We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Glycerol 3-phosphate (BMDB00126)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-05 20:57:42
Accession Number BMDB00126
Common Name Glycerol 3-phosphate
Description Glycerol 3-phosphate is a chemical intermediate in the glycolysis metabolic pathway. It is commonly confused with the similarly named glycerate 3-phosphate or glyceraldehyde 3-phosphate. Glycerol 3-phosphate is produced from glycerol, the triose sugar backbone of triglycerides and glycerophospholipids, by the enzyme glycerol kinase. Glycerol 3-phospate may then be converted by dehydrogenation to dihydroxyacetone phosphate (DHAP) by the enzyme glycerol-3-phosphate dehydrogenase. DHAP can then be rearranged into glyceraldehyde 3-phosphate (GA3P) by triose phosphate isomerase (TIM), and feed into glycolysis. The glycerol 3-phosphate shuttle is used to rapidly regenerate NAD+ in brain and skeletal muscle cells of mammals (wikipedia).
Synonyms
  1. 1-(dihydrogen phosphate) Glycerol
  2. 1-Glycerophosphate
  3. 1-Glycerophosphorate
  4. 1-Glycerophosphoric acid
  5. 3-Glycerophosphate
  6. DL-Glycerol 1-phosphate
  7. DL-Glycerol 3-phosphate
  8. DL-a-Glycerol phosphate
  9. DL-a-Glycerophosphate
  10. DL-a-Glycerophosphorate
  11. DL-a-Glycerophosphoric acid
  12. DL-a-Glyceryl phosphate
  13. Glycerol 1-phosphate
  14. Glycerol a-phosphate
  15. Glycerol monophosphate
  16. Glycerophosphate
  17. Glycerophosphorate
  18. Glycerophosphoric acid
  19. Glycerophosphoric acid I
  20. Glyceryl phosphate
  21. Glyceryl phosphic acid
  22. a-Glycerophosphate
  23. a-Glycerophosphorate
  24. a-Glycerophosphoric acid
  25. a-Phosphoglycerol
  26. dihydrogen a-glycerophosphate
  27. DL-alpha-Glycerol phosphate
  28. DL-alpha-Glycerophosphate
  29. DL-alpha-Glycerophosphorate
  30. DL-alpha-Glycerophosphoric acid
  31. DL-alpha-Glyceryl phosphate
  32. alpha-Glycerophosphate
  33. alpha-Glycerophosphorate
  34. alpha-Glycerophosphoric acid
  35. alpha-Phosphoglycerol
  36. sn-Gro-1-P
  37. sn-glycerol 3-phosphate
Chemical IUPAC Name 1,2,3-Propanetriol, 1-(dihydrogen phosphate)
Chemical Formula C3H9O6P
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Miscellaneous
Class
  • Acyl Phosphates
Sub Class
  • Glycerophosphates
Family
  • Mammalian_Metabolite
Species
  • primary alcohol; secondary alcohol; 1,2-diol; phosphoric acid ester
Biofunction
  • Component of Glycerolipid metabolism; Component of Glycerophospholipid metabolism
Application
Source
  • Endogenous
Average Molecular Weight 172.074
Monoisotopic Molecular Weight 172.013672
Isomeric SMILES OC[C@@H](O)COP(O)(O)=O
Canonical SMILES OCC(O)COP(O)(O)=O
KEGG Compound ID C00093 Link Image
BioCyc ID GLYCEROL-3P Link Image
BiGG ID 137383 Link Image
Wikipedia Link Glycerol 3-phosphate Link Image
METLIN ID 5161 Link Image
PubChem Compound 439162 Link Image
PubChem Substance 830628 Link Image
ChEBI ID Not Available
CAS Registry Number 57-03-4
InChI Identifier InChI=1/C3H9O6P/c4-1-3(5)2-9-10(6,7)8/h3-5H,1-2H2,(H2,6,7,8)/t3-/m1/s1
Synthesis Reference Rios-Mercadillo, Victor M.; Whitesides, George M. Enzymic synthesis of sn-glycerol 3-phosphate. Journal of the American Chemical Society (1979), 101(19), 5828-9.
Melting Point (Experimental) 102-104oCC
Experimental Water Solubility 1000.0 mg/mL [MERCK INDEX (1996)] Source: PhysProp
Predicted Water Solubility 30.599998 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -2
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -1.84 [Predicted by ALOGPS]; -3.1 [Predicted by PubChem via XLOGP]; -1.93 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS) Not Available
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Show Image
Show Peaklist
BMRB Spectrum Show Image
Show Peaklist
Cellular Location
  • Cytoplasm
  • mitochondria
Biofluid Location
  • Breast_Milk
Tissue Location Not Available
Concentrations (Normal)
Biofluid Breast_Milk
Value 97 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw.
References
Biofluid Breast_Milk
Value 80 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw.
