We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for D-Galactose (BMDB00143)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-05 20:57:42
Accession Number BMDB00143
Common Name D-Galactose
Description D-Galactose is an aldohexose that occurs naturally in the D-form in lactose, cerebrosides, gangliosides, and mucoproteins. D-Galactose is an energy-providing nutrient and also a necessary basic substrate for the biosynthesis of many macromolecules in the body. Metabolic pathways for D-Galactose are important not only for the provision of these pathways but also for the prevention of D-Galactose and D-Galactose metabolite accumulation. The main source of D-Galactose is lactose in the milk of mammals, but it can also be found in some fruits and vegetables. Utilization of D-Galactose in all living cells is initiated by the phosphorylation of the hexose by the enzyme galactokinase (E.C. 2.7.1.6) (GALK) to form D-Galactose-1-phosphate. In the presence of D-Galactose-1-phosphate uridyltransferase (E.C. 2.7.7.12) (GALT) D-Galactose-1-phosphate is exchanged with glucose-1-phosphate in UDP-glucose to form UDP-galactose. Glucose-1-phosphate will then enter the glycolytic pathway for energy production. Deficiency of the enzyme GALT in galactosemic patients leads to the accumulation of D-Galactose-1-phosphate. Classic galactosemia-a term that denotes the presence of D-Galactose in the blood is the rare inborn error of D-Galactose metabolism, diagnosed by the deficiency of the second enzyme of the D-Galactose assimilation pathway, GALT, which, in turn, is caused by mutations at the GALT gene. (PMID: 15256214, 11020650, 10408771)
Synonyms
  1. (+)-Galactose
  2. D-(+)-Galactose
  3. D-Galactose
  4. Alpha-d-galactopyranose
  5. Alpha d-galactose
  6. GLA
  7. GAL
  8. Hexose
  9. Alpha-d-galactose
  10. Galactose
  11. GLC
  12. 5abp
  13. 8abp
  14. Galactose (NF)
Chemical IUPAC Name alpha-D-galactopyranose
Chemical Formula C6H12O6
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Carbohydrates and Carbohydrate conjugates
Class
  • Carbohydrates
Sub Class
  • Monosaccharides
Family
  • Mammalian_Metabolite
Species
  • hemiacetal; primary alcohol; secondary alcohol; 1,2-diol; heterocyclic compound
Biofunction
  • Component of Galactose metabolism; Component of Glycerolipid metabolism; Component of Glycosphingolipid metabolism
Application
Source
  • Endogenous
Average Molecular Weight 180.156
Monoisotopic Molecular Weight 180.063385
Isomeric SMILES OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O
Canonical SMILES OCC1OC(O)C(O)C(O)C1O
KEGG Compound ID C00124 Link Image
BioCyc ID GALACTOSE Link Image
BiGG ID 33945 Link Image
Wikipedia Link Hexose Link Image
METLIN ID 134 Link Image
PubChem Compound 439357 Link Image
PubChem Substance 837254 Link Image
ChEBI ID 28061 Link Image
CAS Registry Number 59-23-4
InChI Identifier InChI=1/C6H12O6/c7-1-2-3(8)4(9)5(10)6(11)12-2/h2-11H,1H2/t2-,3+,4+,5-,6+/m1/s1
Synthesis Reference Avigad, Gad. Synthesis of D-galactose-6-t and D-galactosides-6-t. Carbohydrate Research (1967), 3(4), 430-4.
Melting Point (Experimental) 170 oC
Experimental Water Solubility 683.0 mg/mL [YALKOWSKY,SH & DANNENFELSER,RM (1992)] Source: PhysProp
Predicted Water Solubility 782.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -2.57 [Predicted by ALOGPS]; -2.43 [MEYLAN,WM & HOWARD,PH (1995)]; -2.3 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Show Image
Show Peaklist
BMRB Spectrum Show Image
Show Peaklist
Cellular Location
  • Cytoplasm (Predicted from LogP)
  • Extracellular
  • lysosome
Biofluid Location
  • Breast_Milk
  • Rumen
Tissue Location
Tissue References
Brain
Liver
Concentrations (Normal)
Biofluid Breast_Milk
Value 443 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw.
