We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Estradiol (BMDB00151)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-08-04 14:41:28
Accession Number BMDB00151
Common Name Estradiol
Description Estradiol is the most potent form of mammalian estrogenic steroids. Estradiol is produced in the ovaries. The ovary requires both luteinizing hormone (LH) and follicle-stimulating hormone (FSH) to produce sex steroids. LH stimulates the cells surrounding the follicle to produce progesterone and androgens. The androgens diffuse across the basement membrane to the granulosa cell layer, where, under the action of FSH, they are aromatized to estrogens, mainly estradiol. The ovary shows cyclical activity, unlike the testis that is maintained in a more or less constant state of activity. Hormone secretions vary according to the phase of the menstrual cycle. In the developing follicle LH receptors (LH-R) are only located on the thecal cells and FSH receptors (FSHR) on the granulosa cells. The dominant pre-ovulatory follicle develops LH-Rs on the granulosa cells prior to the LH surge. Thecal cells of the preovulatory follicle also develop the capacity to synthesize estradiol and this persists when the thecal cells become incorporated into the corpus luteum. After ovulation, the empty follicle is remodelled and plays an important role in the second half or luteal phase of the menstrual cycle. This phase is dominated by progesterone and, to a lesser extent, estradiol secretion by the corpus luteum. estradiol is also synthesized locally from cholesterol through testosterone in the hippocampus and acts rapidly to modulate neuronal synaptic plasticity. Localization of estrogen receptor alpha (ERalpha) in spines in addition to nuclei of principal neurons implies that synaptic ERalpha is responsible for rapid modulation of synaptic plasticity by endogenous estradiol. estradiol is a potent endogenous antioxidant which suppresses hepatic fibrosis in animal models, and attenuates induction of redox sensitive transcription factors, hepatocyte apoptosis and hepatic stellate cells activation by inhibiting a generation of reactive oxygen species in primary cultures. This suggests that the greater progression of hepatic fibrosis and hepatocellular carcinoma in men and postmenopausal women may be due, at least in part, to lower production of estradiol and a reduced response to the action of estradiol. estradiol has been reported to induce the production of interferon (INF)-gamma in lymphocytes, and augments an antigen-specific primary antibody response in human peripheral blood mononuclear cells. IFN-gamma is a potent cytokine with immunomodulatory and antiproliferative properties. Therefore, female subjects, particularly before menopause, may produce antibodies against hepatitis B virus e antigen and hepatitis B virus surface antigen at a higher frequency than males with chronic hepatitis B virus infection. The estradiol-Dihydrotestosterone model of prostate cancer (PC) proposes that the first step in the development of most PC and breast cancer (BC) occurs when aromatase converts testosterone to estradiol. (PMID: 17708600, 17678531, 17644764)
Synonyms
  1. (+)-3,17b-Estradiol
  2. (17b)-Estra-1,3,5(10)-triene-3,17-diol
  3. 13b-Methyl-1,3,5(10)-gonatriene-3,17b-ol
  4. 17b-Estradiol
  5. 17b-Oestradiol
  6. 3,17-Epidihydroxyestratriene
  7. 3,17b-Dihydroxyestra-1,3,5(10)-triene
  8. 3,17b-Estradiol
  9. Aerodiol
  10. Agofollin
  11. Altrad
  12. Amnestrogen
  13. Aquadiol
  14. Bardiol
  15. Beta-estradiol
  16. Climaderm
  17. Climara
  18. Compudose
  19. Corpagen
  20. D-Estradiol
  21. D-Oestradiol
  22. Dermestril
  23. Dihydrofollicular hormone
  24. Dihydrofolliculin