References
Concentrations (Abnormal) Not Available
Pathway Names
  • Glycerolipid Metabolism
  • Phospholipid Synthesis
HMDB Pathways
Name Glycerolipid Metabolism
Image Show Link Image
Name Phospholipid Synthesis
Image Show Link Image
KEGG Pathways
Name Glycerolipid Metabolism
Image Show Link Image
Name Phospholipid Synthesis
Image Show Link Image
SimCell Pathways
Name Glycerolipid Metabolism
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial
  2. Glycerol-3-phosphate dehydrogenase, mitochondrial
  3. Glycerophosphodiester phosphodiesterase 1
  4. Glycerol kinase
  5. Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic
  6. Glycerol-3-phosphate acyltransferase 4
  7. Putative glycerol kinase 5
  8. Glycerol-3-phosphate acyltransferase 1, mitochondrial
Enzyme 1 [top]
Enzyme 1 ID 78
Enzyme 1 Name CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial
Enzyme 1 Synonyms
  1. Phosphatidylglycerophosphate synthase 1
  2. Phosphatidylglycerophosphate synthase
  3. PGP synthase
Enzyme 1 Gene Name PGS1
Enzyme 1 Protein Sequence >CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase, mitochondrial
MAAAAAAAAGPVFWRRLLGLLPGRPGLAALLGRLSDRLGRNPDRRRRRSPWLLLAPLLSP
AVPVVTSPPCCLCAEGVHRFQWIRNLVPEFGVSSSHVRVLSSPAEFFELMKGQIKVAKRR
VVMASLYLGIGPLEQELVDCLESTLEKSLQAKFPSGLRVSILLDFTRGSRGRKNSRTMLL
PLLQRFPEQVRVSLFHTPNLRGLLRLLIPERFNETIGLQHIKVYLFDNNVILSGANLSDS
YFTNRQDRYVFLQDCPEIADFFTELVDAVGDVSLQLQGDDTVQMVEGMVHPYKGDRAAYC
RAANKRVMDVINSARMRQQMLHAQTFHSDPLLTQEDAAAAGDRRPAPDTWIYPLIQMKPF
EIQIDEIVTETLLTEAERGAKVYLTTGYFNLTQAYMDLVLGTRAEYQILLASPEVNGFFG
AKGVAGAIPAAYVHIERQFYSEVCSLGQQERVQLQEYWRRDWTFHAKGLWLYLAGSSLPC
LTLIGSPNFGYRSVHRDLEAQIAIVTESRALQQQLHQEQEQLYRRAGVVSSATFEQPSRQ
VKLWVKMVTPLIKNFF
Enzyme 1 Number of Residues 556
Enzyme 1 Molecular Weight 62731.9
Enzyme 1 Theoretical pI 9.10
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Lipid transport and metabolism
Enzyme 1 Specific Function Functions in the biosynthesis of the anionic phospholipids phosphatidylglycerol and cardiolipin
Enzyme 1 Pathways
  • Phospholipid metabolism
  • phosphatidylglycerol biosynthesis
  • phosphatidylglycerol from CDP-diacylglycerol:step 1/2
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein Not Available
Enzyme 1 UniProtKB/Swiss-Prot ID Q2KJ28 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name PGPS1_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence Not Available
Enzyme 1 GenBank Gene ID BC105551 Link Image
Enzyme 1 GeneCard ID PGS1 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 17q25.3
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 92
Enzyme 2 Name Glycerol-3-phosphate dehydrogenase, mitochondrial
Enzyme 2 Synonyms
  1. GPDH-M
  2. GPD-M
Enzyme 2 Gene Name GPD2
Enzyme 2 Protein Sequence >Glycerol-3-phosphate dehydrogenase, mitochondrial
MAFQKAVKGTILVGGGALATVLGLSHFAHYKRKQVNLAFVEAADCISEPVNREPPSREAQ
ILTLKNTSEFDVLVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPIYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVMSLLKKTDPQTGKERVSGARCKDVLTGEEFDVRAKCVINATGPFTDTVRKM
DDKDTTAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
VTHHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTKSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAVKAHNLKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDSKKEEELETARKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESIGVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL
Enzyme 2 Number of Residues 727
Enzyme 2 Molecular Weight 80761.8
Enzyme 2 Theoretical pI 7.05