References
Biofluid Breast_Milk
Value 1110.149 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, fluid, partly skimmed, 2% milkfat.
References
Biofluid Breast_Milk
Value 67719.0879 +/- 8881.192 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. 0-2 days before parturition.
References
Biofluid Breast_Milk
Value 1200 - 1760 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. skim.
References
Biofluid Breast_Milk
Value 626 +/- 60 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 2% milk
References
Biofluid Breast_Milk
Value 549 +/- 72 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in skim milk
References
Biofluid Breast_Milk
Value 619 +/- 46 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 1% milk
References
Biofluid Breast_Milk
Value 616 +/- 100 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 3.25% milk
References
Biofluid Breast_Milk
Value NA NA
Age NA
Sex NA
Condition Normal
Comments Detected but not quantified in conventional whole milk
References
Biofluid Rumen
Value 763.813 +/- 751.731 uM
Age N/A
Sex N/A
Condition Normal
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Biofluid Rumen
Value 2415.813 +/- 1248.434 uM
Age N/A
Sex N/A
Condition Rumen acidosis
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names
  • Galactose Metabolism
HMDB Pathways
Name Galactose Metabolism
Image Show Link Image
KEGG Pathways
Name Galactose Metabolism
Image Show Link Image
SimCell Pathways
Name Galactose Metabolism
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Galactokinase
  2. Collectin-12
  3. Collectin-43
  4. Apolipoprotein C-III
Enzyme 1 [top]
Enzyme 1 ID 538
Enzyme 1 Name Galactokinase
Enzyme 1 Synonyms
  1. Galactose kinase
Enzyme 1 Gene Name GALK1
Enzyme 1 Protein Sequence >Galactokinase
MAASEQPQAGELLAKARRAFLEEFGAEPELAVSAPGRVNLIGEHTDYNRGLVLPMALELV
TVLVGSPRVDGLVSLLTTSEDADEPRRLQFPLPTSQRPLEPGTPHWANYVKGVIQHYPAA
PLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQRAEHSFAGV
PCGIMDQLIALLGQRGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLGSSEYPLRR
RQCEEVARALGKESLREVQLEELEAGRDLMSTEAFRRARHVVGEIQRTAQAAAALRRGDY
RAFGRLMVESHHSLRDDYEVSCPELDQLVEAALSAPGVYGSRMTGGGFGGCTVTLLEASA
APRVMQHIQEQYHGTATFYLSQAADGAKVLHF
Enzyme 1 Number of Residues 392
Enzyme 1 Molecular Weight 42226.5
Enzyme 1 Theoretical pI 6.09
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Carbohydrate transport and metabolism
Enzyme 1 Specific Function Major enzyme for galactose metabolism
Enzyme 1 Pathways
  • Carbohydrate metabolism
