We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for D-Glucuronic acid (BMDB00127)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-29 15:46:35
Accession Number BMDB00127
Common Name D-Glucuronic acid
Description Glucuronic acid is a carboxylic acid that has the structure of a glucose molecule that has had its sixth carbon atom (of six total) oxidized. The salts of glucuronic acid are known as glucuronates. Glucuronic acid is highly soluble in water. In the animal body, glucuronic acid is often linked to poisonous substances to allow for subsequent elimination, and to hormones to allow for easier transport. These linkages involve O-glycosidic bonds. The process is known as glucuronidation, and the resulting substances are known as glucuronides (or glucuronosides). Glucuronidation uses UDP-glucuronic acid (glucuronic acid linked via a glycosidic bond to uridine diphosphate) as an intermediate. UDP-glucuronic acid is formed in the liver of all animals.
Synonyms
  1. D-(+)-glucuronate
  2. D-(+)-glucuronic acid
  3. D-glucuronate
  4. GCU
  5. Glucosiduronate
  6. Glucosiduronic acid
  7. Glucuronate
  8. Glucuronic acid
  9. alpha-D-glucopyranuronic acid
  10. alpha-D-glucuronic acid
  11. delta-(+)-glucuronate
  12. delta-(+)-glucuronic acid
  13. delta-glucuronate
  14. alpha-delta-glucopyranuronic acid
  15. alpha-delta-glucuronic acid
Chemical IUPAC Name (2S,3S,4S,5R,6S)-3,4,5,6-tetrahydroxyoxane-2-carboxylic acid
Chemical Formula C6H10O7
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Carbohydrates and Carbohydrate conjugates
Class
  • Carbohydrates
Sub Class
  • Monosaccharides
Family
  • Mammalian_Metabolite
Species
  • hemiacetal; secondary alcohol; 1,2-diol; carboxylic acid; heterocyclic compound
Biofunction
  • Component of Chondroitin / Heparan sulfate biosynthesis; Component of Inositol phosphate metabolism; Component of Porphyrin and chlorophyll metabolism; Component of Starch and sucrose metabolism
Application
Source
  • Endogenous
Average Molecular Weight 194.139
Monoisotopic Molecular Weight 194.042648
Isomeric SMILES O[C@H]1O[C@@H]([C@@H](O)[C@H](O)[C@H]1O)C(O)=O
Canonical SMILES OC1OC(C(O)C(O)C1O)C(O)=O
KEGG Compound ID C00191 Link Image
BioCyc ID GLUCURONATE Link Image
BiGG ID 34196 Link Image
Wikipedia Link GCU Link Image
METLIN ID 161 Link Image
PubChem Compound 444791 Link Image
PubChem Substance 10299584 Link Image
ChEBI ID 35182; 42717 Link Image
CAS Registry Number 6556-12-3
InChI Identifier InChI=1/C6H10O7/c7-1-2(8)4(5(10)11)13-6(12)3(1)9/h1-4,6-9,12H,(H,10,11)/t1-,2-,3+,4-,6-/m0/s1
Synthesis Reference Hamayasu, Kenichi; Tadokoro, Hiroki; Kishino, Eriko; Ito, Tetsuya; Fujita, Koki; Hara, Kozo. Preparation of glucuronic acid and/or glucuronolactone from sucrose. PCT Int. Appl. (2006), 21pp.