  25. Dihydromenformon
  26. Dihydrotheelin
  27. Dihydroxyestrin
  28. Dimenformon
  29. Diogyn
  30. Diogynets
  31. Divigel
  32. Encore
  33. Epiestriol 50
  34. Estra-1,3,5(10)-triene-3,17b-diol
  35. Estrace
  36. Estradiol
  37. Estradot
  38. Estraldine
  39. Estring Vaginal Ring
  40. Estroclim
  41. Estroclim 50
  42. Estrogel
  43. Estrogel HBF
  44. Estrovite
  45. Evorel
  46. Femestral
  47. Femogen
  48. Follicyclin
  49. Gelestra
  50. Ginosedol
  51. Gynergon
  52. Gynoestryl
  53. Lamdiol
  54. Macrodiol
  55. Menorest
  56. Nordicol
  57. Oesclim
  58. Oestergon
  59. Oestra-1,3,5(10)-triene-3,17b-diol
  60. Oestradiol
  61. Oestrogel
  62. Oestroglandol
  63. Ovahormon
  64. Ovasterol
  65. Ovastevol
  66. Ovocyclin
  67. Ovocylin
  68. Perlatanol
  69. Primofol
  70. Profoliol
  71. Profoliol B
  72. Progynon
  73. Progynon DH
  74. Sandrena 1
  75. Syndiol
  76. Systen
  77. Vivelle
  78. Zumenon
  79. b-Estradiol
  80. dihydro-Theelin
  81. Estraderm TTS
  82. delta-Estradiol
  83. delta-Oestradiol
Chemical IUPAC Name 13-methyl-6,7,8,9,11,12,14,15,16,17-decahydrocyclopenta[a]phenanthrene-3,17-diol
Chemical Formula C18H24O2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Cholesterols and derivatives
Class
  • Steroids and Steroid Derivatives
Sub Class
  • Ketosteroids
Family
  • Mammalian_Metabolite
Species
  • secondary alcohol; phenol or hydroxyhetarene; aromatic compound
Biofunction
  • Component of Androgen and estrogen metabolism
Application
Source
  • Endogenous
Average Molecular Weight 272.382
Monoisotopic Molecular Weight 272.177643
Isomeric SMILES C[C@]12CC[C@H]3[C@@H](CCC4=C3C=CC(O)=C4)[C@@H]1CC[C@@H]2O
Canonical SMILES CC12CCC3C(CCC4=C3C=CC(O)=C4)C1CCC2O
KEGG Compound ID C00951 Link Image
BioCyc ID CPD-352 Link Image
BiGG ID 36456 Link Image
Wikipedia Link Estradiol Link Image
METLIN ID 263 Link Image
PubChem Compound 5757 Link Image
PubChem Substance 8028360 Link Image
ChEBI ID 16469 Link Image
CAS Registry Number 50-28-2
InChI Identifier InChI=1/C18H24O2/c1-18-9-8-14-13-5-3-12(19)10-11(13)2-4-15(14)16(18)6-7-17(18)20/h3,5,10,14-17,19-20H,2,4,6-9H2,1H3/t14-,15-,16+,17+,18+/m1/s1
Synthesis Reference Vasiljeva, L. L.; Demin, P. M.; Kochev, D. M.; Lapitskaya, M. A.; Pivnitskya, K. K. New synthesis of estradiol from androsta-1,4-diene-3,17-dione. Russian Chemical Bulletin (Translation of Izvestiya Akademii Nauk, Seriya Khimicheskaya) (1999), 48(3), 593-595.
Melting Point (Experimental) 178.5 oC
Experimental Water Solubility 0.0036 mg/mL [YALKOWSKY,SH & DANNENFELSER,RM (1992)] Source: PhysProp
Predicted Water Solubility 0.021300001 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity 4.01 [HANSCH,C ET AL. (1995)] Source: PhysProp
Predicted LogP/Hydrophobicity 3.57 [Predicted by ALOGPS]; 4.2 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID 1A27 Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Membrane (Predicted from LogP)
  • Cytoplasm
  • endoplasmic reticulum
Biofluid Location
  • Breast_Milk
Tissue Location
Tissue References
Adipose Tissue
Adrenal Cortex
Adrenal Gland
Brain
Epidermis
Fibroblasts
Gonads
Muscle
Neuron
Placenta
Platelet
Prostate
Spleen
Stratum Corneum
Testes
Uterus
Concentrations (Normal)
Biofluid Breast_Milk
Value 0.000220 - 0.000237 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. range from both high equol and low equol milk - high = diet of mainly red clover.
References
Biofluid Breast_Milk
Value 1.469E-06 uM
Age N/A
Sex N/A
Condition Normal
Comments Pasteurized. skim.
References
Biofluid Breast_Milk
Value 2.203E-06 uM
Age N/A
Sex N/A
Condition Normal
Comments Pasteurized. 1%.
References
Biofluid Breast_Milk
Value 3.304E-06 uM
Age N/A
Sex N/A
Condition Normal
Comments Pasteurized. 2%.