  • galactose metabolism
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 148878469 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID A6H768 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name GALK1_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1179 bp
ATGGCCGCTTCGGAGCAGCCCCAGGCCGGGGAGCTGCTGGCCAAGGCCCGGAGAGCCTTC
CTGGAGGAGTTCGGAGCTGAGCCCGAGCTAGCCGTGTCGGCCCCGGGCCGCGTCAACCTC
ATCGGGGAACACACGGACTACAACCGGGGCCTGGTGTTGCCCATGGCCCTGGAGCTTGTG
ACAGTGCTGGTGGGCAGCCCCCGCGTGGATGGGCTTGTTTCCCTCCTCACTACCTCTGAG
GATGCTGATGAGCCCCGGCGGCTGCAGTTTCCTCTGCCCACAAGCCAGCGGCCACTGGAG
CCTGGGACCCCTCACTGGGCCAACTATGTCAAGGGAGTGATTCAGCACTACCCAGCTGCC
CCCCTCCCTGGCTTCAGCGCAGTGGTGGTCAGCTCTGTGCCCCTGGGGGATGGGCTGTCC
AGCTCGGCGTCCCTGGAAGTGGCCACGTATACTTTCCTACAGCAGCTCTGCCCAGACTCG
GGGACAATAGCTGCCCGGGCCCAGGTGTGTCAGCGGGCCGAGCACAGCTTCGCAGGGGTG
CCCTGTGGCATCATGGACCAGCTCATCGCACTGCTGGGGCAGAGAGGCCACGCGCTGCTC
ATTGACTGCAGGTCCCTGGAGACAAGCCTGGTGCCGCTGTCGGACCCCAAGCTGGCCGTG
CTCATCACCAACTCCAACGTTCGCCATTCCCTGGGCTCCAGCGAGTATCCCCTGCGGCGG
CGCCAGTGTGAAGAGGTGGCCCGGGCGCTGGGCAAGGAGAGCCTTCGGGAGGTACAGCTG
GAGGAGCTGGAGGCTGGCCGGGACCTGATGAGCACGGAGGCCTTCCGGCGGGCGCGGCAC
GTGGTGGGCGAGATCCAGCGAACGGCCCAGGCGGCGGCCGCCCTGCGCCGCGGCGACTAC
AGAGCCTTCGGCCGCCTCATGGTGGAGAGTCACCACTCGCTCAGAGACGACTATGAGGTG
AGCTGCCCGGAGCTGGATCAGCTGGTGGAGGCCGCGCTCTCTGCTCCTGGGGTTTACGGC
AGCCGCATGACAGGCGGTGGCTTCGGGGGCTGCACGGTGACCCTGCTGGAGGCCTCTGCC
GCTCCTCGGGTGATGCAGCACATCCAGGAGCAGTACCATGGGACGGCCACCTTCTACCTC
TCCCAGGCGGCTGATGGCGCCAAGGTGCTGCACTTCTGA
Enzyme 1 GenBank Gene ID BC146132 Link Image
Enzyme 1 GeneCard ID GALK1 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 17q24
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 1616
Enzyme 2 Name Collectin-12
Enzyme 2 Synonyms
  1. Collectin placenta protein 1
  2. CL-P1
Enzyme 2 Gene Name COLEC12
Enzyme 2 Protein Sequence >Collectin-12
MKDDFAEEEEVHSFGYKRFGIQEGTQCTKCKNNWALKLSIILLYILCALLTITVAILGYK
VVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKALSTNSELSTFRSDILDLRQ
QLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTN
LQQDTSVLQGNLQSQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKND
FQNLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANNDTLEDMNSQLSSFTGQMDNI
TTASQANEQNLKDLQDVHRDAENRTAAKFSQLEERFQLFESDIVNIISNISYTAHYLRTL
TSNLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLRMQQDLMRSRLDTEVANLSVI
MEEMKLVDSKHGQLIKNFTILQGPPGPRGPKGDRGQQGPPGPTGNKGQKGEKGEPGPPGP
AGERGPIGPVGPPGERGSKGSKGLQGSKGSRGSPGKPGPQGPSGDPGPPGPPGKDGLPGP
QGPPGFQGLQGTVGEPGVPGPRGLPGLPGMPGMPGIKGPPGPPGPSGAAVPLALKTEPTT