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Energy production and conversion
Enzyme 2 Specific Function sn-glycerol 3-phosphate + a quinone = glycerone phosphate + a quinol
Enzyme 2 Pathways
  • Polyol metabolism
  • glycerol degradation via glycerol kinase pathway
  • glycerone phosphate from sn-glycerol 3-phosphate (aerobic route):step 1/1
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 151553979 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID A6QLU1 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name GPDM_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >2184 bp
ATGGCATTTCAAAAGGCGGTGAAAGGGACTATTCTTGTTGGAGGAGGTGCTCTTGCCACT
GTTCTAGGCCTCTCTCATTTTGCTCATTACAAAAGGAAGCAAGTGAACCTGGCCTTTGTT
GAAGCAGCAGACTGCATTTCAGAACCTGTTAACAGGGAGCCTCCTTCCAGAGAAGCTCAG
ATACTGACTTTGAAAAACACATCTGAGTTCGATGTACTTGTCATCGGAGGAGGAGCGACA
GGAAGTGGCTGTGCCCTGGATGCGGTCACCAGAGGACTAAAAACAGCCCTTGTAGAAAGA
GATGATTTCTCATCGGGGACCAGCAGCAGAAGCACTAAATTGATCCATGGTGGTGTGAGA
TATCTTCAGAAGGCTATCATGAAGTTGGATATTGAGCAGTACAGGATGGTAAAAGAAGCC
CTTCATGAGCGTGCCAACCTGCTGGAAATTGCTCCCCATTTATCAGCTCCATTGCCTATT
ATGCTTCCAATTTACAAATGGTGGCAGTTACCATACTACTGGGTAGGAATCAAGCTATAT
GATCTGGTTGCTGGAAGTAATTGCCTGAAAAGCAGTTATGTCCTCAGCAAATCAAGAGCC
CTTGAGCATTTCCCAATGCTCCAGAAGGACAAACTGGTGGGAGCAATTGTCTACTATGAT
GGACAACACAACGACGCACGGATGAACCTTGCCATTGCTCTCACCGCTGCCAGGTATGGG
GCTGCCACGGCCAATTACATGGAGGTCATGAGTTTGCTCAAGAAGACAGACCCCCAGACA
GGGAAAGAGCGTGTGAGCGGTGCACGGTGTAAGGATGTGCTGACAGGGGAGGAATTTGAT
GTGAGAGCCAAGTGTGTTATCAATGCCACGGGACCTTTCACAGACACCGTGCGCAAAATG
GATGATAAGGACACCACAGCTATCTGCCAGCCGAGTGCTGGCGTCCACATCGTGATGCCT
GGTTACTACAGCCCAGAGAGCATGGGACTTCTTGACCCAGCGACCAGTGATGGGAGAGTT
ATTTTCTTCTTGCCCTGGCAAAAGATGACTATAGCTGGCACTACCGACACTCCAACTGAT
GTTACACACCATCCCATTCCTTCCGAAGAAGATATCAACTTCATTTTGAATGAAGTGCGT
AACTACTTGAGTTGTGATGTTGAAGTGAGAAGAGGGGATGTCCTGGCTGCGTGGAGCGGT
ATTCGCCCCCTTGTGACAGATCCCAAGTCTGCAGACACGAAGTCCATCTCCCGAAACCAT
GTCGTGGACATCAGCGAGAGTGGCCTTATCACCATAGCAGGTGGAAAGTGGACAACCTAT
CGATCTATGGCAGAAGATACCATAAATGCCGCAGTCAAGGCACACAATTTGAAAGCAGGA
CCAAGTAGAACAGTTGGGCTTTTCCTTCAGGGGGGCAAAGACTGGAGCCCCACACTCTAC
ATCAGGCTCGTCCAGGACTATGGACTTGAAAGTGAGGTGGCCCAGCATCTTGCCGCCACC
TATGGTGATAAGGCTTTTGAGGTGGCCAAGATGGCAAGTGTGACGGGAAAGCGGTGGCCC
ATTGTTGGGGTGCGTCTTGTGTCGGAATTTCCATACATTGAAGCAGAGGTGAAATACGGG
ATTAAGGAGTATGCTTGTACCGCTGTGGATATGATTTCACGTCGTACTCGCCTGGCCTTC
CTAAATGTGCAGGCGGCAGAGGAGGCCCTACCTAGGATTGTTGAATTGATGGGCCGAGAA
TTGAATTGGGATGATTCTAAAAAAGAGGAAGAACTTGAAACAGCCAGGAAGTTTCTATAT
TATGAAATGGGCTATAAATCTCGATCAGAACAGTTAACAGATCGCTCTGAAATTAGCCTA
CTGCCTTCAGACATTGACAGGTACAAGAAGAGATTTCATAAATTCGATGCAGACCAGAAA
GGCTTTATTACCATTGTTGATGTTCAACGTGTATTAGAGAGTATCGGCGTCCAAATGGAT
GAAAATACGCTACATGAAATTTTGAATGAAGTAGATTTGAATAAAAATGGACAGGTTGAA
CTCAATGAATTTTTGCAGCTGATGAGTGCTATTCAAAAAGGAAGGGTGTCTGGAAGCCGG
CTCGCTATACTCATGAAAACTGCCGAAGAAAATCTCGATAGAAGAGTTCCCATCCCTGTG
GACCGAAGTTGTGGAGGATTGTGA
Enzyme 2 GenBank Gene ID BC148085 Link Image
Enzyme 2 GeneCard ID GPD2 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:2
Enzyme 2 Locus 2q24.1
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 496
Enzyme 3 Name Glycerophosphodiester phosphodiesterase 1
Enzyme 3 Synonyms
  1. Membrane interacting protein of RGS16
Enzyme 3 Gene Name GDE1
Enzyme 3 Protein Sequence >Glycerophosphodiester phosphodiesterase 1
MWLWEEQGGLMGPFSFLLLVLLLLTRSPFNACLFTGSLYLLLRLFSFEPVPSRRAMQVLK
PRDRVSAIAHRGGSHDAPENTLAAIRQAAKNGAAGVELDLEFTADGIPVLMHDSTVDRTT
DGTGRLCDLTFEQIRKLNPAANHRLRNDFPNEKIPTLREAVAECLNHNLTIFFDVKGHAY
KATDALKKVYMEFPKLYNNSIVCSFLPEVIYKMRQTDQNVVTALIHRPWSLSHTGDGKPR