References
Biofluid Breast_Milk
Value 4.0000E-06 uM
Age N/A
Sex N/A
Condition Normal
Comments Pasteurized. whole milk.
References
Biofluid Breast_Milk
Value 6.975E-06 uM
Age N/A
Sex N/A
Condition Normal
Comments Pasteurized. half and half.
References
Biofluid Breast_Milk
Value 3.781E-05 - 5.287E-05 uM
Age N/A
Sex N/A
Condition Normal
Comments Unprocessed whole milk.
References
Biofluid Breast_Milk
Value 1.836E-05 - 3.304E-05 uM
Age N/A
Sex N/A
Condition Normal
Comments Unprocessed skim milk.
References
Biofluid Breast_Milk
Value 2.350E-05 +/- 4.0000E-06 uM
Age N/A
Sex N/A
Condition Normal
Comments Commercial whole milk.
References
Biofluid Breast_Milk
Value 1.285E-05 +/- 5.874E-06 uM
Age N/A
Sex N/A
Condition Normal
Comments commercial skim milk.
References
Biofluid Breast_Milk
Value 6.829E-05 +/- 7.343E-07 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. Holstein. From first trimester of pregnancy.
References
Biofluid Breast_Milk
Value 0.000189 +/- 9.913E-06 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. Holstein. From second trimester of pregnancy.
References
Biofluid Breast_Milk
Value 0.000188 +/- 5.507E-06 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. Holstein. From third trimester of pregnancy.
References
Biofluid Breast_Milk
Value 4.956E-05 uM
Age N/A
Sex N/A
Condition Normal
Comments Whole milk.
References
Biofluid Breast_Milk
Value 4.773E-05 uM
Age N/A
Sex N/A
Condition Normal
Comments Half skimmed milk.
References
Biofluid Breast_Milk
Value 6.0000E-05 uM
Age N/A
Sex N/A
Condition Normal
Comments Skimmed milk.
References
Biofluid Breast_Milk
Value 8.444E-05 +/- 4.626E-05 uM
Age N/A
Sex N/A
Condition Normal
Comments Whole milk (commercial).
References
Biofluid Breast_Milk
Value 0.000121 +/- 2.570E-05 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. Holstein. From first trimester of pregnancy.
References
Biofluid Breast_Milk
Value 0.000308 +/- 1.469E-05 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. Holstein. From second trimester of pregnancy.
References
Biofluid Breast_Milk
Value 0.00118 +/- 0.000128 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. Holstein. From third trimester of pregnancy.
References
Concentrations (Abnormal) Not Available
Pathway Names
  • Androgen and Estrogen Metabolism
HMDB Pathways
Name Androgen and Estrogen Metabolism
Image Show Link Image
KEGG Pathways
Name Androgen and Estrogen Metabolism
Image Show Link Image
SimCell Pathways
Name Androgen and Estrogen Metabolism
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Hydroxysteroid 17-beta dehydrogenase 6
  2. Estradiol 17-beta-dehydrogenase 12
  3. Estrogen receptor
  4. Calcium-activated potassium channel subunit beta-1
Enzyme 1 [top]
Enzyme 1 ID 606
Enzyme 1 Name Hydroxysteroid 17-beta dehydrogenase 6
Enzyme 1 Synonyms
  1. 17-beta-HSD6
  2. Oxidative 3-alpha hydroxysteroid dehydrogenase
  3. 3-alpha->beta-hydroxysteroid epimerase
  4. 3-alpha->beta-HSE
Enzyme 1 Gene Name HSD17B6