APEDNGCLPYWKNFTDKCYYFSTERDFFEDAKLFCERMSSHLVFINTGEEQQWIKNQMVA
KQNYWIGLTDLEQENEWRWLDGTLLEYKNWKAGQPDNWGHGHGPGEDCAGLINFGQWNDF
PCEDMNHFICEKDRERELAITL
Enzyme 2 Number of Residues 742
Enzyme 2 Molecular Weight 81750.2
Enzyme 2 Theoretical pI 5.29
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Secondary metabolites biosynthesis, transport and catabolism
Enzyme 2 Specific Function Scavenger receptor that displays several functions associated with host defense. Promotes binding and phagocytosis of Gram-positive, Gram-negative bacteria and yeast. Mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. Binds to several carbohydrates including Gal-type ligands, D-galactose, L- and D-fucose, GalNAc, T and Tn antigens in a calcium-dependent manner and internalizes specifically GalNAc in nurse-like cells. Binds also to sialyl Lewis X or a trisaccharide and asialo-orosomucoid (ASOR)
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • 38-58
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 151555746 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID A6QP79 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name COL12_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >2229 bp
ATGAAAGACGATTTTGCAGAGGAGGAGGAGGTACATTCCTTCGGTTACAAGCGGTTTGGT
ATTCAAGAAGGAACACAATGTACCAAATGTAAAAATAATTGGGCACTGAAGCTTTCTATC
ATACTGTTATACATTTTGTGTGCCTTGCTTACCATCACAGTAGCCATTTTGGGATACAAA
GTTGTAGAGAAAATGGACAATGTTACAGGTGGCATGGAGACATCTCGCCAAACCTATGAT
GACAAGCTCACAGCAGTGGAAAGCGACCTGAAAAAATTAGGGGACCAAACAGGAAAGAAA
GCGCTCAGCACCAACTCAGAACTCTCCACCTTCAGGTCGGACATCCTGGATCTCCGTCAG
CAACTTCGTGAGATCACAGAAAAGACCAGCAAGAACAAAGATACGCTGGAGAAGTTACAG
GCAAGCGGGGACGCGCTGGTGGACCGGCAGAGCCAACTGAAGGAAACTTTGGAGAATAAC
TCCTTCCTCATCACCACTGTCAACAAAACCCTGCAGGCGTATAACGGCTACGTCACGAAT
CTTCAGCAGGACACAAGCGTGCTGCAGGGCAACCTGCAGAGCCAAATGTACTCTCACAAC
GTGGTCATCATGAACCTCAACAATCTGAACCTAACCCAGGTGCAGCAGAGGAACCTCATC
ACGAATCTGCAGCGCTCCGTGGATGACACGAGCCAGGCGATCCAGCGCATCAAGAACGAC
TTCCAGAACCTACAGCAGGTCTTCCTTCAAGCCAAGAAGGACACGGACTGGCTGAAGGAG
AAGGTGCAGAGCCTGCAGACGCTGGCTGCCAATAACTCCGCCTTGGCCAAAGCCAACAAC
GACACCCTGGAGGACATGAACAGCCAGCTCAGCTCCTTCACAGGGCAGATGGACAATATC
ACCACAGCCTCCCAAGCCAACGAGCAGAACCTGAAGGACCTGCAGGACGTACACAGGGAT
GCGGAGAACAGAACGGCGGCCAAATTCAGCCAACTCGAGGAGCGCTTCCAGCTCTTTGAG
TCAGACATTGTGAACATCATCAGCAATATCAGCTACACAGCCCACTACCTGCGGACGCTG
ACCAGCAACCTGAACGAAGTCAGGACCACGTGCACAGACACACTGACCAAACACACGGAC
GATCTGACCTCCCTGAACAACACGCTGGCCAACATCCGTTTGGATTCTGTTTCTCTCAGG
ATGCAGCAAGATTTGATGAGGTCGAGGTTGGACACGGAAGTGGCCAACTTGTCAGTGATT
