We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Glutathione (BMDB00125)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-08-17 15:08:20
Accession Number BMDB00125
Common Name Glutathione
Description Glutathione is a compound synthesized from cysteine, perhaps the most important member of the body's toxic waste disposal team. Like cysteine, glutathione contains the crucial thiol (-SH) group that makes it an effective antioxidant. There are virtually no living organisms on this planet-animal or plant whose cells don't contain some glutathione. Scientists have speculated that glutathione was essential to the very development of life on earth. glutathione has many roles; in none does it act alone. It is a coenzyme in various enzymatic reactions. The most important of these are redox reactions, in which the thiol grouping on the cysteine portion of cell membranes protects against peroxidation; and conjugation reactions, in which glutathione (especially in the liver) binds with toxic chemicals in order to detoxify them. glutathione is also important in red and white blood cell formation and throughout the immune system. glutathione's clinical uses include the prevention of oxygen toxicity in hyperbaric oxygen therapy, treatment of lead and other heavy metal poisoning, lowering of the toxicity of chemotherapy and radiation in cancer treatments, and reversal of cataracts. (http://www.dcnutrition.com/AminoAcids/) glutathione participates in leukotriene synthesis and is a cofactor for the enzyme glutathione peroxidase. It is also important as a hydrophilic molecule that is added to lipophilic toxins and waste in the liver during biotransformation before they can become part of the bile. glutathione is also needed for the detoxification of methylglyoxal, a toxin produced as a by-product of metabolism. This detoxification reaction is carried out by the glyoxalase system. Glyoxalase I (EC 4.4.1.5) catalyzes the conversion of methylglyoxal and reduced glutathione to S-D-Lactoyl-glutathione. Glyoxalase II (EC 3.1.2.6) catalyzes the hydrolysis of S-D-Lactoyl-glutathione to glutathione and D-lactate. GSH is known as a substrate in both conjugation reactions and reduction reactions, catalyzed by glutathione S-transferase enzymes in cytosol, microsomes, and mitochondria. However, it is also capable of participating in non-enzymatic conjugation with some chemicals, as in the case of n-acetyl-p-benzoquinone imine (NAPQI), the reactive cytochrome P450-reactive metabolite formed by acetaminophen, that becomes toxic when GSH is depleted by an overdose (of acetaminophen). glutathione in this capacity binds to NAPQI as a suicide substrate and in the process detoxifies it, taking the place of cellular protein thiol groups which would otherwise be covalently modified; when all GSH has been spent, NAPQI begins to react with the cellular proteins, killing the cells in the process. The preferred treatment for an overdose of this painkiller is the administration (usually in atomized form) of N-acetylcysteine, which is used by cells to replace spent GSSG and renew the usable GSH pool. (http://en.wikipedia.org/wiki/glutathione)
Synonyms
  1. 5-L-Glutamyl-L-cysteinylglycine
  2. Agifutol S
  3. Bakezyme RX
  4. Copren
  5. Deltathione
  6. GSH
  7. Glutathion
  8. Glutathione
  9. Glutathione red
  10. Glutathione reduced
  11. Glutathione-SH
  12. Glutatiol
  13. Glutatione
  14. Glutide
  15. Glutinal
  16. L-g-glutamyl-L-cysteinyl-glycine
  17. L-gamma-glutamyl-L-cysteinyl-glycine
  18. Isethion
  19. L-Glutathione
  20. L-Glutathione reduce
  21. L-gamma-glutamyl-L-cysteinylglycine
  22. L-glutamyl-L-cysteinylglycine
  23. Ledac
  24. Neuthion
  25. Reduced glutathione
  26. Tathion
  27. Tathione
  28. Triptide
  29. gamma-Glutamylcysteinylglycine
  30. gamma-L-Glutamyl-L-cysteinylglycine
  31. gamma-L-glutamyl-L-cysteinyl-glycine
  32. red. glutathione
Chemical IUPAC Name (2S)-2-amino-4-[[(1R)-1-(carboxymethylcarbamoyl)-2-sulfanyl-ethyl]carbamoyl]butanoic acid
Chemical Formula C10H17N3O6S
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Polypeptides
Sub Class
  • Tripeptides
Family
  • Mammalian_Metabolite
Species
  • primary amine; primary aliphatic amine (alkylamine); carboxylic acid; secondary carboxylic acid amide; thiol (sulfanyl compound); alkylthiol; alpha-aminoacid
Biofunction
  • Component of Glutamate metabolism; Component of Glutathione metabolism
Application
Source
  • Endogenous
Average Molecular Weight 307.323
Monoisotopic Molecular Weight 307.083801
Isomeric SMILES N[C@@H](CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O)C(O)=O
Canonical SMILES NC(CCC(=O)NC(CS)C(=O)NCC(O)=O)C(O)=O
KEGG Compound ID C00051 Link Image
BioCyc ID OXIDIZED-GLUTATHIONE Link Image
BiGG ID 33669 Link Image
Wikipedia Link Glutathione Link Image
METLIN ID 44 Link Image
PubChem Compound 124886 Link Image
PubChem Substance 821009 Link Image
ChEBI ID 16856 Link Image
CAS Registry Number 70-18-8
InChI Identifier InChI=1/C10H17N3O6S/c11-5(10(18)19)1-2-7(14)13-6(4-20)9(17)12-3-8(15)16/h5-6,20H,1-4,11H2,(H,12,17)(H,13,14)(H,15,16)(H,18,19)/t5-,6-/m0/s1
Synthesis Reference Not Available
Melting Point (Experimental) 195 oC
Experimental Water Solubility 292.5 mg/mL [HMP experimental] Source: PhysProp
Predicted Water Solubility 1000.0 mg/mL at 25 oC [MEYLAN,WM et al. (1996)]; 0.879 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -1
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -2.74 [Predicted by ALOGPS]; -6.4 [Predicted by PubChem via XLOGP]; -5.41 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID 11GS Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