Melting Point (Experimental) 143-144 oC
Experimental Water Solubility 485 mg/mL [HMP experimental] Source: PhysProp
Predicted Water Solubility 1000 mg/mL at 25 oC [MEYLAN,WM et al. (1996)]; 295.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -1
State Solid
Experimental LogP/Hydrophobicity -2.57 [HANSCH,C ET AL. (1995)] Source: PhysProp
Predicted LogP/Hydrophobicity -2 [Predicted by PubChem via XLOGP]; -2.30 [Predicted by ALOGPS] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
  • endoplasmic reticulum
  • lysosome
Biofluid Location Not Available
Tissue Location
Tissue References
Liver
Concentrations (Normal)
Biofluid Breast_Milk
Value NA NA
Age NA
Sex NA
Condition Normal
Comments Detected but not quantified in conventional whole milk
References
Concentrations (Abnormal) Not Available
Pathway Names
  • Inositol Metabolism
  • Starch and Sucrose Metabolism
HMDB Pathways
Name Inositol Metabolism
Image Show Link Image
Name Starch and Sucrose Metabolism
Image Show Link Image
KEGG Pathways
Name Inositol Metabolism
Image Show Link Image
Name Starch and Sucrose Metabolism
Image Show Link Image
SimCell Pathways
Name Inositol Metabolism
Image Show Link Image
Graph
SBML
Name Starch and Sucrose Metabolism
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Dermatan-sulfate epimerase
  2. Hyaluronidase-2
  3. Hyaluronidase-1
  4. Inositol oxygenase
Enzyme 1 [top]
Enzyme 1 ID 373
Enzyme 1 Name Dermatan-sulfate epimerase
Enzyme 1 Synonyms
  1. DS epimerase
  2. Chondroitin-glucuronate 5-epimerase
Enzyme 1 Gene Name DSE
Enzyme 1 Protein Sequence >Dermatan-sulfate epimerase
MRTHTRGAPSVFFICLFCFVSACVTDENPEVMIPFTNANYDSHPMLYFSRAEVAELQLRA
ASSHEHIAARLTEAVNTMLSSPLEYLPPWDPKEYSARWNEIYGNNLGALAMFCVLYPENM
EARDMAKDYMERMAAQPSWLVKDAPWDEVPLAHSLVGFATAYDFLYNYLSKTQQEKFLEV
IANASGYMYETSYRRGWGFQYLHNHQPTNCMALLTGSLVLMNQGYLQEAYLWTKQVLTIM
EKSLVLLREVTDGSLYEGVAYGSYTTRSLFQYMFLVQRHFDINHFGHPWLKQHFAFMYRT
ILPGFQRTVAIADSNYNWFYGPESQLVFLDKFVMRNGSGNWLADQIRRNRVVEGPGTPSK
GQRWCTLHTEFLWYDASLKSVPPPDFGTPTLHYFEDWGVVTYGSALPAEINRSFLSFKSG
KLGGRAIYDIVHRNKYKDWIKGWRNFNAGHEHPDQNSFTFAPNGVPFITEALYGPKYTFF
NNVLMFSPAASKSCFSPWEGQVTEDCSSKWSKYKHDPAASCQGRVVAAVEKNGVVFIRGE
GVGAYNPQLHLRNVQRNLILLHPQLLLLVDQIHLGEDSPLERAASFFHNVDFPFEETVVD
GVHGALIRQRDGLYKMYWMDDTGYSEKGTFASVTYPRGYPYNGTNYVNVTTHLRSPVTRA
AYLFIGPSIDVQSFSIHGDAQQLDVFVATSEHAYATYLWTGETAGQSAFAQVIADRQKIL
FDRSSAIRSSVVPEVKDYAALVEQNLQHFKPVFQLLEKQILSRVRNTASFRKTAERLLRF
SDKRQTEEAIDRIFAISQQQQQQQSKSKKNRRGGKRYKFVDAVPDIFAQIEVNERKVRQK
AQILAQKELPVDEDEEMKDLLDFADITYEKHKNGDVMNGRFGQARMVTTHSRAPALSASY
TRLFLILNIAIFFVMLAMQLTYFQRAQSLHGQRCLYAVLLIDSCILLWLYSSCSQSQC
Enzyme 1 Number of Residues 958
Enzyme 1 Molecular Weight 109723.9
Enzyme 1 Theoretical pI 7.65
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Involved in chondroitin-glucuronate 5-epimerase activity