ATGGAAGAAATGAAGCTGGTAGACTCCAAGCATGGTCAGCTCATCAAGAATTTTACCATC
CTGCAAGGTCCTCCTGGCCCCAGGGGTCCAAAAGGTGACCGAGGACAGCAGGGACCCCCA
GGCCCCACCGGCAACAAGGGGCAGAAAGGAGAGAAGGGGGAGCCGGGCCCGCCTGGCCCA
GCCGGTGAGAGGGGCCCAATCGGGCCGGTCGGCCCCCCTGGAGAGCGCGGCAGCAAAGGC
TCCAAAGGCCTGCAAGGCTCCAAAGGCTCCCGAGGGTCTCCTGGGAAGCCCGGCCCCCAG
GGCCCCAGCGGGGACCCAGGCCCCCCCGGCCCGCCGGGCAAGGATGGACTCCCAGGCCCT
CAGGGCCCCCCCGGCTTCCAGGGACTGCAGGGCACCGTGGGGGAGCCTGGGGTGCCCGGG
CCACGGGGGCTGCCAGGCCTCCCTGGGATGCCGGGCATGCCAGGTATCAAGGGTCCCCCT
GGTCCCCCGGGCCCCTCAGGGGCGGCAGTGCCCCTGGCCCTTAAGACTGAGCCGACCACA
GCACCTGAGGACAACGGCTGCCTGCCTTACTGGAAGAACTTCACAGACAAATGCTACTAT
TTTTCAACTGAGAGAGACTTTTTTGAGGATGCAAAACTTTTCTGCGAAAGAATGTCTTCA
CATCTCGTTTTCATAAACACGGGAGAGGAGCAGCAATGGATCAAAAACCAGATGGTGGCG
AAACAGAACTACTGGATTGGCCTCACGGACTTGGAGCAGGAGAATGAATGGAGGTGGCTG
GATGGGACACTTCTGGAGTACAAAAATTGGAAAGCTGGACAGCCAGATAACTGGGGTCAT
GGCCACGGGCCTGGAGAAGATTGCGCTGGACTGATTAATTTTGGGCAGTGGAACGATTTC
CCATGTGAAGACATGAATCACTTCATCTGCGAGAAAGACAGGGAGAGAGAATTAGCAATT
ACATTATAA
Enzyme 2 GenBank Gene ID BC149193 Link Image
Enzyme 2 GeneCard ID COLEC12 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 18pter-p11.3
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 1617
Enzyme 3 Name Collectin-43
Enzyme 3 Synonyms
  1. 43 kDa collectin
  2. CL-43
Enzyme 3 Gene Name CL43
Enzyme 3 Protein Sequence >Collectin-43
MLPLPLSILLLLTQSQSFLGEEMDVYSEKTLTDPCTLVVCAPPADSLRGHDGRDGKEGPQ
GEKGDPGPPGMPGPAGREGPSGRQGSMGPPGTPGPKGEPGPEGGVGAPGMPGSPGPAGLK
GERGTPGPGGAIGPQGPSGAMGPPGLKGDRGDPGEKGARGETSVLEVDTLRQRMRNLEGE
VQRLQNIVTQYRKAVLFPDGQAVGEKIFKTAGAVKSYSDAEQLCREAKGQLASPRSSAEN
EAVTQLVRAKNKHAYLSMNDISKEGKFTYPTGGSLDYSNWAPGEPNNRAKDEGPENCLEI
YSDGNWNDIECREERLVICEF
Enzyme 3 Number of Residues 321
Enzyme 3 Molecular Weight 33615.3
Enzyme 3 Theoretical pI 4.76
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Carbohydrate transport and metabolism
Enzyme 3 Specific Function Lectin that binds to various sugars:mannose = ManNAc > fucose > GlcNAc > glucose = maltose > galactose > lactose > galNAc. Could play a role in immune defense
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • 1-20
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 18252109 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID P42916 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name CL43_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >966 bp
ATGCTTCCCCTCCCTCTCTCCATATTGCTCCTGCTCACACAGTCCCAGAGTTTCCTGGGC
GAAGAAATGGATGTCTATTCTGAGAAAACCCTCACCGATCCCTGCACCCTGGTTGTGTGT
GCTCCACCAGCAGATAGCCTTCGTGGTCATGATGGACGAGATGGGAAAGAAGGCCCCCAG
