Synonyms Not Available
Enzyme 42 Gene Name VAV1
Enzyme 42 Protein Sequence >Proto-oncogene vav
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCYEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGIMPFPTEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEVYEDLMRSE
PVPMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDVEIIFINIE
DLLRVHTHFLKEMKEALANPGASTLYQVFIKYKERFLIYGRYCSQVESASKHLDRVATAR
EDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDAMEKDNLRLALD
AMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKMD
RYAFLLDKALLICKRRGDTYDLKDFVNLHSFQVRDDSSGERDNKKWTHMFLLIEDQGAQG
YELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTFY
QGYRCQRCRAPAHKECLGRVPPCGRHGQDYSGTMKKDKPHRRAQDKKRNELGLPKMEVCQ
EYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNISTNEVGWFPCNRVKPYVHG
PPQDLSVHLWYAGPMERAGAESILTNRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIM
TAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPERRAINKPSAGSI
KIFGTAKARYDFCARDRSELSLKEGDIVKILNKKGQQGWWRGEIYGRIGWFPSNYVEEDY
SEYC
Enzyme 42 Number of Residues 844
Enzyme 42 Molecular Weight 98242.4
Enzyme 42 Theoretical pI 6.63
Enzyme 42 GO Classification
Function
Process
Component
Enzyme 42 General Function Involved in diacylglycerol binding
Enzyme 42 Specific Function Couples tyrosine kinase signals with the activation of the Rho/Rac GTPases, thus leading to cell differentiation and/or proliferation
Enzyme 42 Pathways Not Available
Enzyme 42 Reactions Not Available
Enzyme 42 Pfam Domain Function
Enzyme 42 Signals
  • None
Enzyme 42 Transmembrane Regions
  • None
Enzyme 42 Essentiality Not Available
Enzyme 42 GenBank ID Protein 115304907 Link Image
Enzyme 42 UniProtKB/Swiss-Prot ID Q08DN7 Link Image
Enzyme 42 UniProtKB/Swiss-Prot Entry Name VAV_BOVIN Link Image
Enzyme 42 PDB ID 1F5X Link Image
Enzyme 42 PDB File Show
Enzyme 42 3D Structure
Enzyme 42 Cellular Location Not Available
Enzyme 42 Gene Sequence >2535 bp
ATGGAGCTGTGGCGCCAGTGCACCCACTGGCTCATCCAGTGCCGGGTGCTACCGCCCAGC
CACCGTGTGACCTGGGATGGAGCCCAAGTGTGCGAGCTGGCGCAGGCCCTCCGGGATGGC
GTCCTTCTGTGCCAGCTGCTCAACAACCTGCTGCCCCATGCCATCAACCTGCGGGAAGTC
AACCTGCGTCCCCAGATGTCCCAGTTCCTCTGCCTTAAGAATATCCGCACCTTTCTGTCT
ACCTGCTACGAGAAGTTTGGCCTCAAGCGGAGTGAACTCTTTGAGGCCTTCGACCTCTTC
GATGTGCAGGATTTTGGCAAGGTCATCTACACCCTGTCCGCTCTGTCCTGGACCCCGATT
GCCCAGAACAAGGGGATCATGCCCTTCCCCACTGAGGAGAGTGTGGGTGATGAAGACATC
TACAGTGGCCTGTCCGACCAGATCGACGACACGGTGGAGGAGGATGAGGACCTGTACGAC