Enzyme 1 Specific Function Converts D-glucuronic acid to L-iduronic acid (IdoUA) residues
Enzyme 1 Pathways
  • Glycan metabolism
  • heparan sulfate biosynthesis
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function Not Available
Enzyme 1 Signals
  • 1-22
Enzyme 1 Transmembrane Regions
  • 903-923 934-954
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein Not Available
Enzyme 1 UniProtKB/Swiss-Prot ID P0C2H4 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name DSE_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence Not Available
Enzyme 1 GenBank Gene ID Not Available
Enzyme 1 GeneCard ID DSE Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:6
Enzyme 1 Locus 6q22
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 424
Enzyme 2 Name Hyaluronidase-2
Enzyme 2 Synonyms
  1. Hyal-2
  2. Hyaluronoglucosaminidase-2
Enzyme 2 Gene Name HYAL2
Enzyme 2 Protein Sequence >Hyaluronidase-2
MWTGLGPAVTLALVLVVAWATELKPTAPPIFTGRPFVVAWDVPTQDCGPRHKMPLDPKDM
KAFDVQASPNEGFVNQNITIFYRDRLGMYPHFNSVGRSVHGGVPQNGSLWVHLEMLKGHV
EHYIRTQEPAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRHLVAIRHPDWPPERVAKEAQY
EFEFAARQFMLETLRFVKAFRPRHLWGFYLFPDCYNHDYVQNWETYTGRCPDVEVSRNDQ
LAWLWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPT
YSRGLTGLSEMDLISTIGESAALGAAGVILWGDAGFTTSNETCRRLKDYLTRSLVPYVVN
VSWAAQYCSWAQCHGHGRCVRRDPNAHTFLHLSASSFRLVPSHAPDEPRLRPEGELSWAD
RNHLQMHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGSHLTGLLAVAVLAFT
Enzyme 2 Number of Residues 473
Enzyme 2 Molecular Weight 53880.7
Enzyme 2 Theoretical pI 7.66
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Involved in hyalurononglucosaminidase activity
Enzyme 2 Specific Function Hydrolyzes high molecular weight hyaluronic acid to produce an intermediate-sized product which is further hydrolyzed by sperm hyaluronidase to give small oligosaccharides. Displays very low levels of activity. Associates with and negatively regulates MST1R
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • 1-20
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 18699094 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q8SQG8 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name HYAL2_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1422 bp
ATGTGGACAGGCCTGGGCCCCGCCGTCACACTGGCCCTGGTGTTGGTGGTGGCATGGGCC
ACGGAGCTGAAGCCCACAGCACCACCCATCTTCACGGGCCGGCCCTTTGTGGTCGCATGG
GATGTGCCCACACAGGACTGTGGCCCGCGCCACAAGATGCCATTGGACCCAAAGGACATG
AAGGCCTTTGATGTTCAGGCTTCACCTAACGAGGGTTTTGTAAATCAGAACATCACCATC
TTCTACCGTGACCGGCTGGGCATGTATCCACACTTCAATTCGGTGGGGAGGTCAGTACAT
GGTGGTGTGCCACAGAATGGCAGCCTCTGGGTACACCTGGAGATGCTGAAGGGACACGTG
GAACACTACATTCGTACACAGGAGCCTGCAGGGCTGGCAGTCATCGACTGGGAGGACTGG
CGGCCAGTGTGGGTGCGCAACTGGCAGGACAAGGATGTGTACCGCCGATTATCACGCCAT
TTGGTAGCCATTCGCCACCCTGATTGGCCACCAGAGCGCGTAGCCAAGGAGGCGCAGTAT