Enzyme 1 Protein Sequence >Hydroxysteroid 17-beta dehydrogenase 6
MWLYLAVLLGLYYLLRWFRERQVVSHLQDKFVFITGCDSGFGNQLARQLDLRGLRVLAGC
LTEQGAEQLRNQTSDRLQTVILDVTKTESIAAATEWVKECVGDRGLWGLVNNAGIFHSHG
YAEWIKIETYRDTLRVNLIGVIEVTLSMLPLVRKAQGRIVNVSSILGRIAFFGAVYSCSK
YGVEAFSDILRRELQHFGVKVSMVEPGYFRTAMTDWQKFSEIMKQIWKETPAHIKETYGQ
KFFDAYHDLMKQGLLSCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAQFFFVPLSYLPTS
LADYILTRSWPKPAQAV
Enzyme 1 Number of Residues 317
Enzyme 1 Molecular Weight 36197.5
Enzyme 1 Theoretical pI 8.55
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Lipid transport and metabolism
Enzyme 1 Specific Function NAD-dependent oxidoreductase with broad substrate specificity that shows both oxidative and reductive activity (in vitro). Has 17-beta-hydroxysteroid dehydrogenase activity towards various steroids (in vitro). Converts 5-alpha-androstan-3- alpha,17-beta-diol to androsterone and estradiol to estrone (in vitro). Has 3-alpha-hydroxysteroid dehydrogenase activity towards androsterone (in vitro). Has retinol dehydrogenase activity towards all-trans-retinol (in vitro). Can convert androsterone to epi-androsterone. Androsterone is first oxidized to 5-alpha- androstane-3,17-dione and then reduced to epi-andosterone. Can act on both C-19 and C-21 3-alpha-hydroxysteroids
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • 1-17
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 74354657 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q3T001 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name H17B6_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >954 bp
ATGTGGCTGTACCTGGCAGTCCTCTTGGGCCTGTACTACCTCCTGCGCTGGTTCCGAGAG
AGGCAGGTGGTGAGCCACCTCCAGGACAAGTTTGTCTTCATCACGGGCTGTGACTCGGGC
TTTGGGAACCAGCTGGCCAGGCAGCTGGACCTGCGAGGCTTGAGGGTCCTGGCTGGGTGT
CTGACGGAGCAGGGGGCCGAGCAGCTGAGGAACCAGACATCAGACAGGCTGCAGACAGTG
ATTCTGGACGTCACCAAGACAGAGAGCATCGCTGCGGCCACTGAGTGGGTGAAGGAGTGT
GTTGGGGACAGAGGGCTCTGGGGTCTGGTCAACAATGCAGGCATTTTTCACTCACATGGC
TATGCTGAGTGGATAAAGATTGAGACCTACAGGGATACCCTTAGGGTGAACCTCATTGGT
GTGATAGAGGTGACCCTGAGCATGCTTCCCCTGGTCAGGAAAGCACAGGGGAGAATTGTC
AATGTCTCCAGCATTCTGGGAAGAATTGCTTTCTTTGGAGCAGTCTACAGTTGTTCCAAG
TATGGAGTGGAAGCCTTCTCAGATATTCTGAGGCGTGAGCTTCAACATTTTGGGGTGAAA
GTCAGTATGGTTGAACCTGGCTACTTCAGAACAGCAATGACAGATTGGCAGAAGTTCTCA
GAGATAATGAAACAAATCTGGAAAGAAACCCCTGCGCATATTAAGGAGACCTATGGACAG
AAGTTTTTTGATGCCTATCACGATCTCATGAAACAAGGGCTGCTGAGTTGTAGCACAAAC
CTAAACCTGGTCACCGACTGCATGGAACACGCTCTGACATCCGTGCATCCCCGCACTCGA
TACTCAGCTGGCTGGGATGCTCAGTTTTTCTTTGTCCCTCTATCTTATTTGCCTACATCC
CTGGCAGACTACATATTGACTAGATCTTGGCCCAAACCAGCCCAGGCAGTCTAA
Enzyme 1 GenBank Gene ID BC102626 Link Image
Enzyme 1 GeneCard ID HSD17B6 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 12q13
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 927
Enzyme 2 Name Estradiol 17-beta-dehydrogenase 12
Enzyme 2 Synonyms
  1. 17-beta-hydroxysteroid dehydrogenase 12
  2. 17-beta-HSD 12
  3. 3-ketoacyl-CoA reductase
  4. KAR
Enzyme 2 Gene Name HSD17B12