GGAGAGAAGGGGGATCCAGGGCCTCCAGGTATGCCTGGACCAGCTGGAAGAGAGGGCCCC
TCAGGGAGGCAGGGGAGCATGGGACCTCCAGGCACACCAGGCCCCAAAGGAGAACCTGGG
CCCGAAGGAGGAGTGGGTGCCCCAGGCATGCCCGGCTCCCCAGGCCCCGCAGGTCTCAAA
GGAGAGAGAGGTACCCCTGGGCCTGGTGGAGCCATCGGTCCACAGGGACCTTCAGGTGCC
ATGGGTCCCCCAGGACTGAAGGGAGACAGAGGTGATCCTGGAGAAAAAGGAGCAAGGGGG
GAGACTTCAGTCCTAGAGGTTGATACTCTAAGGCAGCGGATGAGAAACTTAGAGGGAGAA
GTTCAACGCCTCCAGAACATAGTCACTCAGTACAGGAAAGCGGTGCTCTTCCCTGATGGC
CAGGCTGTCGGGGAGAAGATCTTCAAGACGGCAGGTGCTGTAAAGTCATATTCGGATGCA
GAGCAGCTCTGCAGAGAGGCTAAGGGACAGCTGGCCTCCCCACGCTCTTCAGCCGAGAAC
GAGGCCGTGACACAGCTGGTCAGAGCCAAGAACAAGCATGCTTACCTGAGCATGAATGAC
ATCTCCAAAGAGGGCAAGTTCACCTACCCAACGGGGGGGTCACTGGACTATTCCAACTGG
GCCCCCGGGGAGCCCAACAATAGGGCAAAAGACGAAGGCCCAGAGAACTGTCTTGAGATC
TATTCCGATGGCAATTGGAATGACATAGAATGCAGGGAGGAGCGCCTCGTGATCTGTGAG
TTCTGA
Enzyme 3 GenBank Gene ID AY071821 Link Image
Enzyme 3 GeneCard ID CL43 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Not Available
Enzyme 3 Locus Not Available
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 1618
Enzyme 4 Name Apolipoprotein C-III
Enzyme 4 Synonyms
  1. Apo-CIII
  2. ApoC-III
Enzyme 4 Gene Name APOC3
Enzyme 4 Protein Sequence >Apolipoprotein C-III
MQPRLLLLAAFLALLVLPEATKAEEGSLLDKMQGYVKEATKTAKDALSSVQESQVAQQAR
DWMTESFSSLKDYWSSFKGKFTDFWESATSPTQSPP
Enzyme 4 Number of Residues 96
Enzyme 4 Molecular Weight 10692.0
Enzyme 4 Theoretical pI 4.74
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in lipid binding
Enzyme 4 Specific Function Inhibits lipoprotein lipase and hepatic lipase and decreases the uptake of lymph chylomicrons by hepatic cells. This suggests that it delays the catabolism of triglyceride-rich particles
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • 1-23
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 46359698 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID P19035 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name APOC3_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >291 bp
ATGCAGCCCCGGCTGCTCCTTCTTGCTGCCTTCCTGGCGCTCCTGGTCTTGCCTGAAGCT
ACCAAGGCCGAGGAGGGATCCCTTCTGGACAAGATGCAGGGCTATGTGAAGGAGGCCACC
AAGACCGCCAAGGATGCCCTGAGCAGCGTTCAGGAGTCCCAGGTGGCCCAGCAGGCCAGA
GACTGGATGACTGAGAGCTTCAGCTCCCTGAAAGACTACTGGAGCTCGTTCAAGGGCAAG
TTCACTGACTTCTGGGAATCTGCCACCAGTCCCACACAGTCTCCACCCTGA
Enzyme 4 GenBank Gene ID AB126687 Link Image
Enzyme 4 GeneCard ID APOC3 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 11q23.1-q23.2
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available