FESFWKQSMFVALDILLDWSMHNILWYLCGVSAFLAQKDFISPDYVKKWSAKGIQVVAWT
VNTFDEKSYYESHLGSSYITDSMLEDCTPEF
Enzyme 3 Number of Residues 331
Enzyme 3 Molecular Weight 37652.9
Enzyme 3 Theoretical pI 6.85
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Energy production and conversion
Enzyme 3 Specific Function Has glycerophosphoinositol phosphodiesterase activity. Has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • 3-23 255-275
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 74354565 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q3T0T0 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name GDE1_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >996 bp
ATGTGGCTGTGGGAGGAACAGGGGGGCCTCATGGGCCCCTTCTCCTTCCTGCTGCTGGTG
CTGCTGCTGCTAACGCGCAGTCCCTTCAATGCCTGCCTCTTCACTGGCAGCCTCTACCTC
CTGTTGCGCCTCTTCAGCTTTGAGCCAGTGCCCTCCCGCAGGGCTATGCAGGTGCTCAAG
CCCCGGGACCGCGTTTCCGCTATCGCCCACCGGGGAGGCAGCCACGACGCTCCCGAGAAC
ACGCTGGCGGCCATTCGGCAGGCAGCTAAGAACGGAGCAGCAGGCGTGGAACTGGACCTT
GAGTTTACTGCTGACGGGATTCCTGTCTTAATGCACGATAGCACAGTAGATAGGACGACT
GACGGCACCGGTCGATTGTGTGATTTGACATTTGAACAAATTAGGAAGCTTAATCCTGCA
GCAAATCACAGATTAAGGAATGATTTCCCTAATGAAAAGATCCCTACCCTAAGAGAAGCC
GTTGCAGAGTGCCTAAACCATAACCTCACAATCTTCTTTGATGTCAAGGGCCATGCATAT
AAGGCTACTGATGCTCTAAAAAAAGTATATATGGAATTTCCTAAACTATACAATAATAGT
ATCGTCTGCTCTTTCTTGCCAGAAGTTATCTATAAGATGAGACAAACAGATCAGAATGTA
GTAACGGCTTTAATTCATAGACCCTGGAGCCTTAGCCACACAGGAGATGGGAAACCACGC
TTTGAATCTTTCTGGAAACAGTCCATGTTTGTGGCCTTGGACATTTTGCTCGATTGGAGT
ATGCATAATATCTTGTGGTACCTGTGTGGAGTTTCAGCTTTCCTCGCACAAAAGGACTTT
ATATCCCCGGACTATGTGAAGAAGTGGTCAGCTAAAGGCATTCAGGTTGTTGCTTGGACT
GTTAATACTTTTGATGAAAAAAGTTACTACGAATCTCATCTTGGTTCCAGCTATATCACT
GACAGCATGTTGGAAGACTGCACACCTGAATTCTAG
Enzyme 3 GenBank Gene ID BC102273 Link Image
Enzyme 3 GeneCard ID GDE1 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 16p12-p11.2
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 930
Enzyme 4 Name Glycerol kinase
Enzyme 4 Synonyms
  1. ATP:glycerol 3-phosphotransferase
  2. Glycerokinase
  3. GK
Enzyme 4 Gene Name GK
Enzyme 4 Protein Sequence >Glycerol kinase
MASAKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LQSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKLTGEPLYNAVVWLDLRTQ
STVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEDRALFGTIDS
WLIWSLTGGASGGVHCTDVTNASRTMLFNIHSLEWDKELCEFFEIPMKILPNVRSSSEIY
GLMKISHSPKAGALEGVPISGCLGDQSAALVGQMCFQDGQAKNTYGTGCFLLCNTGRKCV
FSEHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKSSEEIEKLAKEVGT
SYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRD
CGIPLSHLQVDGGMTNNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSL
EPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSSESGDPSIFCSLPLGF
FIVSSVVMLIGARYLSGMP
Enzyme 4 Number of Residues 559
Enzyme 4 Molecular Weight 61261.0
Enzyme 4 Theoretical pI 5.93
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Energy production and conversion
Enzyme 4 Specific Function Key enzyme in the regulation of glycerol uptake and metabolism
Enzyme 4 Pathways
  • Polyol metabolism
  • glycerol degradation via glycerol kinase pathway
  • sn-glycerol 3-phosphate from glycerol:step 1/1
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 113912034 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q0IID9 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name GLPK_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >1680 bp
ATGGCATCCGCGAAGAAAGCAGTTTTGGGGCCCTTGGTGGGAGCAGTGGACCAGGGCACC
AGCTCGACGCGCTTTCTGGTTTTCAATTCAAAAACAGCCGAACTACTTAGTCATCATCAA