Enzyme 2 Protein Sequence >Estradiol 17-beta-dehydrogenase 12
METALPAAGFLYWVGASTVAYLALRISCWFFTALRVWGLGHEAGVGPWLGEWAVVTGGTD
GIGKSYAEELAKRGMKIVLISRSQDKLDQVSSEISEKFKVETKTIAVDFTSEDIYDKIKA
SLAGLNIGVLVNNVGMSYEYPEYFLDVPDLDNTIKKLITVNALSVCKMTRLVLPGMVERS
KGAILNISSASGMYPVPLLTIYSATKAFVDFFSQCLHEEYKSKGVIVQSVLPYYVATKLA
KIKRPTWDKPSPETFVKSAMKTIGVQSRTNGYPIHSLVASVSASLPSWLYFKIAMYSGNS
IRVRYLKKMKMN
Enzyme 2 Number of Residues 312
Enzyme 2 Molecular Weight 34494.9
Enzyme 2 Theoretical pI 9.68
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Involved in binding
Enzyme 2 Specific Function Catalyzes the transformation of estrone (E1) into estradiol (E2), suggesting a central role in estrogen formation. Its strong expression in ovary and mammary gland suggest that it may constitute the major enzyme responsible for the conversion of E1 to E2 in females. Also has 3-ketoacyl-CoA reductase activity, reducing both long chain 3-ketoacyl-CoAs and long chain fatty acyl-CoAs, suggesting a role in long fatty acid elongation
Enzyme 2 Pathways
  • Lipid metabolism
  • fatty acid biosynthesis
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • 4-24 182-202 271-291
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 59858251 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q5E9H7 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name DHB12_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >939 bp
ATGGAGACAGCTCTGCCTGCAGCGGGCTTCCTGTACTGGGTGGGCGCGAGCACCGTGGCC
TACCTGGCTCTGCGCATCTCGTGCTGGTTCTTCACGGCCCTTCGGGTCTGGGGTTTGGGT
CACGAGGCGGGGGTCGGCCCGTGGCTCGGTGAATGGGCAGTTGTCACAGGTGGTACTGAT
GGAATTGGAAAATCATATGCAGAAGAGTTAGCAAAGCGTGGCATGAAGATTGTCCTTATC
AGCAGATCCCAGGACAAACTGGACCAGGTTTCCAGTGAAATAAGTGAAAAATTCAAAGTG
GAAACAAAGACCATTGCTGTTGACTTTACATCAGAAGATATTTATGATAAAATTAAAGCA
AGCTTGGCAGGTCTTAATATTGGTGTTTTAGTGAACAATGTGGGAATGTCATACGAATAT
CCAGAATACTTTTTGGACGTTCCTGACTTGGACAATACCATCAAGAAACTGATAACTGTC
AATGCTCTTTCTGTTTGTAAGATGACACGGTTGGTACTGCCTGGCATGGTAGAAAGATCT
AAAGGGGCAATTCTGAACATCTCCTCTGCCAGTGGCATGTACCCAGTTCCACTGCTGACC
ATCTACTCTGCAACCAAGGCTTTTGTAGATTTCTTCTCTCAGTGCCTCCATGAGGAATAT
AAGAGCAAGGGCGTCATTGTGCAGAGTGTCCTGCCCTACTATGTCGCCACAAAACTGGCT
AAAATTAAAAGGCCAACTTGGGACAAGCCCTCTCCAGAGACGTTTGTGAAGTCTGCAATG
AAAACCATCGGCGTGCAATCTCGAACCAACGGATACCCGATCCATTCTCTTGTGGCCTCA
GTAAGCGCAAGCCTGCCTTCCTGGCTGTATTTCAAAATCGCCATGTATTCAGGCAACTCC
ATACGGGTTCGCTATCTGAAGAAAATGAAGATGAACTAA
Enzyme 2 GenBank Gene ID BT020943 Link Image
Enzyme 2 GeneCard ID HSD17B12 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 11p11.2
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 2169
Enzyme 3 Name Estrogen receptor
Enzyme 3 Synonyms
  1. ER
  2. Estradiol receptor
  3. ER-alpha
  4. Nuclear receptor subfamily 3 group A member 1
Enzyme 3 Gene Name ESR1
Enzyme 3 Protein Sequence >Estrogen receptor
MTMTLHTKASGMALLHQIQANELEPLNRPQLKIPLERPLGEVYMDSSKPAVYNYPEGAAY
DFNAAAPASAPVYGQSGLPYGPGSEAAAFGANGLGAFPPLNSVSPSPLVLLHPPPQPLSP
FLHPHGQQVPYYLENESSGYAVREAGPPAYYRPNSDNRRQGGRERLASTSDKGSMAMESA
KETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQA
CRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRNEAVPSGDMRAANLWPSPIMIK
HTKKNSPVLSLTADQMISALLEAEPPIIYSEYDPTRPFSEASMMGLLTNLADRELVHMIN
WAKRVPGFVDLALHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVE
GMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLRSLEEKDHIHRVL
DKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHFRHMSNKGMEHLYSMKCKNVVPLYDL
LLEMLDAHRLHAPANFGSAPPEDVNQSQLAPTGCTSSHSLQTYYITGEAENFPSTV
Enzyme 3 Number of Residues 596
Enzyme 3 Molecular Weight 66488.8
Enzyme 3 Theoretical pI 7.99
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Involved in protein binding
Enzyme 3 Specific Function Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 42795679 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID P49884 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name ESR1_BOVIN Link Image
Enzyme 3 PDB ID 1R5K Link Image
Enzyme 3 PDB File Show
Enzyme 3 3D Structure
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1791 bp
ATGACCATGACCCTGCACACCAAAGCGTCCGGCATGGCCCTGCTGCACCAGATCCAAGCC
AACGAGCTGGAGCCCCTGAACCGCCCGCAGCTCAAGATCCCCCTGGAGCGGCCCCTGGGC
GAGGTGTACATGGACAGCAGCAAGCCCGCCGTGTACAACTACCCCGAGGGCGCCGCGTAC
GACTTCAACGCCGCGGCCCCCGCCTCCGCGCCCGTCTACGGCCAGTCGGGCCTCCCCTAC
GGCCCCGGGTCCGAGGCGGCGGCGTTCGGCGCCAACGGCCTGGGGGCCTTCCCGCCGCTC
AACAGCGTGTCTCCGAGCCCGCTGGTGCTGCTACACCCGCCTCCGCAGCCACTCTCGCCC
TTCCTGCACCCGCACGGCCAACAGGTGCCCTATTACCTGGAGAACGAGTCGAGCGGCTAT
GCGGTGCGCGAAGCCGGCCCTCCCGCCTACTACAGGCCAAATTCAGATAATCGACGCCAA
GGTGGCAGAGAGAGATTGGCCAGTACCAGTGACAAGGGAAGCATGGCCATGGAATCTGCC
AAGGAGACTCGCTACTGTGCAGTGTGCAATGACTATGCCTCAGGCTACCATTACGGAGTT
TGGTCTTGCGAGGGCTGTAAGGCCTTCTTCAAGAGAAGTATTCAAGGACATAATGACTAC
ATGTGTCCGGCCACCAACCAGTGCACGATTGATAAAAACAGGAGGAAGAGCTGTCAGGCC
TGCCGGCTACGCAAGTGCTATGAAGTGGGCATGATGAAAGGCGGAATACGGAAAGACCGA
AGAGGAGGGAGAATGTTGAAGCACAAGCGCCAGAGAGATGATGGGGAGGGCAGGAACGAA
GCGGTGCCCTCCGGAGACATGAGAGCTGCCAACCTTTGGCCAAGCCCCATCATGATTAAA
CACACTAAGAAGAACAGCCCGGTGTTGTCCCTGACAGCTGACCAGATGATCAGTGCCTTG
CTGGAGGCTGAGCCCCCCATAATCTATTCTGAGTATGACCCTACCAGACCTTTCAGTGAG
GCTTCAATGATGGGCTTGCTGACCAACCTTGCAGACAGGGAGCTGGTACACATGATCAAC
TGGGCAAAGAGGGTGCCAGGATTTGTGGATCTGGCCCTCCATGATCAAGTCCACCTTTTG
GAATGTGCCTGGCTAGAGATCCTCATGATTGGTCTTGTCTGGCGCTCCATGGAGCATCCA
GGGAAGCTCCTATTTGCTCCTAACCTTCTCCTGGACAGGAACCAGGGAAAATGTGTGGAA
GGCATGGTGGAGATCTTTGACATGTTGCTGGCTACTTCGTCTCGGTTCCGTATGATGAAT
CTCCAGGGAGAAGAGTTTGTGTGCCTCAAATCCATCATCTTGCTTAATTCTGGAGTGTAC
ACATTTCTGTCCAGCACTCTGAGGTCTCTGGAAGAGAAGGACCACATCCACCGCGTCCTG
GACAAGATCACAGACACCTTGATCCATCTGATGGCCAAAGCAGGCCTGACTCTGCAGCAG
CAGCACCGGCGTCTGGCCCAACTCCTCCTCATCCTCTCTCACTTCAGGCACATGAGCAAC
AAAGGCATGGAGCATCTATACAGCATGAAGTGCAAGAACGTGGTGCCTCTCTACGACCTG
CTGCTGGAGATGCTGGATGCCCACCGCCTGCACGCCCCAGCCAACTTTGGGAGCGCACCT
CCAGAGGACGTGAATCAGAGCCAGCTGGCCCCCACTGGCTGCACTTCATCGCATTCCTTG
CAAACATATTACATCACTGGGGAGGCAGAGAATTTCCCCAGCACAGTCTGA
Enzyme 3 GenBank Gene ID AY538775 Link Image
Enzyme 3 GeneCard ID ESR1 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:6
Enzyme 3 Locus 6q25.1