  • endoplasmic reticulum
  • Extracellular
  • mitochondria
Biofluid Location Not Available
Tissue Location
Tissue References
All Tissues
Concentrations (Normal) Not Available
Concentrations (Abnormal) Not Available
Pathway Names
  • Glutamate Metabolism
  • Glutathione Metabolism
HMDB Pathways
Name Glutamate Metabolism
Image Show Link Image
Name Glutathione Metabolism
Image Show Link Image
KEGG Pathways
Name Glutamate Metabolism
Image Show Link Image
Name Glutathione Metabolism
Image Show Link Image
SimCell Pathways
Name Glutathione Metabolism
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. S-formylglutathione hydrolase
  2. Glutathione synthetase
  3. Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
  4. Glutathione peroxidase 3
  5. Glutathione peroxidase 1
  6. Carbonyl reductase [NADPH] 1
  7. Leukotriene C4 synthase
  8. Glutathione S-transferase theta-1
  9. Microsomal glutathione S-transferase 3
  10. Glutathione S-transferase
  11. Microsomal glutathione S-transferase 1
  12. Glutathione S-transferase Mu 1
  13. Hydroxyacylglutathione hydrolase, mitochondrial
  14. 4-HYDROXYNONENAL metabolizing glutathione S-transferase
  15. Glutathione S-transferase A4
  16. Glutathione S-transferase mu 3 (Brain)
  17. Glutathione S-transferase
  18. Glutathione peroxidase 7
  19. Glutathione S-transferase
  20. Glutathione S-transferase
  21. Glutathione S-transferase P
  22. Microsomal glutathione S-transferase 2
  23. Glutathione S-transferase omega 1
  24. Probable glutathione peroxidase 8
  25. Thioredoxin domain-containing protein 12
  26. Glutathione S-transferase mu 4
  27. Glutathione S-transferase A2
  28. Glutathione S-transferase A1
  29. Multidrug resistance-associated protein 1
  30. GSTM2 protein
  31. GSTM1 protein
Enzyme 1 [top]
Enzyme 1 ID 117
Enzyme 1 Name S-formylglutathione hydrolase
Enzyme 1 Synonyms
  1. FGH
  2. Esterase D
Enzyme 1 Gene Name ESD
Enzyme 1 Protein Sequence >S-formylglutathione hydrolase
MALKQVSSSKCFGGLQKVFEHDSVELKCKMKFAVYLPPKAETGKCPVLYWLSGLTCTEQN
FISKSGYHQAASEHGLVVIAPDTSPRGCNIKGEEDSWDFGTGAGFYVDATEDLWKTNYRM
YSYVTKELPQLVNDNFPVDPQRMSVFGHSMGGHGALICALKNPGKYKSVSAFAPLCNPVL
CRWGKKAFTGYLGTDQSKWEAYDATYLVKSYPGPQLDILIDQGKEDEFLSDGQLLPDNFI
AACTEKKIPVVFRLQEGYDHSYYFIATFIADHIRHHAKYLNA
Enzyme 1 Number of Residues 282
Enzyme 1 Molecular Weight 31547.7
Enzyme 1 Theoretical pI 6.97
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Involved in carboxylesterase activity
Enzyme 1 Specific Function Serine hydrolase involved in the detoxification of formaldehyde
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 115305246 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q08E20 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name ESTD_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >849 bp
ATGGCCCTGAAACAGGTTTCCAGCAGCAAGTGCTTTGGTGGACTGCAGAAAGTTTTTGAA
CATGACAGTGTTGAACTGAAGTGCAAAATGAAATTTGCTGTCTATTTACCACCAAAGGCA
GAAACTGGAAAATGCCCTGTGCTATATTGGCTGTCTGGTTTAACTTGCACAGAACAAAAT
TTTATATCAAAATCTGGTTACCATCAAGCTGCTTCGGAACACGGCCTTGTCGTCATTGCC
CCAGATACCAGCCCTCGTGGCTGCAATATTAAAGGAGAAGAGGACAGCTGGGACTTCGGC
ACTGGCGCTGGGTTTTATGTCGATGCTACTGAAGATCTTTGGAAAACTAACTATAGAATG
TACTCTTACGTAACGAAGGAGCTTCCCCAACTTGTAAATGACAATTTCCCAGTGGACCCC
CAAAGGATGTCTGTTTTTGGCCACTCTATGGGAGGCCATGGAGCTCTGATTTGTGCTTTG
AAGAATCCTGGAAAATACAAATCTGTGTCAGCATTTGCTCCACTTTGCAACCCAGTGCTC
TGTCGTTGGGGCAAAAAAGCCTTTACCGGATATTTGGGAACAGATCAAAGTAAATGGGAG
GCTTATGATGCTACCTATCTTGTGAAGTCCTATCCAGGTCCTCAGCTGGATATACTAATT
GATCAAGGGAAAGAGGACGAGTTCCTTTCCGACGGACAGTTACTGCCTGATAACTTCATA
GCTGCCTGTACAGAAAAGAAAATCCCTGTTGTTTTCAGATTGCAAGAGGGTTATGATCAC
AGCTACTACTTTATTGCAACCTTTATCGCTGATCACATCAGACATCATGCAAAATATCTG
AATGCATGA
Enzyme 1 GenBank Gene ID BC123461 Link Image
Enzyme 1 GeneCard ID ESD Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 13q14.1-q14.2
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 197
Enzyme 2 Name Glutathione synthetase
Enzyme 2 Synonyms
  1. Glutathione synthase
  2. GSH synthetase
  3. GSH-S
Enzyme 2 Gene Name GSS
Enzyme 2 Protein Sequence >Glutathione synthetase
MATGWGSLLQDEQQLEELARQAVDRALAEGVLLRTSQAPSSSHVVSYAPFTLFPSPVPSA
LLEQAYAVQADFNLLVDAVSQNAVFLEQTLSSTIKRDSFTARLFDIHKQVLKEGIAQTVF
LGLNRSDYMFQCNPDGSAALKQIEINTVSASFGGLASRTPAVHRHVLSVLGKTKEAAKIL
SNNPSKGLAMGIAKAWELYGSANAQVLLIAQEKERNIFDQRAIENELLARNIHVIRRKFE
DVSEKGSLDQDRRLFMDGQEIAVVYFRDGYMPGHYSLQNWEARLLLERSCAVKCPDIATQ
LAGTKKVQQELSRVGVLESFLPGQPEAVARLRATFAGLYSLDLGEEGDQAITKAIAAPSC
FVLKPQREGGGNNLYGEEMVQALERLKDSEERASYILMEKIEPEPFRNCLLRPGSPARVI
QCISELGIFGVYVREGKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV
Enzyme 2 Number of Residues 474
Enzyme 2 Molecular Weight 52065.0
Enzyme 2 Theoretical pI 6.44
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Involved in ATP binding
Enzyme 2 Specific Function ATP + gamma-L-glutamyl-L-cysteine + glycine = ADP + phosphate + glutathione
Enzyme 2 Pathways
  • Sulfur metabolism
  • glutathione biosynthesis
  • glutathione from L-cysteine and L-glutamate:step 2/2
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 59857659 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q5EAC2 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name GSHB_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1425 bp
ATGGCCACCGGCTGGGGGAGCCTCTTGCAGGATGAACAGCAGCTGGAGGAGCTAGCAAGG
CAGGCTGTGGACCGGGCTCTGGCTGAGGGTGTGTTGCTGAGGACCTCACAGGCACCCAGC
TCCTCTCATGTGGTGAGCTATGCTCCATTCACACTCTTCCCTTCACCGGTCCCAAGTGCC
CTGCTGGAGCAGGCCTATGCTGTGCAGGCGGACTTCAACCTCCTGGTGGATGCGGTCAGC
CAAAATGCTGTCTTTCTGGAGCAGACTCTCTCCAGCACCATCAAAAGAGACAGCTTTACT
GCTCGTCTCTTTGACATCCACAAGCAAGTCTTAAAAGAAGGCATTGCCCAGACCGTGTTC
CTGGGCTTGAATCGCTCAGACTACATGTTCCAGTGCAATCCGGATGGCTCCGCAGCCCTG
AAACAGATTGAAATCAACACCGTCTCTGCCAGCTTTGGGGGCCTAGCCTCCCGGACCCCA