GTGGAAATAAAACAAGAGTTTCCAAGAGAAGGGTGGGTGGAGCAGGACCCTAAGGAAATT
CTGCAGTCTGTCTATGAGTGTATAGAGAAAACGTGTGAGAAACTCGGGCAGCTCAATATT
GATATTTCCAACATAAAAGCTATTGGTGTCAGTAACCAGAGGGAAACCACTGTAGTCTGG
GACAAGTTAACTGGAGAACCTCTCTACAACGCTGTGGTGTGGCTTGACCTAAGAACCCAG
TCTACTGTTGAGAGTCTTAGTAAAAGAATCCCAGGAAATAATAACTTTGTCAAGTCCAAG
ACAGGCCTTCCACTTAGCACTTATTTCAGTGCGGTGAAGCTTCGTTGGCTCCTTGACAAT
GTGAGAAAAGTTCAAAAGGCCGTTGAAGAAGATAGAGCTCTTTTTGGGACCATTGATTCA
TGGCTTATTTGGAGCTTGACAGGAGGAGCCAGTGGAGGGGTCCATTGTACAGATGTAACA
AATGCAAGCAGGACAATGCTTTTCAACATCCATTCTTTGGAATGGGATAAAGAGCTCTGC
GAATTTTTTGAAATTCCAATGAAAATTCTTCCAAATGTCCGGAGTTCTTCAGAGATCTAT
GGCCTAATGAAAATCTCTCATAGCCCGAAAGCTGGGGCCTTGGAAGGTGTGCCAATATCT
GGGTGTTTGGGAGACCAGTCTGCTGCGTTGGTAGGACAAATGTGCTTCCAAGATGGACAA
GCCAAAAACACGTATGGAACAGGCTGCTTCTTACTATGTAATACAGGCCGTAAGTGTGTA
TTTTCTGAACATGGCCTTCTGACCACAGTGGCTTACAAACTCGGCAGAGATAAACCCGTA
TATTATGCATTAGAAGGTTCAGTAGCTATAGCTGGTGCTGTTATTCGCTGGCTTAGAGAC
AATCTTGGAATTATAAAAAGCTCCGAGGAAATTGAAAAACTTGCTAAAGAAGTAGGTACT
TCTTATGGCTGCTATTTCGTCCCAGCATTTTCGGGGCTGTATGCACCTTATTGGGAGCCC
AGTGCAAGAGGGATCATCTGTGGGCTCACTCAGTTCACCAATAAATGCCATATTGCTTTT
GCTGCATTAGAAGCTGTTTGTTTCCAAACTCGAGAGATTTTGGACGCCATGAACCGTGAC
TGTGGAATTCCACTCAGCCATTTGCAGGTAGATGGTGGAATGACCAACAACAAAATCCTT
ATGCAGTTACAAGCAGACATTCTGTATATTCCAGTAGTGAAACCATCCATGCCTGAAACA
ACTGCTCTGGGAGCCGCCATGGCTGCAGGGGCTGCAGAAGGGGTTGGCGTCTGGAGTCTG
GAGCCTGAGGACTTGTCGGCTGTCACAATGGAGCGATTTGAACCTCAGATCAACGCTGAG
GAAAGTGAAATTCGTTATTCTACATGGAAGAAAGCTGTGATGAAATCAATGGGTTGGGTT
ACAACTCAGTCTTCAGAAAGTGGTGACCCTAGTATCTTCTGTAGTCTGCCCTTGGGCTTT
TTTATAGTGAGTAGCGTGGTAATGTTAATCGGAGCAAGGTACCTCTCAGGTATGCCGTAA
Enzyme 4 GenBank Gene ID BC122692 Link Image
Enzyme 4 GeneCard ID GK Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Not Available
Enzyme 4 Locus Xp21.3
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References Not Available
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 931
Enzyme 5 Name Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic
Enzyme 5 Synonyms
  1. GPDH-C
  2. GPD-C
Enzyme 5 Gene Name GPD1
Enzyme 5 Protein Sequence >Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic
MTGKKVCIVGSGNWGSAIAKIVGGNAAQLAHFDPRVTMWVFEEDIGGRKLTEIINTQHEN
VKYLPGHKLPPNVVAVPDVVQAAADADILIFVVPHQFIGKICDQLKGHLKADTIGVSLIK
GVDEGPKGLKLISEVIGERLGIPMSVLMGANIANEVADEKFCETTIGSKNQAHGQLLKEL
MQTPNFRITVVQEVDTVEICGALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAK
LFCSGSVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKEMLNGQKLQGP
QTARELHSILQHKGMVDKFPLFTAVYKVCYENQPVGEFIHCLQNHPEHV
Enzyme 5 Number of Residues 349
Enzyme 5 Molecular Weight 37647.5
Enzyme 5 Theoretical pI 6.88
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Energy production and conversion
Enzyme 5 Specific Function sn-glycerol 3-phosphate + NAD(+) = glycerone phosphate + NADH
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 59857727 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID Q5EA88 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name GPDA_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >1050 bp
ATGACCGGCAAGAAAGTCTGCATTGTAGGCTCTGGCAACTGGGGCTCAGCCATCGCCAAG
ATTGTGGGTGGCAATGCAGCCCAGCTGGCACACTTTGACCCACGGGTGACCATGTGGGTG
TTTGAGGAAGACATCGGGGGCAGAAAGCTGACAGAGATCATCAACACACAGCACGAGAAT
GTCAAATACCTGCCAGGGCACAAGCTGCCCCCCAATGTGGTGGCTGTCCCTGATGTGGTC
CAGGCTGCAGCGGATGCCGACATCCTGATCTTTGTGGTGCCCCATCAGTTCATCGGCAAG
ATCTGTGATCAGCTCAAGGGCCACCTGAAGGCCGACACCATTGGCGTGTCTCTTATTAAG
GGGCTAGACGAAGGCCCCAAGGGGCTGAAGCTCATCTCTGAAGTGATTGGGGAGCGCCTT
GGCATCCCCATGAGCGTGCTGATGGGGGCCAACATTGCCAACGAGGTGGCTGATGAGAAG