GAGTTTGAGTTCGCTGCACGGCAGTTCATGCTGGAGACATTGCGATTTGTCAAGGCGTTT
CGGCCTCGGCACCTATGGGGCTTCTACCTCTTCCCTGACTGTTACAACCATGATTATGTG
CAGAACTGGGAGACCTATACAGGCCGCTGCCCTGATGTTGAGGTCTCCCGAAATGACCAG
CTGGCCTGGCTCTGGGCCGAGAGCACGGCCCTCTTCCCCTCTGTCTACTTGGAAGAGACA
CTGGCTTCCTCCACTCACGGCCGCAACTTTGTCAGCTTTCGTGTCCAGGAGGCTCTTCGC
GTGGCTGACGTCCACCATGCCAACCATGCACTCCCCGTCTACGTCTTCACGAGGCCCACC
TATAGCCGTGGACTCACAGGGCTTAGCGAGATGGATCTCATCTCCACCATTGGTGAGAGT
GCTGCCCTGGGTGCAGCTGGCGTCATCCTCTGGGGTGACGCAGGGTTTACCACCAGCAAC
GAGACCTGCCGACGCCTCAAGGATTATCTGACTCGGTCATTGGTACCCTATGTCGTCAAT
GTGTCCTGGGCTGCCCAGTACTGCAGCTGGGCCCAGTGCCATGGCCATGGGCGCTGTGTG
CGCCGGGACCCCAACGCTCACACCTTCCTGCACCTCAGTGCCAGCAGCTTCCGTCTAGTG
CCTAGCCACGCACCTGATGAGCCGCGGCTGCGACCAGAGGGGGAACTCAGTTGGGCCGAC
CGCAACCACCTACAGATGCACTTTCGCTGCCAGTGCTACTTAGGCTGGGGCGGTGAGCAA
TGCCAGTGGGACCGCAGGCGGGCAGCTGGGGGTGCCAGTGGGGCCTGGGCTGGGTCCCAC
CTCACTGGCCTGCTGGCAGTGGCAGTCCTGGCCTTCACCTAG
Enzyme 2 GenBank Gene ID AF411973 Link Image
Enzyme 2 GeneCard ID HYAL2 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:3
Enzyme 2 Locus 3p21.3
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 425
Enzyme 3 Name Hyaluronidase-1
Enzyme 3 Synonyms
  1. Hyal-1
  2. Hyaluronoglucosaminidase-1
Enzyme 3 Gene Name HYAL1
Enzyme 3 Protein Sequence >Hyaluronidase-1
MRPFSLEVSLHLPWAMAAHLLPVCTLFLNLLSMTQGSRDPVVPNQPFTTIWNANTEWCMK
KHGVDVDISIFDVVTNPGQTFRGPNMTIFYSSQLGTYPYYTSAGEPVFGGLPQNASLNAH
LARTFQDILAAMPEPRFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQKQHPDWLAP
RVEAAAQDQFEGAAEEWMAGTLKLGQALRPQGLWGFYNFPECYNYDFKSPNYTGRCPLNI
CAQNDQLGWLWGQSRALYPSIYLPAALEGTKKTQMFVQHRVAEAFRVAAGAGDPKLPVLP
YMQLFYDMTNHFLPAEELEHSLGESAAQGAAGVVLWVSWLSTSTKESCQAIKEYVDTTLG
PSILNVTSGARLCSQVLCSGHGRCARRPSYPKARLILNSTSFSIKPTPGGGPLTLQGALS
LEDRLRMAVEFECRCYRGWRGTRCEQWGMW
Enzyme 3 Number of Residues 450
Enzyme 3 Molecular Weight 50507.3
Enzyme 3 Theoretical pI 7.84
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Involved in hyalurononglucosaminidase activity
Enzyme 3 Specific Function May have a role in promoting tumor progression. May block the TGFB1-enhanced cell growth
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • 1-35
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 59857915 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q5E985 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name HYAL1_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >762 bp
ATGGCAGGCACCCTCAAGCTGGGACAAGCACTGCGCCCTCAGGGCCTCTGGGGCTTCTAT
AATTTCCCTGAGTGCTACAACTATGACTTTAAAAGTCCCAACTATACAGGCCGGTGTCCA
CTAAACATCTGTGCCCAGAATGACCAGCTCGGGTGGCTGTGGGGCCAGAGCCGTGCCCTC
TACCCCAGCATCTACCTGCCTGCAGCACTGGAGGGCACGAAGAAGACACAGATGTTCGTG
CAGCACCGTGTGGCTGAGGCATTCCGTGTGGCAGCGGGTGCGGGGGACCCCAAGCTGCCG
GTGCTGCCCTACATGCAGCTCTTCTACGACATGACTAACCACTTTCTGCCCGCGGAGGAG
CTGGAGCACAGCCTGGGGGAGAGTGCAGCCCAGGGTGCAGCGGGAGTGGTGCTCTGGGTG