GCTGTGCATCGACATGTTCTCAGTGTCCTGGGTAAGACCAAAGAAGCTGCCAAGATCCTC
TCCAATAATCCCAGCAAGGGACTGGCCATGGGGATTGCCAAAGCCTGGGAGCTCTACGGC
TCAGCCAATGCTCAGGTGCTACTGATTGCTCAAGAGAAGGAAAGGAACATATTTGACCAG
CGTGCCATAGAGAATGAGCTACTGGCCAGGAATATCCATGTAATCCGACGAAAGTTCGAA
GATGTCTCTGAAAAGGGGTCTCTAGACCAAGACCGAAGACTATTTATGGACGGCCAGGAG
ATTGCTGTGGTTTACTTCCGGGATGGCTACATGCCAGGCCATTACAGCCTACAGAACTGG
GAAGCACGCCTGCTCCTGGAGAGGTCATGTGCTGTCAAGTGCCCGGATATTGCCACCCAG
CTGGCCGGGACCAAGAAGGTGCAGCAGGAGCTGAGCAGAGTGGGCGTGCTGGAGTCCTTT
CTCCCAGGGCAGCCTGAGGCTGTGGCCCGCCTCCGTGCCACCTTTGCTGGCCTCTACTCA
CTAGACCTGGGTGAAGAAGGGGACCAGGCTATCACCAAGGCCATTGCTGCTCCTAGCTGC
TTTGTGCTAAAGCCTCAAAGAGAGGGTGGAGGTAACAACCTATACGGGGAGGAGATGGTA
CAAGCCCTGGAGCGGCTGAAGGACAGTGAGGAGAGAGCCTCCTACATCCTCATGGAGAAG
ATCGAACCCGAGCCTTTTAGGAATTGTCTACTACGACCCGGCAGCCCTGCCCGAGTGATC
CAATGCATTTCAGAGCTGGGCATCTTCGGGGTCTATGTCAGGGAGGGAAAGACACTTGTG
ATGAACAAGCACGTGGGACATCTGCTTCGAACCAAAGCCATCGAGCATGCAGATGGCGGT
GTGGCGGCTGGAGTGGCAGTCCTGGACAACCCGTACCCTGTGTGA
Enzyme 2 GenBank Gene ID BT020647 Link Image
Enzyme 2 GeneCard ID GSS Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:2
Enzyme 2 Locus 20q11.2
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 541
Enzyme 3 Name Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
Enzyme 3 Synonyms
  1. PHGPx
  2. Glutathione peroxidase 4
  3. GPx-4
Enzyme 3 Gene Name GPX4
Enzyme 3 Protein Sequence >Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
MSFSRLYRLLKPALLCGALAAPGLASTMCASRDDWRCARSMHEFSAKDIDGRMVNLDKYR
GHVCIVTNVASQUGKTDVNYTQLVDLHARYAECGLRILAFPCNQFGRQEPGSNAEIKEFA
AGYNVKFDLFSKICVNGDDAHPLWKWMKVQPKGRGMLGNAIKWNFTKFLIDKNGCVVKRY
GPMEEPLVIEKDLPCYL
Enzyme 3 Number of Residues 197
Enzyme 3 Molecular Weight 22239.5
Enzyme 3 Theoretical pI 8.79
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 3 Specific Function Protects cells against membrane lipid peroxidation and cell death. Required for normal sperm development and male fertility. Could play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for embryonic development. Protects from radiation and oxidative damage
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 6174770 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q9N2J2 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name GPX4_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >594 bp
ATGAGCTTTAGCCGTCTGTACCGCCTGCTCAAGCCAGCGCTACTCTGCGGGGCTCTGGCT
GCGCCGGGCCTGGCCAGCACCATGTGCGCGTCCCGCGACGACTGGCGCTGTGCTCGCTCC
ATGCACGAATTTTCAGCCAAGGACATCGACGGGCGCATGGTTAACCTGGACAAGTACCGG
GGCCACGTGTGCATCGTCACCAATGTGGCCTCGCAATGAGGCAAGACTGACGTAAACTAC
ACTCAGCTGGTCGACCTGCACGCCCGATACGCCGAGTGTGGTTTACGGATCCTGGCCTTC
CCTTGCAACCAGTTTGGGAGGCAGGAGCCAGGGAGTAATGCAGAGATCAAAGAGTTCGCC
GCTGGCTATAACGTCAAATTCGATTTGTTCAGCAAGATCTGTGTAAATGGGGACGACGCC
CACCCTCTGTGGAAATGGATGAAAGTCCAGCCCAAGGGGAGAGGCATGCTGGGAAACGCC
ATCAAATGGAACTTCACCAAGTTCCTCATTGACAAGAACGGCTGTGTGGTGAAGCGGTAT
GGTCCCATGGAAGAGCCCCTGGTGATAGAGAAGGACCTGCCGTGCTACCTCTAG
Enzyme 3 GenBank Gene ID AB017534 Link Image
Enzyme 3 GeneCard ID GPX4 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 19p13.3
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 542
Enzyme 4 Name Glutathione peroxidase 3
Enzyme 4 Synonyms
  1. GSHPx-3
  2. GPx-3
  3. Plasma glutathione peroxidase
  4. GSHPx-P
Enzyme 4 Gene Name GPX3
Enzyme 4 Protein Sequence >Glutathione peroxidase 3
MARLFRASCLLSLLLAGFIPPSQGQEKSKTDCHAGVGGTIYEYGALTIDGEEYIPFKQYA
GKYILFVNVASYUGLTGQYVELNALQEELEPFGLVILGFPCNQFGKQEPGENSEILATLK
YVRPGGGFTPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGSPDRLFWEPMKVHDIR
WNFEKFLVGPDGIPIMRWYHRTTVNSVKMDILTYMRRRAVWEAKGK
Enzyme 4 Number of Residues 226
Enzyme 4 Molecular Weight 25663.2
Enzyme 4 Theoretical pI 7.38
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 4 Specific Function Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • 1-24
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 14717817 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID P37141 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name GPX3_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >681 bp
ATGGCCCGGCTCTTCCGGGCATCCTGCCTTCTGTCCCTGCTCCTGGCCGGCTTCATTCCC
CCGAGCCAGGGACAGGAGAAGTCGAAGACGGACTGCCACGCTGGTGTGGGTGGCACCATC
TATGAGTACGGGGCCCTCACCATCGATGGGGAGGAGTACATCCCCTTTAAGCAGTACGCT
GGCAAATACATCCTCTTCGTCAACGTGGCCAGCTACTGAGGCCTGACGGGCCAGTACGTT
GAACTGAATGCACTGCAGGAAGAGCTTGAACCATTTGGTCTGGTCATTCTGGGCTTCCCC
TGCAACCAATTTGGAAAACAAGAACCAGGAGAGAACTCGGAGATCCTAGCCACCCTCAAG
TATGTTCGACCAGGTGGGGGCTTCACCCCCAATTTCCAACTGTTTGAGAAAGGCGATGTG
AATGGGGAGAAAGAGCAGAAGTTCTACACGTTCCTGAAGAACTCCTGTCCTCCTACCTCG
GAGCTCCTAGGCTCACCTGACCGCCTTTTCTGGGAACCCATGAAGGTCCATGACATCCGG
TGGAACTTTGAGAAGTTCCTGGTGGGGCCAGACGGCATCCCCATCATGCGCTGGTACCAC
CGCACCACGGTCAACTCTGTCAAGATGGACATCCTGACCTACATGCGGCGGCGGGCGGTC
TGGGAGGCCAAGGGGAAGTAA
Enzyme 4 GenBank Gene ID L10325 Link Image
Enzyme 4 GeneCard ID GPX3 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:5
Enzyme 4 Locus 5q23
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 544
Enzyme 5 Name Glutathione peroxidase 1
Enzyme 5 Synonyms
  1. GSHPx-1
  2. GPx-1
  3. Cellular glutathione peroxidase
Enzyme 5 Gene Name GPX1
Enzyme 5 Protein Sequence >Glutathione peroxidase 1
MCAAQRSAAALAAAAPRTVYAFSARPLAGGEPFNLSSLRGKVLLIENVASLUGTTVRDYT
QMNDLQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNCLKYVRPGGGFEPNFMLFEKCEV
NGEKAHPLFAFLREVLPTPSDDATALMTDPKFITWSPVCRNDVSWNFEKFLVGPDGVPVR
RYSRRFLTIDIEPDIETLLSQGASA
Enzyme 5 Number of Residues 205
Enzyme 5 Molecular Weight 22658.6
Enzyme 5 Theoretical pI 7.25
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 5 Specific Function Protects the hemoglobin in erythrocytes from oxidative breakdown