TTCTGTGAGACAACCATTGGTAGCAAGAACCAGGCTCATGGACAGCTTCTGAAAGAGTTG
ATGCAGACACCCAATTTCCGCATCACGGTGGTGCAGGAGGTGGACACAGTAGAGATCTGT
GGGGCTTTAAAGAATATAGTGGCCGTTGGGGCTGGCTTCTGTGATGGCCTGGGCTTTGGC
GACAACACCAAGGCAGCTGTGATCCGACTGGGACTCATGGAGATGATCGCCTTCGCCAAG
CTCTTCTGCAGTGGCTCCGTGTCCTCTGCCACCTTCTTGGAGAGCTGCGGTGTTGCTGAC
CTCATCACTACCTGCTACGGAGGGCGGAACCGGAAGGTGGCCGAGGCCTTCGCCCGCACA
GGAAAGTCCATTGAGCAGCTGGAGAAAGAGATGCTGAATGGACAGAAGCTGCAGGGGCCC
CAGACAGCCCGGGAACTGCACAGTATCCTCCAGCACAGAGGCATGGTGGACAAGTTCCCT
CTGTTCACAGCTGTGTACAAGGTATGCTACGAGAACCAGCCAGTGGGGGAATTCATCCAC
TGCCTGCAGAATCATCCAGAACATGTGTGA
Enzyme 5 GenBank Gene ID BT020681 Link Image
Enzyme 5 GeneCard ID GPD1 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:1
Enzyme 5 Locus 12q12-q13
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References
  1. [PubMed Link Image]
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 932
Enzyme 6 Name Glycerol-3-phosphate acyltransferase 4
Enzyme 6 Synonyms
  1. GPAT4
  2. Acyl-CoA:glycerol-3-phosphate acyltransferase 4
  3. 1-acylglycerol-3-phosphate O-acyltransferase 6
  4. 1-AGP acyltransferase 6
  5. 1-AGPAT 6
  6. Lysophosphatidic acid acyltransferase zeta
  7. LPAAT-zeta
Enzyme 6 Gene Name AGPAT6
Enzyme 6 Protein Sequence >Glycerol-3-phosphate acyltransferase 4
MFLLLPFDSLIVSLLGISLTVLFTLLLVFIIVPAVFGVSFGIRKLYMKTLLKIFAWATLR
MERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCR
KGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTVLWGLGVLIRYCLLLSLRI
ALAFTGISLLVVGTTMVGYLPNGRFKEFLSKHVHLMCYRICVRALTAIITYHDRKNRPRN
GGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHL
VARRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAF
WNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTRQAEEDAVQFANRVKSAIARQGGLVDLL
WDGGLKREKVKDTFKEEQQKLYSKMIVGNHEDRSRS
Enzyme 6 Number of Residues 456
Enzyme 6 Molecular Weight 52054.6
Enzyme 6 Theoretical pI 9.65
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Involved in glycerol-3-phosphate O-acyltransferase acti
Enzyme 6 Specific Function Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis. Active against both saturated and unsaturated long- chain fatty acyl-CoAs
Enzyme 6 Pathways
  • Phospholipid metabolism
  • CDP-diacylglycerol biosynthesis
  • CDP-diacylglycerol from sn-glycerol 3-phosphate:step 1/3
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • 1-37
Enzyme 6 Transmembrane Regions
  • 156-176 180-200
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 125662837 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID A3FPG8 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name GPAT4_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence Not Available
Enzyme 6 GenBank Gene ID EF432784 Link Image
Enzyme 6 GeneCard ID AGPAT6 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:8
Enzyme 6 Locus 8p11.21
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References Not Available
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 933
Enzyme 7 Name Putative glycerol kinase 5
Enzyme 7 Synonyms
  1. ATP:glycerol 3-phosphotransferase
Enzyme 7 Gene Name GK5
Enzyme 7 Protein Sequence >Putative glycerol kinase 5
MSEQSTVPEQSASDSRRAGFVLGVDVGSSMIRCHVYDRAARICGSSAQKVESLYPQPGWV
EIDPDVLWLQFVAVIKESVKAAGIETNQIVGLGISTQRATFITWDKKTGKHFHNFISWQD
LRATELVKSWNGSLLMKLIHSSCRVLHFFTRSKQFLAASLFTFTTQHVSLRLAWILQNLT
EVQKAVEEENCCFGTVDTWLLHKLTKGSEFATDFSNASTTGLFDPYEMCWSKIVTSLLSI
PLSLLPPVKDTSHNFGSVDEEIFGVPIPIVALVADQQAAMFGECCFQTGDVKLTMGTGTF
LDINTGNNPQQSVGGFYPLIGWKIGQEVVCLAESNAGDTGTAIEWAQQLDLFTDAAETEK