TGCGTGGAGAACGAGGAGGCAGAGGGCGACGAGGTCTACGAGGACCTCATGCGCTCGGAG
CCGGTGCCCATGCCGCCCAAGATGACAGAGTATGACAAGCGGTGCTGCTGTCTGCGGGAG
ATCCAGCAGACGGAGGAGAAGTATACGGACACGCTGGGCTCCATCCAACAGCATTTTATG
AAGCCCTTGCAGCGGTTCCTTAAACCCCAAGACGTCGAGATTATCTTCATCAACATTGAG
GACCTGCTTCGTGTACACACCCATTTCCTAAAGGAGATGAAGGAAGCCCTGGCCAACCCT
GGTGCATCCACCCTCTACCAGGTCTTCATCAAATACAAGGAGAGGTTCCTCATCTATGGC
CGCTACTGTAGCCAGGTGGAGTCTGCCAGCAAGCACCTGGACCGTGTGGCCACAGCCCGG
GAGGATGTACAAATGAAGCTGGAAGAATGTAGTCAGCGCGCCAACAACGGGAGGTTCACC
TTAAGGGACCTGTTGATGGTGCCCATGCAGCGAGTGCTCAAATATCACCTCCTGCTCCAG
GAGCTGGTGAAACACACACAGGATGCAATGGAGAAGGACAACTTGCGGCTGGCCCTAGAT
GCCATGAGGGACCTGGCACAGTGCGTAAACGAGGTCAAGCGGGACAATGAGACGCTGCGG
CAGATTACCAACTTCCAGCTGTCCATCGAGAACCTGGACCAGTCTCTAGCCCACTACGGC
CGACCCAAGATCGATGGTGAGCTGAAGATAACTTCGGTGGAGAGGCGCTCCAAGATGGAC
AGGTATGCCTTCCTGCTTGACAAAGCTCTGCTCATCTGTAAGCGCCGAGGGGACACCTAC
GACCTCAAGGACTTTGTGAACCTGCACAGCTTCCAGGTTCGAGATGACTCCTCCGGAGAG
AGGGACAACAAGAAGTGGACTCACATGTTCCTCCTGATTGAGGACCAAGGTGCCCAGGGC
TATGAGCTGTTCTTCAAGACACGAGAACTAAAGAAGAAGTGGATGGAGCAGTTCGAGATG
GCCATCTCCAACATCTACCCCGAGAACGCCACTGCCAATGGTCATGACTTTCAGATGTTT
TCCTTTGAGGAGACCACATCCTGCAAGGCTTGCCAGATGCTGCTGAGAGGCACTTTCTAT
CAGGGGTACCGCTGTCAACGGTGCCGAGCACCTGCACACAAGGAGTGTCTTGGGAGGGTC
CCTCCGTGTGGTCGACATGGACAAGATTATTCAGGAACTATGAAGAAGGATAAGCCACAT
CGGCGGGCTCAAGACAAAAAGAGGAATGAGCTAGGCCTGCCCAAGATGGAGGTGTGCCAG
GAATACTACGGGCTGCCCCCACCCCCTGGAGCCATTGGACCTTTTTTGCGCCTCAACCCG
GGAGACATTGTGGAGCTCACTAAGGCTGAAGCCGAACAGAACTGGTGGGAGGGAAGGAAT
ATATCTACCAATGAAGTCGGCTGGTTTCCCTGCAATAGGGTCAAGCCCTACGTGCATGGT
CCCCCTCAGGACCTGTCCGTTCATCTCTGGTACGCTGGCCCCATGGAGCGAGCCGGGGCG
GAAAGCATTCTTACCAACCGCTCGGATGGGACGTTCTTGGTGCGGCAGAGGGTGAAGGAT
GCCGCGGAATTTGCCATCAGTATTAAGTATAATGTTGAAGTCAAGCATATTAAAATCATG
ACAGCAGAAGGACTGTACCGGATTACAGAAAAGAAAGCTTTCAGGGGACTTACGGAGCTG
GTGGAATTCTACCAACAGAACTCTCTGAAGGATTGCTTCAAGTCGCTGGACACCACCCTG
CAGTTCCCCTTCAAGGAGCCTGAGAGGAGAGCCATCAACAAACCATCAGCCGGGAGCATC
AAGATCTTTGGCACTGCTAAAGCCCGCTATGACTTCTGCGCCCGGGACCGGTCAGAGCTG
TCCCTCAAAGAGGGCGACATCGTCAAGATCCTTAACAAGAAGGGGCAGCAGGGCTGGTGG
CGAGGGGAGATCTATGGCCGGATTGGCTGGTTCCCCTCCAACTATGTGGAAGAGGACTAT
TCTGAGTACTGCTGA
Enzyme 42 GenBank Gene ID BC123646 Link Image
Enzyme 42 GeneCard ID VAV1 Link Image
Enzyme 42 GenAtlas ID Not Available
Enzyme 42 HGNC ID Not Available
Enzyme 42 Chromosome Location Chromosome:1
Enzyme 42 Locus 19p13.2
Enzyme 42 SNPs SNPJam Report Link Image
Enzyme 42 General References Not Available
Enzyme 42 Metabolite References Not Available