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 4584712 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID P00435 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name GPX1_BOVIN Link Image
Enzyme 5 PDB ID 1GP1 Link Image
Enzyme 5 PDB File Show
Enzyme 5 3D Structure
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >618 bp
ATGTGCGCCGCTCAGCGCTCGGCGGCCGCCCTGGCGGCGGCAGCCCCGCGCACAGTGTAC
GCCTTCTCCGCGCGCCCTCTGGCCGGCGGGGAGCCCTTCAACCTGTCCTCCCTGCGGGGC
AAGGTGCTGCTCATTGAGAACGTAGCATCGCTCTGAGGCACAACGGTGCGGGACTACACC
CAGATGAATGACCTGCAGCGGCGCCTTGGACCCCGGGGCCTGGTCGTGCTCGGCTTCCCC
TGCAACCAGTTTGGGCATCAGGAAAACGCCAAGAACGAGGAGATCCTGAATTGCCTGAAG
TACGTCCGACCAGGCGGCGGGTTCGAGCCCAACTTTATGCTCTTCGAAAAGTGCGAGGTG
AATGGCGAGAAGGCGCATCCGCTCTTCGCCTTCCTTCGGGAGGTTCTGCCCACGCCAAGT
GACGACGCCACTGCTCTCATGACCGACCCTAAGTTCATCACCTGGTCCCCGGTGTGCCGC
AACGACGTCTCCTGGAACTTCGAGAAGTTCCTGGTGGGCCCAGACGGTGTGCCCGTGCGC
AGGTACAGCCGCCGCTTTCTGACCATCGACATCGAGCCTGACATTGAAACCCTGCTGTCC
CAGGGGGCCTCTGCCTAG
Enzyme 5 GenBank Gene ID X13684 Link Image
Enzyme 5 GeneCard ID GPX1 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:3
Enzyme 5 Locus 3p21.3
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References
  1. [PubMed Link Image]
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 602
Enzyme 6 Name Carbonyl reductase [NADPH] 1
Enzyme 6 Synonyms
  1. NADPH-dependent carbonyl reductase 1
  2. Prostaglandin-E(2) 9-reductase
  3. Prostaglandin 9-ketoreductase
  4. 15-hydroxyprostaglandin dehydrogenase [NADP+]
Enzyme 6 Gene Name CBR1
Enzyme 6 Protein Sequence >Carbonyl reductase [NADPH] 1
MSSSNCVALVTGANKGIGFVIVRDLCRRFSGDVVLTARDEARGRAAVQQLQAEGLSPLFH
QLDIDDRQSIRALRDFLRKEYGGLDVLVNNAGIAFKTADTTPFHIQAEVTMKTNFFGTRD
VCTELLPLIKPQGRVVNVSSFVSVNSLKKCSRELQQKFRSETITEEELVGLMNKFVEDTK
NGVHRKEGWPDTAYGVTKIGVTVLSRIHARKLSEQRGGDKILLNACCPGWVRTDMGGPKA
SKSPEEGAETPVYLALLPSDAEGPHGEFISEKRVVQW
Enzyme 6 Number of Residues 277
Enzyme 6 Molecular Weight 30532.7
Enzyme 6 Theoretical pI 8.37
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Lipid transport and metabolism
Enzyme 6 Specific Function NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 74354825 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID Q3SZD7 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name CBR1_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >834 bp
ATGTCGTCCTCCAACTGCGTGGCGCTGGTCACCGGGGCCAACAAGGGCATCGGCTTCGTC
ATCGTGCGTGACCTGTGCCGGCGGTTCTCGGGCGACGTGGTGCTCACGGCGCGGGACGAG
GCGCGGGGTCGGGCGGCCGTGCAGCAGCTGCAGGCTGAGGGCCTGAGCCCCCTTTTCCAC
CAGCTGGACATCGACGACCGGCAGAGCATCCGCGCCCTGCGTGACTTCCTGCGCAAGGAG
TACGGGGGCCTCGATGTGCTGGTCAACAACGCGGGCATTGCCTTCAAGACTGCTGACACC
ACACCATTTCACATTCAAGCAGAGGTGACTATGAAAACAAACTTCTTTGGCACCAGAGAT
GTGTGCACGGAGCTCCTGCCTCTAATAAAACCGCAAGGCAGAGTGGTGAATGTATCCAGC
TTTGTCAGTGTCAACTCTCTAAAGAAATGCAGCCGTGAACTGCAGCAGAAGTTTCGAAGT
GAGACCATCACAGAGGAGGAGCTGGTGGGGCTCATGAACAAGTTTGTGGAAGACACAAAG
AACGGGGTGCACAGGAAGGAGGGCTGGCCCGATACCGCATATGGAGTGACGAAAATTGGA
GTCACAGTCCTGTCCAGAATCCACGCCAGGAAACTGAGTGAGCAGAGAGGAGGGGACAAG
ATCCTCCTGAACGCCTGCTGCCCAGGGTGGGTGAGAACCGACATGGGGGGACCCAAAGCC
TCCAAAAGCCCAGAAGAAGGAGCAGAGACCCCCGTGTACTTGGCCCTTCTGCCCTCAGAT
GCTGAGGGGCCTCACGGAGAGTTCATTTCTGAGAAAAGAGTTGTGCAATGGTGA
Enzyme 6 GenBank Gene ID BC102943 Link Image
Enzyme 6 GeneCard ID CBR1 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:2
Enzyme 6 Locus 21q22.13
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References Not Available
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 1078
Enzyme 7 Name Leukotriene C4 synthase
Enzyme 7 Synonyms
  1. LTC4 synthase
  2. Leukotriene-C(4) synthase
Enzyme 7 Gene Name LTC4S
Enzyme 7 Protein Sequence >Leukotriene C4 synthase
MKDEVALLASVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERIYRAQVNCSEYF
PLFLAMLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQQRLAPLYASARALWLLVA
LAALGLLAHFLPAELRAALLGQLRKLLLRS
Enzyme 7 Number of Residues 150
Enzyme 7 Molecular Weight 16700.6
Enzyme 7 Theoretical pI 10.34
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Involved in enzyme activator activity
Enzyme 7 Specific Function Catalyzes the conjugation of leukotriene A4 with reduced glutathione to form leukotriene C4
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • 7-27 49-69 74-94 105-124
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 84201712 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q2NKS0 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name LTC4S_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >402 bp
ATGAAGGACGAGGTAGCTCTTCTGGCCTCTGTCACCCTCCTGGGCGTCCTGCTGCAAGCC
TACTTCTCTCTGCAGGTGATCTCGGCGCGCAGGGCCTTCCGCGTTTCGCCGCCGCTCACC
ACTGGCCCGCCGGAGTTCGAGCGCATCTACCGAGCCCAAGTGAACTGCAGCGAGTACTTC
CCGCTGTTCCTCGCCATGCTCTGGGTGGCCGGCATCTTCTTTCACGAAGGTGCGGCAGCA
CTGTGTGGTCTGGTCTACCTGTTCGCACGCCTACGCTACTTCCAGGGCTACGCGCGCTCT
GCGCAGCAGAGGCTGGCCCCGCTGTACGCGAGCGCGCGCGCGCTCTGGCTTCTCGTGGCC
CTGGCGGCCCTTGGCCTGCTCGCCCACTTCCTCCCGGCCTAG
Enzyme 7 GenBank Gene ID BC111676 Link Image
Enzyme 7 GeneCard ID LTC4S Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:5
Enzyme 7 Locus 5q35
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References
  1. [PubMed Link Image]
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 1241
Enzyme 8 Name Glutathione S-transferase theta-1
Enzyme 8 Synonyms
  1. GST class-theta-1
Enzyme 8 Gene Name GSTT1
Enzyme 8 Protein Sequence >Glutathione S-transferase theta-1
MGLELYLDLLSQPCRAIYIFAKKNRIPFELRTVDLRKGQHLSDAFAQVNPLQKVPILKDG
DFILTESVAILLYLARKYKVPDHWYPQDLQACARVDEYLAWQHTALRRNCLRALWHKVML
PVFLGEPVSPEMLATTLAELDMALQVLEGKFLQDKAFLTGSHISLADLVAITELMHPVGA
GCQVFKGRPKLAAWRQRVEAAVGEVLFQEAHEVILKAKDSQPADPTLKQKMLPKVLAMIQ
Enzyme 8 Number of Residues 240
Enzyme 8 Molecular Weight 27148.7
Enzyme 8 Theoretical pI 8.61