MAQSLEDSEGVYFVPSFSGLQAPLNDPCACASFMGLKPSTNKYHLVRAILESIAFRNKQL
YETMQKEIHIPVRKIRADGGVCKNSFVMQMTSDLINETIDRPVHIDMSCSGAASLAGLAV
GFWSDKEELKKLRQSEMVFKPQKKWQEYEVNMGNWVKAVKRSMNWYKT
Enzyme 7 Number of Residues 528
Enzyme 7 Molecular Weight 58764.8
Enzyme 7 Theoretical pI 6.15
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Transcription
Enzyme 7 Specific Function ATP + glycerol = ADP + sn-glycerol 3- phosphate
Enzyme 7 Pathways
  • Polyol metabolism
  • glycerol degradation via glycerol kinase pathway
  • sn-glycerol 3-phosphate from glycerol:step 1/1
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • None
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 61553643 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q08D86 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name GLPK5_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >1113 bp
ATGTCAGAACAGTCTACGGTCCCGGAGCAGAGCGCGTCGGACTCGCGGCGCGCAGGCTTC
GTGCTGGGGGTGGACGTAGGCAGCTCGATGATTCGCTGCCACGTCTATGACCGCGCGGCA
CGAATCTGCGGCTCCAGCGCGCAGAAGGTAGAAAGTCTTTATCCTCAGCCTGGCTGGGTT
GAAATTGATCCTGATGTTCTCTGGCTTCAGTTTGTTGCTGTAATAAAGGAATCTGTCAAA
GCTGCAGGAATAGAAACAAATCAAATTGTTGGTCTTGGCATTTCAACACAGAGAGCAACT
TTTATCACATGGGACAAGAAAACGGGAAAGCATTTCCACAACTTCATTAGTTGGCAAGAC
CTACGAGCTACTGAACTTGTAAAATCTTGGAATGGTTCTCTTTTAATGAAGCTCATACAC
AGTTCCTGCCGAGTACTGCACTTTTTCACTAGAAGTAAACAATTTCTAGCAGCCAGTTTG
TTCACTTTCACAACTCAGCATGTTTCTTTGAGATTGGCCTGGATTTTGCAGAACCTGACT
GAGGTGCAAAAGGCAGTGGAAGAAGAAAATTGCTGCTTTGGGACTGTTGATACCTGGTTG
TTACATAAGCTCACAAAAGGTTCTGAATTTGCCACAGATTTTTCAAATGCCAGCACAACT
GGACTTTTTGACCCATATGAGATGTGTTGGAGCAAGATCGTTACCTCCCTGCTTTCAATC
CCGCTCTCTCTCCTGCCTCCTGTGAAGGATACGAGCCACAATTTTGGATCAGTGGATGAA
GAGATATTTGGTGTGCCTATACCAATAGTGGCCTTGGTCGCTGACCAGCAAGCAGCCATG
TTTGGAGAATGCTGCTTTCAAACAGGAGATGTGAAGTTAACCATGGGAACTGGGACGTTT
TTAGATATTAATACTGGAAATAACCCTCAACAGAGTGTTGGAGGCTTTTATCCATTAATT
GGGTGGAAGATCGGGCAAGAAGTGGTGTGCTTAGCTGAAAGCAATGCGGGAGACACAGGC
ACTGCCATAGAGTGGGCTCAGCAGTTAGGTAGAATGAAAAAGCATTCAAAAAACAAGAAC
AAGGGGATTATTTCCCCACTCTCTGTTCTGTAG
Enzyme 7 GenBank Gene ID BT021588 Link Image
Enzyme 7 GeneCard ID GK5 Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:3
Enzyme 7 Locus 3q23
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References
  1. [PubMed Link Image]
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 934
Enzyme 8 Name Glycerol-3-phosphate acyltransferase 1, mitochondrial
Enzyme 8 Synonyms
  1. GPAT
Enzyme 8 Gene Name GPAM
Enzyme 8 Protein Sequence >Glycerol-3-phosphate acyltransferase 1, mitochondrial
MDESALTLGTIDVSYLPNSSEYSIGRCKHATEEWGECGSRPTVFRSATLKWKESLMSRKR
PFVGRCCYSCTPQSWDKFFNPSIPSLGLRNVIYINETHTRHRGWLARRLSYVLFIQERDV
HKGMFATNVTENVLNSSRVQEAIAEVAGELNPDGSAQQQSKAVNKVKKKARKILQEMVAT
VSPAMIRLTGWVLLKLFNSFFWNIQIHKGQLEMVKAATETNLPLIFLPVHRSHIDYLLLT
FILFCHNIKAPYIASGNNLNIPIFSTLIHKLGGFFIRRRLDETPDGRKDILYRALLHGHI
VELLRQQQFLEIFLEGTRSRSGKISCARAGLLSVVVDTLSTNTIPDILIIPGGISYDRII
EGHYNGEQLGKPKKNESLWSIARGVIRMLRKNYGCVKTDFAQPFSLKEYLESQSQKPVSA
PLSLEQALLPAILPSRPSGAADEGTDMSINESRNATDESRRRLIAHLAEHILFTASKSCA
IMSTHIVACLLLYRHRQGIGLFTLVEDFFVMKEEVLARDFDLGFSGNSEDVVMHAIQFLG
NCITITHTSKNDEFFITPSTTIPSVFELNFYSNGVLHVFIMEAIIACSLYAVLKKRGPGG
PASPSLVSQEQLVHKAASLCYLLSNEGTISLPCQTFYQICHETVGRFIQYGILIVAEQDD
QEDISPGLAEQQWDKKLPEPLSWRSDEEDEDSDFGEEQRDCYLKVSQSKEHQQFITFLQR
LLGPLLEAYSSAAVFIHNFGGPVPEPEFLQKLHKYLITRTERRVAVYAESATYCLVKNAV
KTFKDIGVFKETKQKRVSGLELSNTFLPQCNRQKLLEYILSLVVL
Enzyme 8 Number of Residues 825
Enzyme 8 Molecular Weight 93143.3
Enzyme 8 Theoretical pI 8.00
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Lipid transport and metabolism