AGCTGGCTGAGCACAAGCACCAAGGAATCATGCCAGGCCATCAAGGAGTATGTGGACACG
ACGCTGGGACCCTCCATCCTGAATGTGACCAGCGGGGCTCGTCTGTGCAGTCAGGTCCTA
TGCTCCGGCCATGGCCGTTGTGCCCGGCGCCCCAGTTACCCCAAGGCCCGCCTCATCCTC
AACTCCACCAGTTTTTCCATCAAGCCTACACCTGGTGGTGGGCCCCTGACCCTACAAGGT
GCCCTCTCGCTCGAGGATCGGTTGCGGATGGCAGTGGAGTTCGAATGTCGCTGCTACCGT
GGGTGGAGGGGGACACGGTGTGAGCAGTGGGGCATGTGGTGA
Enzyme 3 GenBank Gene ID BT020775 Link Image
Enzyme 3 GeneCard ID HYAL1 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:3
Enzyme 3 Locus 3p21.3-p21.2
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 426
Enzyme 4 Name Inositol oxygenase
Enzyme 4 Synonyms
  1. Myo-inositol oxygenase
  2. MI oxygenase
Enzyme 4 Gene Name MIOX
Enzyme 4 Protein Sequence >Inositol oxygenase
MKVAADPDPSLVSQRDMEPEAAKDKDSFRNYTSGPLLDRVFATYKLMHTWQTVDFVRRKH
AQFGGFSYKRMTVMEAVDMLDGLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVG
LLHDLGKVLALAGEPQWAVVGDTFPVGCRPQASVVFRDCTFQDNPDLQDPLYSTELGMYQ
PHCGLENVLMSWGHDEYMYRMMKFNKFALPPEAFYIIRFHSFYPWHKFGDYQQLCNEQDL
AMLPWVQEFNKFDLYTKSSSLPDVAALRPYYQGLVDKYCPGILCW
Enzyme 4 Number of Residues 285
Enzyme 4 Molecular Weight 32973.3
Enzyme 4 Theoretical pI 5.15
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in inositol oxygenase activity
Enzyme 4 Specific Function Myo-inositol + O(2) = D-glucuronate + H(2)O
Enzyme 4 Pathways
  • Polyol metabolism
  • myo-inositol degradation into D- glucuronate
  • D-glucuronate from myo-inositol:step 1/1
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 154425971 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID A7MBE4 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name MIOX_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >858 bp
ATGAAGGTGGCTGCGGACCCAGACCCTTCCCTGGTCTCCCAGCGTGATATGGAGCCAGAA
GCAGCCAAAGACAAGGACAGCTTCCGAAACTACACGTCTGGCCCGCTCCTGGACCGTGTC
TTTGCCACCTACAAGCTCATGCACACATGGCAGACCGTGGACTTCGTCAGGAGGAAGCAT
GCCCAGTTCGGGGGCTTCTCCTATAAGAGGATGACTGTCATGGAGGCTGTGGACATGCTG
GACGGGCTGGTGGATGAGTCGGACCCCGACGTGGACTTCCCCAACTCCTTCCATGCCTTC
CAGACGGCTGAGGGCATCCGGAAGGCCCATCCAGACAAGGACTGGTTCCACCTCGTGGGG
CTCCTGCACGACCTGGGGAAGGTCCTGGCTCTGGCAGGGGAGCCCCAGTGGGCAGTCGTC
GGAGACACCTTCCCAGTTGGCTGCCGTCCCCAGGCCTCTGTGGTCTTCCGTGACTGCACC
TTCCAGGACAACCCTGACCTCCAGGACCCCTTGTACAGCACGGAGCTTGGCATGTACCAG
CCTCACTGTGGGCTCGAGAACGTCCTCATGTCCTGGGGTCATGACGAGTACATGTACCGG
ATGATGAAGTTCAACAAATTCGCCCTCCCACCGGAGGCCTTCTACATCATCCGGTTCCAC
TCGTTCTACCCCTGGCACAAGTTCGGCGACTACCAGCAGCTGTGCAACGAACAGGACCTG
GCCATGCTGCCCTGGGTGCAGGAGTTCAACAAGTTCGACCTCTACACCAAGAGCTCCAGC
CTGCCAGACGTGGCCGCGCTGAGGCCCTACTACCAAGGGCTCGTTGACAAGTACTGTCCT
GGCATCCTGTGCTGGTGA
Enzyme 4 GenBank Gene ID BC151511 Link Image
Enzyme 4 GeneCard ID MIOX Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:2
Enzyme 4 Locus 22q13.3
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References Not Available
Enzyme 4 Metabolite References Not Available