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 8 Specific Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Also binds steroids, bilirubin, carcinogens and numerous organic anions. Has dichloromethane dehalogenase activity
Enzyme 8 Pathways Not Available
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • None
Enzyme 8 Transmembrane Regions
  • None
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 84708805 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID Q2NL00 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name GSTT1_BOVIN Link Image
Enzyme 8 PDB ID Not Available
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence >723 bp
ATGGGCCTGGAGCTCTACCTGGACCTGCTGTCCCAACCCTGCCGCGCCATCTACATCTTC
GCCAAGAAGAACCGCATCCCCTTCGAGCTGCGCACCGTGGACCTGCGCAAAGGCCAGCAC
CTCAGCGATGCCTTTGCCCAGGTGAACCCCCTGCAGAAGGTGCCAATCTTGAAGGACGGG
GACTTCATCTTGACCGAGAGCGTGGCCATCCTGCTCTACCTGGCCCGCAAGTATAAGGTC
CCCGACCACTGGTACCCTCAGGACCTGCAGGCCTGTGCCCGTGTGGACGAGTACCTGGCC
TGGCAGCACACAGCCCTGCGGAGAAACTGCCTCCGAGCCCTGTGGCATAAGGTGATGCTC
CCTGTTTTCCTGGGTGAGCCGGTCTCTCCTGAGATGCTGGCGACCACGCTGGCAGAGTTG
GACATGGCCCTGCAGGTGCTTGAGGGCAAGTTCCTCCAGGACAAAGCCTTTCTCACCGGG
TCCCACATCTCTCTGGCTGACCTGGTAGCCATCACGGAGCTGATGCACCCCGTGGGTGCC
GGCTGCCAAGTCTTCAAAGGCCGACCCAAGCTGGCCGCATGGCGCCAGCGCGTGGAGGCG
GCGGTGGGGGAGGTCCTCTTCCAAGAGGCCCATGAGGTCATCCTGAAGGCCAAGGACTCT
CAGCCTGCAGACCCCACCTTAAAGCAGAAGATGCTGCCCAAAGTGCTGGCCATGATCCAG
TGA
Enzyme 8 GenBank Gene ID BC111289 Link Image
Enzyme 8 GeneCard ID GSTT1 Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:2
Enzyme 8 Locus 22q11.23
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References Not Available
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 1257
Enzyme 9 Name Microsomal glutathione S-transferase 3
Enzyme 9 Synonyms
  1. Microsomal GST-3
Enzyme 9 Gene Name MGST3
Enzyme 9 Protein Sequence >Microsomal glutathione S-transferase 3
MAVLSKEYGFVILTGAASFLMVTHLAINVSKARKKYKVEYPTMYSTDPENGHIFNCIQRA
HQNTLEVYPPFLFFLAVGGVYHPRIVSGLGLAWIVGRVLYAYGYYTGEPRKRQRGALSFI
ALIGLMGTTVCSAFQHLGWVRTGLNSGCKSCH
Enzyme 9 Number of Residues 152
Enzyme 9 Molecular Weight 16883.6
Enzyme 9 Theoretical pI 9.84
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Involved in glutathione transferase activity
Enzyme 9 Specific Function Also functions as a glutathione peroxidase
Enzyme 9 Pathways Not Available
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • None
Enzyme 9 Transmembrane Regions
  • 9-29 71-91 120-140
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 74353862 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID Q3T100 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name MGST3_BOVIN Link Image
Enzyme 9 PDB ID Not Available
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence >459 bp
ATGGCCGTCCTCTCTAAGGAATATGGTTTCGTGATTCTAACTGGTGCTGCCAGCTTCTTG
ATGGTAACTCATCTAGCCATCAATGTTTCTAAGGCCCGCAAGAAGTACAAAGTGGAGTAT
CCTACCATGTACAGCACTGACCCTGAAAACGGGCACATCTTCAACTGCATTCAGCGAGCT
CACCAGAACACGTTGGAAGTGTACCCTCCCTTCTTATTTTTTCTAGCTGTCGGAGGTGTT
TACCACCCACGTATAGTTTCTGGCTTGGGCTTGGCCTGGATCGTTGGACGAGTCCTTTAT
GCTTACGGCTATTACACAGGAGAACCCAGAAAGCGGCAGCGGGGAGCCCTGAGCTTCATC
GCCCTCATTGGCCTGATGGGCACCACTGTGTGCTCTGCCTTCCAGCATCTTGGTTGGGTT
AGAACCGGCTTGAACAGCGGGTGCAAGAGCTGCCATTGA
Enzyme 9 GenBank Gene ID BC102190 Link Image
Enzyme 9 GeneCard ID MGST3 Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Chromosome:1
Enzyme 9 Locus 1q23
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References Not Available
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 1258
Enzyme 10 Name Glutathione S-transferase
Enzyme 10 Synonyms Not Available
Enzyme 10 Gene Name GSTA4
Enzyme 10 Protein Sequence >Glutathione S-transferase
MATKPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLQKLQDGNHLLFQQVPMVEI
NGMKLVQTRSILHYIADKHHLFGKDLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKE
VANMAQKAIIRYFPVFEKVLRGHGQRFLVGNQLSLADIIQLQTILALEEKIPNILSAFPH
LQEYTVKISNIPTIKKFLEPGSKKKPPPDDIYVRTVYNIFMP
Enzyme 10 Number of Residues 222
Enzyme 10 Molecular Weight 25672.9
Enzyme 10 Theoretical pI 8.75
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Involved in glutathione transferase activity
Enzyme 10 Specific Function RX + glutathione = HX + R-S-glutathione
Enzyme 10 Pathways Not Available
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • None
Enzyme 10 Transmembrane Regions
  • None
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 81674797 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID Q32L24 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name Q32L24_BOVIN Link Image
Enzyme 10 PDB ID 1GUM Link Image
Enzyme 10 PDB File Show
Enzyme 10 3D Structure
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >669 bp
ATGGCCACGAAACCCAAGCTCCACTATCCCAACGGACGAGGCCGGATGGAATCTGTGCGA
TGGGTGTTAGCTGCTGCCGGAGTCGAGTTTGACGAAGAATTTTTAGAAACAAAAGAACAG
TTGCAGAAGTTGCAGGATGGTAACCACCTGCTGTTTCAGCAAGTGCCAATGGTTGAAATC
AACGGGATGAAGCTGGTACAGACCCGGAGCATCCTCCACTACATCGCAGACAAGCACCAT
CTCTTCGGCAAAGACCTCAAGGAGAGAACCCTGATTGACATGTATGTGGAGGGGACCCTG
GATCTTCTGGAACTGCTTATCATGCATCCTTTCCTCAAACCAGACGATCAGCAAAAGGAA
GTGGCTAATATGGCCCAGAAGGCTATAATTAGATACTTTCCTGTGTTCGAAAAGGTTTTA
CGGGGTCATGGACAAAGGTTTCTTGTTGGTAATCAGCTGAGTCTTGCAGACATAATTCAA
CTCCAGACCATTTTGGCTCTAGAAGAGAAAATTCCTAATATCCTGTCTGCCTTCCCTCAC
CTCCAGGAGTACACAGTGAAAATCAGTAATATCCCTACAATTAAGAAATTCCTTGAACCT
GGCAGCAAGAAGAAGCCTCCCCCCGATGACATCTACGTGAGAACCGTGTACAACATCTTC
ATGCCATAG
Enzyme 10 GenBank Gene ID BC109801 Link Image
Enzyme 10 GeneCard ID GSTA4 Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:6
Enzyme 10 Locus 6p12.1
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References Not Available
Enzyme 10 Metabolite References Not Available
Enzyme 11 [top]
Enzyme 11 ID 1259