Enzyme 8 Specific Function Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis
Enzyme 8 Pathways
  • Phospholipid metabolism
  • CDP-diacylglycerol biosynthesis
  • CDP-diacylglycerol from sn-glycerol 3-phosphate:step 1/3
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • None
Enzyme 8 Transmembrane Regions
  • 471-493 574-592
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 45934752 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID Q5GJ77 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name GPAT1_BOVIN Link Image
Enzyme 8 PDB ID Not Available
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence >2478 bp
ATGGATGAATCTGCATTGACCCTTGGCACGATAGATGTATCTTATTTGCCAAATTCTTCT
GAATACAGCATTGGTCGGTGTAAGCATGCCACCGAGGAATGGGGTGAGTGTGGTTCCAGG
CCTACTGTCTTCAGATCTGCAACCTTGAAGTGGAAAGAAAGCCTAATGAGCCGGAAGAGG
CCCTTTGTGGGAAGGTGCTGTTATTCCTGTACTCCTCAGAGCTGGGATAAATTTTTCAAC
CCCAGTATCCCGTCTTTGGGTTTGCGGAATGTTATTTATATCAATGAAACGCATACAAGG
CACCGAGGGTGGCTGGCAAGACGTCTTTCTTATGTGCTTTTCATTCAAGAGCGAGATGTC
CATAAAGGCATGTTTGCCACCAACGTAACTGAAAACGTGCTGAACAGCAGTCGAGTACAA
GAGGCAATTGCAGAAGTGGCTGGTGAATTAAACCCTGATGGTTCTGCTCAGCAGCAATCA
AAAGCTGTGAATAAAGTGAAAAAGAAAGCCAGAAAGATCCTTCAAGAAATGGTTGCCACC
GTTTCACCGGCAATGATCAGACTGACTGGATGGGTGCTGCTGAAACTGTTCAACAGCTTC
TTTTGGAATATTCAGATTCACAAGGGTCAACTTGAGATGGTTAAAGCTGCGACTGAGACG
AATTTGCCGCTTATATTTCTGCCAGTTCATAGATCACACATTGACTATCTCCTGCTCACT
TTCATTCTCTTCTGCCATAACATCAAAGCGCCGTACATTGCTTCAGGCAATAATCTCAAC
ATCCCCATCTTCAGTACTTTGATCCATAAGCTTGGAGGCTTTTTCATACGACGGAGGCTA
GATGAGACGCCAGATGGACGGAAAGATATTCTCTATAGAGCTTTACTCCATGGGCATATA
GTTGAACTACTGCGACAGCAGCAGTTCTTGGAGATCTTCCTGGAAGGCACACGCTCAAGA
AGTGGAAAAATCTCCTGTGCTCGGGCAGGACTTCTGTCAGTTGTGGTAGATACACTGTCC
ACCAATACGATCCCAGACATCTTGATAATACCTGGTGGGATCTCTTACGATCGCATTATT
GAGGGTCATTACAATGGCGAACAACTGGGAAAACCCAAGAAGAATGAGAGCCTCTGGAGC
ATAGCAAGAGGCGTTATCAGAATGTTACGAAAAAACTACGGATGTGTCAAAACGGATTTT
GCACAACCATTTTCCTTAAAGGAATATTTAGAAAGCCAAAGTCAGAAACCTGTTTCTGCT
CCACTTTCTTTGGAGCAAGCATTGTTGCCAGCTATACTTCCCTCAAGACCCAGTGGTGCT
GCTGACGAAGGTACAGACATGTCCATTAATGAGTCCAGAAATGCAACAGATGAATCCCGC
CGAAGACTGATTGCACACCTGGCTGAGCACATTCTCTTCACTGCTAGCAAGTCCTGTGCT
ATTATGTCCACGCACATCGTGGCCTGTCTGCTCCTCTACAGACACAGGCAGGGAATTGGC
CTCTTCACATTGGTGGAAGACTTCTTTGTGATGAAGGAGGAAGTCCTGGCTCGTGATTTT
GACTTGGGTTTCTCAGGAAATTCAGAAGATGTAGTCATGCATGCCATACAGTTCCTGGGA
AATTGTATCACAATCACCCACACGAGCAAGAATGATGAGTTTTTTATTACTCCTAGCACA
ACTATCCCATCAGTCTTTGAACTCAACTTCTACAGCAATGGGGTGCTCCATGTCTTTATC
ATGGAGGCCATCATAGCCTGCAGCCTTTATGCAGTTCTGAAGAAGAGGGGCCCAGGAGGA
CCCGCGTCTCCCAGCTTGGTCAGCCAGGAGCAGCTGGTGCACAAGGCTGCCAGCCTGTGC
TATCTGCTCTCCAATGAAGGCACCATCTCTCTCCCCTGCCAGACCTTTTACCAAATTTGC
CATGAAACAGTGGGCAGGTTTATCCAGTATGGCATTCTTATAGTGGCGGAGCAAGATGAT
CAGGAAGATATCAGTCCTGGTCTTGCCGAGCAGCAGTGGGACAAGAAGCTTCCGGAACCT
TTGTCTTGGAGAAGTGATGAAGAAGATGAAGACAGCGATTTTGGTGAGGAGCAACGAGAT
TGCTACCTGAAGGTGAGCCAGTCCAAGGAGCACCAGCAGTTCATCACCTTCCTGCAGAGG
CTCCTCGGGCCTCTGCTGGAGGCGTACAGCTCTGCCGCCGTCTTCATTCACAACTTCGGC
GGTCCTGTCCCCGAGCCTGAATTCCTGCAGAAGCTGCACAAGTACCTGATCACAAGAACC
GAGAGAAGGGTTGCCGTATACGCTGAGAGCGCCACTTACTGTCTCGTGAAGAATGCTGTG
AAGACGTTTAAGGATATCGGGGTTTTCAAAGAGACCAAACAAAAGAGAGTGTCTGGGTTA
GAACTCAGCAACACTTTTCTACCTCAATGCAACCGGCAAAAACTCCTGGAATATATTCTG
AGTTTGGTGGTGCTGTAG
Enzyme 8 GenBank Gene ID AY515690 Link Image
Enzyme 8 GeneCard ID GPAM Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:1
Enzyme 8 Locus 10q25.2
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References
  1. [PubMed Link Image]
Enzyme 8 Metabolite References Not Available