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 2170
Enzyme 4 Name Calcium-activated potassium channel subunit beta-1
Enzyme 4 Synonyms
  1. Calcium-activated potassium channel, subfamily M subunit beta-1
  2. Calcium-activated potassium channel subunit beta
  3. Maxi K channel subunit beta-1
  4. BK channel subunit beta-1
  5. BKbeta1
  6. BKbeta
  7. K(VCA)beta-1
  8. Slo-beta-1
  9. Slo-beta
  10. Charybdotoxin receptor subunit beta-1
Enzyme 4 Gene Name KCNMB1
Enzyme 4 Protein Sequence >Calcium-activated potassium channel subunit beta-1
MGKKLVMAQRRGETRALCLGVAMVVGAVITYYILGTTVLPLYQKSVWTQESTCHLIETNI
RDQEELEGKRVPQYPCLWVNVSSVGRWAVLYHTEDTRDQNHQCSYIPSSLDNYQVARADV
EKVRARFHENQDFFCFSTTRENETSVLYRRLYGPQSLLFSLFWPTFLLTGGLLIIVMVKI
NQSLSILAAQR
Enzyme 4 Number of Residues 191
Enzyme 4 Molecular Weight 21957.2
Enzyme 4 Theoretical pI 8.46
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in potassium ion transport
Enzyme 4 Specific Function Regulatory subunit of the calcium activated potassium KCNMA1 (maxiK) channel. Modulates the calcium sensitivity and gating kinetics of KCNMA1, thereby contributing to KCNMA1 channel diversity. Increases the apparent Ca(2+)/voltage sensitivity of the KCNMA1 channel. It also modifies KCNMA1 channel kinetics and alters its pharmacological properties. It slows down the activation and the deactivation kinetics of the channel. Acts as a negative regulator of smooth muscle contraction by enhancing the calcium sensitivity to KCNMA1. Its presence is also a requirement for internal binding of the KCNMA1 channel opener dehydrosoyasaponin I (DHS-1) triterpene glycoside and for external binding of the agonist hormone 17-beta-estradiol (E2). Increases the binding activity of charybdotoxin (CTX) toxin to KCNMA1 peptide blocker by increasing the CTX association rate and decreasing the dissociation rate
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • 19-39 158-178
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 508846 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q28067 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name KCMB1_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >576 bp
ATGGGAAAGAAGCTGGTGATGGCCCAGAGGCGGGGAGAGACTCGGGCCCTCTGCCTGGGG
GTGGCCATGGTCGTGGGCGCCGTCATCACCTACTACATCTTAGGCACAACTGTGCTGCCC
CTCTATCAGAAGAGTGTGTGGACCCAGGAATCCACGTGTCACCTGATTGAGACCAACATC
AGGGACCAGGAGGAGCTGGAGGGCAAGAGGGTGCCCCAGTACCCATGCCTGTGGGTCAAC
GTGTCGTCCGTGGGCCGCTGGGCTGTGCTGTACCACACGGAGGACACGCGGGACCAGAAC
CACCAGTGCTCCTACATCCCAAGCAGCCTGGACAACTACCAAGTGGCCCGGGCCGACGTG
GAGAAGGTCAGAGCCAGGTTCCACGAGAACCAGGATTTCTTCTGCTTCTCCACGACTCGG
GAGAATGAGACCAGCGTCCTGTACCGGCGCCTCTATGGGCCCCAGAGCCTCCTCTTCTCT
CTCTTCTGGCCCACCTTTCTGCTGACTGGCGGCCTGCTCATCATTGTCATGGTGAAGATC
AACCAGTCCCTGTCCATCCTGGCGGCCCAGAGGTAG
Enzyme 4 GenBank Gene ID L26101 Link Image
Enzyme 4 GeneCard ID KCNMB1 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:5
Enzyme 4 Locus 5q34
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available