Enzyme 11 Name Microsomal glutathione S-transferase 1
Enzyme 11 Synonyms
  1. Microsomal GST-1
Enzyme 11 Gene Name MGST1
Enzyme 11 Protein Sequence >Microsomal glutathione S-transferase 1
MANLSQLMENEVFMAFASYTTIVLSKMNFMSTATAFYRLTKKVFANPEDCAGFGKGENAK
KYLRTDDRVERVRRAHLNDLENIVPFLGIGLLYSLSGPDLSTAILHFRLFVRARIYHTIA
YLTPLPQPNRALAFFIGYGVTLSMAYRLLKSKLYL
Enzyme 11 Number of Residues 155
Enzyme 11 Molecular Weight 17644.5
Enzyme 11 Theoretical pI 10.12
Enzyme 11 GO Classification
Function
Process
Component
Enzyme 11 General Function Involved in glutathione transferase activity
Enzyme 11 Specific Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a wide substrate specificity
Enzyme 11 Pathways Not Available
Enzyme 11 Reactions Not Available
Enzyme 11 Pfam Domain Function
Enzyme 11 Signals
  • None
Enzyme 11 Transmembrane Regions
  • None
Enzyme 11 Essentiality Not Available
Enzyme 11 GenBank ID Protein 37702694 Link Image
Enzyme 11 UniProtKB/Swiss-Prot ID Q64L89 Link Image
Enzyme 11 UniProtKB/Swiss-Prot Entry Name MGST1_BOVIN Link Image
Enzyme 11 PDB ID Not Available
Enzyme 11 Cellular Location Not Available
Enzyme 11 Gene Sequence >468 bp
ATGGCCAACCTTTCGCAGCTAATGGAGAATGAAGTATTCATGGCCTTTGCCTCCTACACG
ACAATTGTGCTTTCAAAAATGAATTTTATGAGCACTGCAACTGCATTCTATAGACTGACA
AAAAAGGTTTTTGCCAATCCAGAAGACTGCGCGGGCTTCGGCAAAGGTGAAAATGCCAAG
AAGTATCTTCGGACAGATGACAGGGTGGAACGTGTTCGCAGAGCCCACTTGAATGACCTT
GAAAACATCGTGCCATTTCTTGGTATTGGCCTTCTGTATTCCTTGAGTGGTCCAGACCTC
TCTACAGCCATCCTGCACTTCAGACTCTTTGTCAGAGCACGAATCTACCACACGATTGCG
TATTTGACACCCCTTCCCCAGCCAAATCGTGCTTTGGCTTTTTTCATTGGCTATGGAGTT
ACACTTTCAATGGCTTACAGATTGCTGAAGAGTAAACTGTACCTGTAA
Enzyme 11 GenBank Gene ID AY334548 Link Image
Enzyme 11 GeneCard ID MGST1 Link Image
Enzyme 11 GenAtlas ID Not Available
Enzyme 11 HGNC ID Not Available
Enzyme 11 Chromosome Location Chromosome:1
Enzyme 11 Locus 12p12.3-p12.1
Enzyme 11 SNPs SNPJam Report Link Image
Enzyme 11 General References Not Available
Enzyme 11 Metabolite References Not Available
Enzyme 12 [top]
Enzyme 12 ID 1260
Enzyme 12 Name Glutathione S-transferase Mu 1
Enzyme 12 Synonyms
  1. GSTM1-1
  2. GST class-mu 1
Enzyme 12 Gene Name GSTM1
Enzyme 12 Protein Sequence >Glutathione S-transferase Mu 1
MPMILGYWDIRGLAHAIRLLLEYTDTNYEERQYSVGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKLTQSNAILRYIARKHNLCGETEEEMIRVDILENQVMDVRLAMARICYSPDF
EKLKPGFLKEIPEKIKLFSEFLGKRPWFAGDKLTYVDFLVYDVLDMHRIFEPKCLDAFPN
LKDFISRFEGLKKISAYMKSSRFLPGPLFMKLAVWGNK
Enzyme 12 Number of Residues 218
Enzyme 12 Molecular Weight 25634.6
Enzyme 12 Theoretical pI 7.49
Enzyme 12 GO Classification
Function
Process
Component
Enzyme 12 General Function Involved in glutathione transferase activity
Enzyme 12 Specific Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Protects against the thiol-mediated metal-catalysed oxidative inactivation of enzymes
Enzyme 12 Pathways Not Available
Enzyme 12 Reactions Not Available
Enzyme 12 Pfam Domain Function
Enzyme 12 Signals
  • None
Enzyme 12 Transmembrane Regions
  • None
Enzyme 12 Essentiality Not Available
Enzyme 12 GenBank ID Protein 73586890 Link Image
Enzyme 12 UniProtKB/Swiss-Prot ID Q9N0V4 Link Image
Enzyme 12 UniProtKB/Swiss-Prot Entry Name GSTM1_BOVIN Link Image
Enzyme 12 PDB ID Not Available
Enzyme 12 Cellular Location Not Available
Enzyme 12 Gene Sequence >657 bp
ATGCCCATGATCCTGGGTTACTGGGACATCCGCGGGCTGGCCCATGCCATCCGCCTTCTC
CTGGAGTACACAGACACAAACTATGAGGAGAGGCAGTACTCGGTAGGAGATGCTCCCGAC
TATGACAGAAGCCAGTGGCTGAATGAAAAATTCAAGCTGGGCCTGGACTTCCCCAATCTG
CCCTACTTAATCGATGGGACTCACAAGCTCACCCAGAGCAACGCCATCCTTCGGTACATC
GCTCGCAAGCACAACCTGTGTGGGGAGACAGAGGAGGAGATGATTCGTGTGGACATTTTG
GAGAACCAGGTTATGGATGTCCGCTTGGCCATGGCTAGGATCTGCTACAGCCCTGACTTT
GAGAAACTGAAGCCTGGTTTCTTGAAGGAGATCCCTGAAAAAATCAAGCTGTTCTCAGAG
TTTCTGGGGAAGAGGCCTTGGTTTGCAGGGGACAAGCTCACCTATGTGGATTTCCTGGTT
TATGACGTCCTTGACATGCACCGCATATTTGAGCCCAAGTGCCTGGACGCATTCCCAAAC
CTGAAAGACTTCATTTCTCGTTTTGAGGGCCTGAAGAAGATCTCTGCCTACATGAAGTCC
AGCCGCTTCCTCCCAGGCCCTCTGTTCATGAAGCTTGCCGTGTGGGGCAACAAGTAG
Enzyme 12 GenBank Gene ID BC102050 Link Image
Enzyme 12 GeneCard ID GSTM1 Link Image
Enzyme 12 GenAtlas ID Not Available
Enzyme 12 HGNC ID Not Available
Enzyme 12 Chromosome Location Chromosome:1
Enzyme 12 Locus 1p13.3
Enzyme 12 SNPs SNPJam Report Link Image
Enzyme 12 General References
  1. [PubMed Link Image]
Enzyme 12 Metabolite References Not Available
Enzyme 13 [top]
Enzyme 13 ID 1261
Enzyme 13 Name Hydroxyacylglutathione hydrolase, mitochondrial
Enzyme 13 Synonyms
  1. Glyoxalase II
  2. Glx II
Enzyme 13 Gene Name HAGH
Enzyme 13 Protein Sequence >Hydroxyacylglutathione hydrolase, mitochondrial
MVLGRGLLGRWSVAELGAVCARLGLGPALLGSLHHLGLRKSLTVDQGTMKVELLPALTDN
YMYLLIDEDTKEAAIVDPVQPQKVVETARKHGVKLTTVLTTHHHWDHAGGNEKLVKLEPG
LKVYGGDDRIGALTHKVTHLSTLQVGSLHVKCLSTPCHTSGHICYFVTKPNSPEPPAVFT
GDTLFVAGCGKFYEGTADEMYKALLEVLGRLPADTRVYCGHEYTINNLKFARHVEPDNTA
VREKLAWAKEKYSIGEPTVPSTIAEEFTYNPFMRVREKTVQQHAGETEPVATMRAIRKEK
DQFKMPRD
Enzyme 13 Number of Residues 308
Enzyme 13 Molecular Weight 34089.0
Enzyme 13 Theoretical pI 7.93
Enzyme 13 GO Classification
Function
Process
Component
Enzyme 13 General Function Involved in hydroxyacylglutathione hydrolase activity
Enzyme 13 Specific Function Thiolesterase that catalyzes the hydrolysis of S-D- lactoyl-glutathione to form glutathione and D-lactic acid
Enzyme 13 Pathways
  • Secondary metabolite metabolism
  • methylglyoxal degradation
  • (R)-lactate from methylglyoxal:step 2/2
Enzyme 13 Reactions Not Available
Enzyme 13 Pfam Domain Function
Enzyme 13 Signals
  • None
Enzyme 13 Transmembrane Regions
  • None
Enzyme 13 Essentiality Not Available
Enzyme 13 GenBank ID Protein 77567664 Link Image
Enzyme 13 UniProtKB/Swiss-Prot ID Q3B7M2 Link Image
Enzyme 13 UniProtKB/Swiss-Prot Entry Name GLO2_BOVIN Link Image
Enzyme 13 PDB ID 1QH3 Link Image
Enzyme 13 PDB File Show
Enzyme 13 3D Structure
Enzyme 13 Cellular Location Not Available
Enzyme 13 Gene Sequence >927 bp
ATGGTGCTGGGCCGCGGGCTGCTCGGCCGCTGGAGCGTCGCAGAGCTGGGAGCCGTCTGC
GCTCGTCTCGGCCTGGGTCCAGCCCTGCTGGGAAGCCTCCACCACTTGGGTTTAAGGAAG
AGCTTGACCGTGGATCAGGGCACCATGAAGGTGGAGTTACTGCCGGCTCTGACCGACAAT
TACATGTACCTGCTCATTGATGAGGACACCAAGGAGGCGGCCATTGTGGATCCGGTGCAG
CCCCAGAAGGTGGTGGAAACGGCGAGGAAGCACGGCGTGAAGCTGACCACAGTGCTCACC
ACCCACCACCACTGGGACCACGCTGGCGGGAACGAGAAGCTGGTCAAGCTGGAACCTGGG
TTGAAGGTGTACGGGGGTGATGACCGGATTGGGGCCCTGACTCACAAGGTCACACACCTG
TCCACACTGCAGGTGGGGTCTCTCCATGTCAAGTGCCTGTCGACGCCGTGTCACACTTCC
GGACACATCTGTTACTTTGTGACCAAGCCCAACAGTCCCGAGCCGCCCGCTGTGTTCACA
GGTGACACCTTGTTTGTGGCCGGCTGCGGGAAGTTCTATGAAGGGACAGCGGATGAGATG
TACAAAGCCCTGCTCGAGGTCCTGGGCCGGCTCCCTGCAGACACGAGAGTGTACTGTGGC
CATGAATACACCATCAACAACCTGAAGTTTGCTCGCCACGTGGAGCCCGACAACACTGCC
GTCCGGGAGAAACTGGCCTGGGCCAAGGAGAAGTACAGCATCGGGGAGCCCACGGTGCCA
TCCACCATCGCCGAGGAGTTCACCTACAACCCATTCATGCGAGTGAGGGAGAAGACGGTG
CAGCAGCACGCGGGCGAGACGGAGCCTGTGGCCACCATGAGGGCCATCCGCAAAGAGAAG
GACCAGTTCAAGATGCCGCGGGACTAG
Enzyme 13 GenBank Gene ID BC107545 Link Image
Enzyme 13 GeneCard ID HAGH Link Image
Enzyme 13 GenAtlas ID Not Available
Enzyme 13 HGNC ID Not Available
Enzyme 13 Chromosome Location Chromosome:1
Enzyme 13 Locus 16p13.3
Enzyme 13 SNPs SNPJam Report Link Image
Enzyme 13 General References Not Available
Enzyme 13 Metabolite References Not Available
Enzyme 14 [top]
Enzyme 14 ID 1262
Enzyme 14 Name 4-HYDROXYNONENAL metabolizing glutathione S-transferase
Enzyme 14 Synonyms Not Available
Enzyme 14 Gene Name Not Available
Enzyme 14 Protein Sequence >4-HYDROXYNONENAL metabolizing glutathione S-transferase
IAVAPFKTPKEKEESYDLIL
Enzyme 14 Number of Residues 20
Enzyme 14 Molecular Weight 2291.6
Enzyme 14 Theoretical pI 4.59
Enzyme 14 GO Classification
Function
Process
Component
Enzyme 14 General Function Involved in glutathione transferase activity
Enzyme 14 Specific Function Not Available
Enzyme 14 Pathways Not Available
Enzyme 14 Reactions Not Available
Enzyme 14 Pfam Domain Function Not Available
Enzyme 14 Signals
  • None
Enzyme 14 Transmembrane Regions
  • None
Enzyme 14 Essentiality Not Available
Enzyme 14 GenBank ID Protein Not Available
Enzyme 14 UniProtKB/Swiss-Prot ID Q9TQX5 Link Image
Enzyme 14 UniProtKB/Swiss-Prot Entry Name Q9TQX5_BOVIN Link Image
Enzyme 14 PDB ID 1GUK Link Image
Enzyme 14 PDB File Show
Enzyme 14 3D Structure
Enzyme 14 Cellular Location Not Available
Enzyme 14 Gene Sequence Not Available
Enzyme 14 GenBank Gene ID Not Available
Enzyme 14 GeneCard ID Not Available
Enzyme 14 GenAtlas ID Not Available
Enzyme 14 HGNC ID Not Available
Enzyme 14 Chromosome Location Not Available
Enzyme 14 Locus Not Available
Enzyme 14 SNPs SNPJam Report Link Image
Enzyme 14 General References
  1. [PubMed Link Image]
Enzyme 14 Metabolite References Not Available
Enzyme 15 [top]
Enzyme 15 ID 1263
Enzyme 15 Name Glutathione S-transferase A4
Enzyme 15 Synonyms
  1. Glutathione S-transferase alpha-4
  2. GST class-alpha member 4
Enzyme 15 Gene Name GSTA4
Enzyme 15 Protein Sequence >Glutathione S-transferase A4
MATKPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLQKLQDGNHLLFQQVPMVEI
DGMKLVQTRSILHYIADKHHLFGKDLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKE
VANMAQKAIIRYFPVFEKVLRGHGQRFLVGNQLSLADIILLQTILALEEKIPNILSAFPH
LQEYTVKISNIPTIKKFLEPGSKKKPPPDDIYVRTVYNIFMP
Enzyme 15 Number of Residues 222
Enzyme 15 Molecular Weight 25658.9
Enzyme 15 Theoretical pI 7.97
Enzyme 15 GO Classification
Function
Process
Component
Enzyme 15 General Function Involved in glutathione transferase activity
Enzyme 15 Specific Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles
Enzyme 15 Pathways Not Available
Enzyme 15 Reactions Not Available
Enzyme 15 Pfam Domain Function
Enzyme 15 Signals
  • None
Enzyme 15 Transmembrane Regions
  • None
Enzyme 15 Essentiality Not Available
Enzyme 15 GenBank ID Protein 59858285 Link Image
Enzyme 15 UniProtKB/Swiss-Prot ID Q5E9G0 Link Image
Enzyme 15 UniProtKB/Swiss-Prot Entry Name GSTA4_BOVIN Link Image
Enzyme 15 PDB ID 1GUM Link Image
Enzyme 15 PDB File Show
Enzyme 15 3D Structure
Enzyme 15 Cellular Location Not Available
Enzyme 15 Gene Sequence >669 bp
ATGGCCACGAAACCCAAGCTCCACTATCCCAACGGACGAGGCCGGATGGAATCTGTGCGA
TGGGTGTTAGCTGCTGCCGGAGTCGAGTTTGACGAAGAATTTTTAGAAACAAAAGAACAG
TTGCAGAAGTTGCAGGATGGTAACCACCTGCTGTTTCAGCAAGTGCCAATGGTTGAAATC
GACGGGATGAAGCTGGTGCAGACCCGGAGCATCCTCCACTACATCGCAGACAAGCACCAT
CTCTTCGGCAAAGACCTCAAGGAGAGAACCCTGATTGACATGTATGTGGAGGGGACCCTG
GATCTTCTGGAACTGCTTATCATGCATCCTTTCCTCAAACCAGACGATCAGCAAAAGGAA
GTGGCTAATATGGCCCAGAAGGCTATAATTAGATACTTTCCTGTGTTCGAAAAGGTTTTA
CGGGGTCATGGACAAAGGTTTCTTGTTGGTAATCAGCTGAGTCTTGCAGACATAATTCTA
CTCCAGACCATTTTGGCTCTAGAAGAGAAAATTCCTAATATCCTGTCTGCCTTCCCTCAC
CTCCAGGAGTACACAGTGAAAATCAGTAATATCCCTACAATTAAGAAATTCCTTGAACCT
GGCAGCAAGAAGAAGCCTCCCCCCGATGACATCTACGTGAGAACCGTGTACAACATCTTC
ATGCCATAG
Enzyme 15 GenBank Gene ID BT020960 Link Image
Enzyme 15 GeneCard ID GSTA4 Link Image
Enzyme 15 GenAtlas ID Not Available
Enzyme 15 HGNC ID Not Available
Enzyme 15 Chromosome Location Chromosome:6
Enzyme 15 Locus 6p12.1
Enzyme 15 SNPs SNPJam Report Link Image
Enzyme 15 General References
  1. [PubMed Link Image]
Enzyme 15 Metabolite References Not Available
Enzyme 16 [top]
Enzyme 16 ID 1264
Enzyme 16 Name Glutathione S-transferase mu 3 (Brain)
Enzyme 16 Synonyms Not Available
Enzyme 16 Gene Name GSTM3
Enzyme 16 Protein Sequence >Glutathione S-transferase mu 3 (Brain)
MASSKSMVLGYWDIRGLAHAIRMLLEFTDTSYEEKRYTCGEAPDYDKSQWLDVKFKLDLD
FPNLPYLMDGKNRLTQSNAILRYIARKHNMCGDTEEERIRVDIMENQIMDFRMQLVQLCY
NPDHEKLKPRYLEQLPGQLKQFSLFLGKYSWFAGEKLTFVDFLTYDVLDQNRMFEPKCLD
EFPNLKAFMCRFEALEKIATYMQSDRFLKMPVNNKMAQWGNRRIC
Enzyme 16 Number of Residues 225
Enzyme 16 Molecular Weight 26849.8
Enzyme 16 Theoretical pI 7.30
Enzyme 16 GO Classification
Function
Process
Component
Enzyme 16 General Function Involved in glutathione transferase activity
Enzyme 16 Specific Function Not Available
Enzyme 16 Pathways Not Available
Enzyme 16 Reactions Not Available
Enzyme 16 Pfam Domain Function
Enzyme 16 Signals
  • None
Enzyme 16 Transmembrane Regions
  • None
Enzyme 16 Essentiality Not Available
Enzyme 16 GenBank ID Protein 86827371 Link Image
Enzyme 16 UniProtKB/Swiss-Prot ID Q2KIV8 Link Image
Enzyme 16 UniProtKB/Swiss-Prot Entry Name Q2KIV8_BOVIN Link Image
Enzyme 16 PDB ID 3GTU Link Image
Enzyme 16 PDB File Show
Enzyme 16 3D Structure
Enzyme 16 Cellular Location Not Available
Enzyme 16 Gene Sequence >678 bp
ATGGCTTCGTCAAAGTCTATGGTTCTAGGTTACTGGGATATTCGCGGGCTGGCGCACGCC
ATCCGCATGCTCCTGGAGTTCACGGATACGTCCTATGAAGAGAAAAGATACACGTGCGGG
GAAGCTCCTGACTATGATAAGAGCCAGTGGCTGGATGTGAAATTCAAACTAGACCTGGAC
TTCCCTAACCTGCCCTATCTCATGGACGGTAAGAACAGGCTGACCCAGAGCAATGCCATC
TTGCGCTACATCGCCCGCAAGCACAATATGTGCGGTGACACTGAAGAGGAAAGGATTCGA
GTGGACATCATGGAGAACCAAATAATGGATTTTCGCATGCAACTGGTACAACTCTGCTAC
AACCCTGACCACGAAAAGCTGAAGCCTCGGTACTTGGAACAGCTACCTGGACAACTGAAA
CAGTTCTCTTTGTTCTTGGGGAAATACTCATGGTTTGCAGGGGAAAAGCTCACCTTTGTG
GATTTCCTCACCTATGATGTCTTAGATCAGAACCGTATGTTTGAGCCCAAGTGCCTGGAT
GAATTTCCGAATCTGAAGGCTTTCATGTGCCGTTTTGAGGCTTTGGAGAAAATAGCTACC
TACATGCAGTCTGACCGCTTCCTTAAGATGCCTGTCAACAACAAGATGGCCCAGTGGGGC
AACAGGAGAATCTGCTGA
Enzyme 16 GenBank Gene ID BC112491 Link Image
Enzyme 16 GeneCard ID GSTM3 Link Image
Enzyme 16 GenAtlas ID Not Available
Enzyme 16 HGNC ID Not Available
Enzyme 16 Chromosome Location Chromosome:1
Enzyme 16 Locus 1p13.3
Enzyme 16 SNPs SNPJam Report Link Image
Enzyme 16 General References Not Available
Enzyme 16 Metabolite References Not Available
Enzyme 17 [top]
Enzyme 17 ID 1265
Enzyme 17 Name Glutathione S-transferase
Enzyme 17 Synonyms Not Available
Enzyme 17 Gene Name GSTA3
Enzyme 17 Protein Sequence >Glutathione S-transferase
MAAKPKLWYFHGRGRMESIRWLLAAAGVEFEEEFLETREQYEKLQKDGRLLFGQVPLVEI
DGMELTQTRAILSYLAAKYNLHGKDLKETVRIDMYADGTLDLMLMVALAAFKHPEEKEES
LALAVKKAKTRYFPVFEKILKDHGEDFLVGNKFSWADIQLLEVILTMEELDASVLSDFPL
LKEFKTRISNIPTIKKFLQPGSQRKPPPDSHYVEVVRNILQF
Enzyme 17 Number of Residues 222
Enzyme 17 Molecular Weight 25649.6
Enzyme 17 Theoretical pI 6.38
Enzyme 17 GO Classification
Function
Process
Component
Enzyme 17 General Function Involved in glutathione transferase activity
Enzyme 17 Specific Function RX + glutathione = HX + R-S-glutathione
Enzyme 17 Pathways Not Available
Enzyme 17 Reactions Not Available
Enzyme 17 Pfam Domain Function
Enzyme 17 Signals
  • None
Enzyme 17 Transmembrane Regions
  • None
Enzyme 17 Essentiality Not Available
Enzyme 17 GenBank ID Protein 94574232 Link Image
Enzyme 17 UniProtKB/Swiss-Prot ID Q1JQ90 Link Image
Enzyme 17 UniProtKB/Swiss-Prot Entry Name Q1JQ90_BOVIN Link Image
Enzyme 17 PDB ID Not Available
Enzyme 17 Cellular Location Not Available
Enzyme 17 Gene Sequence >669 bp
ATGGCGGCCAAACCCAAGCTCTGGTACTTCCACGGCCGAGGCAGGATGGAGTCTATCCGC
TGGCTGCTGGCTGCAGCTGGTGTGGAGTTTGAAGAAGAATTTCTTGAAACAAGAGAACAA
TATGAGAAGTTGCAGAAGGACGGACGCCTGCTTTTCGGCCAGGTGCCTCTGGTTGAAATT
GATGGAATGGAGCTGACACAGACAAGAGCCATCCTCAGCTACCTTGCTGCCAAGTACAAC
TTGCATGGGAAGGACCTGAAGGAGACAGTCAGGATCGACATGTACGCCGACGGCACCCTG
GATCTCATGCTGATGGTGGCGCTGGCTGCGTTCAAACACCCGGAGGAAAAAGAGGAGAGC
CTGGCTTTAGCCGTGAAGAAAGCTAAAACCCGGTACTTCCCCGTCTTTGAAAAGATTTTG
AAAGACCACGGAGAGGATTTTCTCGTTGGCAACAAATTTAGCTGGGCAGACATACAGCTC
CTGGAAGTTATTTTAACAATGGAAGAACTTGATGCTTCTGTTCTTTCCGATTTCCCTCTG
CTAAAGGAATTTAAGACAAGAATCAGCAACATTCCTACCATTAAGAAGTTCCTGCAGCCT
GGGAGTCAGAGGAAGCCGCCCCCGGATAGCCACTATGTTGAGGTTGTCAGGAACATCTTG
CAGTTCTAA
Enzyme 17 GenBank Gene ID BC116161 Link Image
Enzyme 17 GeneCard ID GSTA3 Link Image
Enzyme 17 GenAtlas ID Not Available
Enzyme 17 HGNC ID Not Available
Enzyme 17 Chromosome Location Chromosome:6
Enzyme 17 Locus 6p12.1
Enzyme 17 SNPs SNPJam Report Link Image
Enzyme 17 General References Not Available
Enzyme 17 Metabolite References Not Available
Enzyme 18 [top]
Enzyme 18 ID 1266
Enzyme 18 Name Glutathione peroxidase 7
Enzyme 18 Synonyms Not Available
Enzyme 18 Gene Name GPX7
Enzyme 18 Protein Sequence >Glutathione peroxidase 7
MVAARAAAWLLLAAAACAPREQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTD
QHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVT
GTGAHPAFKYLTETSGKEPTWNFWKYLVAPDGKVIGAWDPTVSVEEIRPQITALVRKLIL
KKREDL
Enzyme 18 Number of Residues 186
Enzyme 18 Molecular Weight 20907.8
Enzyme 18 Theoretical pI 9.12
Enzyme 18 GO Classification
Function
Process
Component
Enzyme 18 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 18 Specific Function 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O
Enzyme 18 Pathways Not Available
Enzyme 18 Reactions Not Available
Enzyme 18 Pfam Domain Function
Enzyme 18 Signals
  • 1-18
Enzyme 18 Transmembrane Regions
  • None
Enzyme 18 Essentiality Not Available
Enzyme 18 GenBank ID Protein 151553824 Link Image
Enzyme 18 UniProtKB/Swiss-Prot ID A6QLY2 Link Image
Enzyme 18 UniProtKB/Swiss-Prot Entry Name GPX7_BOVIN Link Image
Enzyme 18 PDB ID Not Available
Enzyme 18 Cellular Location Not Available
Enzyme 18 Gene Sequence >561 bp
ATGGTGGCGGCACGGGCGGCGGCGTGGCTGCTCCTGGCTGCGGCGGCCTGCGCGCCGCGG
GAGCAGGACTTCTACGACTTCAAGGCCGTCAACATCCGGGGCAAGTTGGTGTCGCTGGAG
AAGTACCGAGGCTCGGTGTCCCTGGTGGTGAACGTGGCTAGCGAGTGTGGCTTCACAGAC
CAGCACTATCGGGCCCTGCAGCAGCTGCAGCGGGACCTGGGGCCCCACCACTTCAATGTG
CTTGCCTTCCCCTGCAACCAGTTTGGCCAGCAGGAGCCCGACAGCAACAAGGAGATCGAG
AGCTTTGCCCGCCGCACATACAGTGTCTCTTTCCCCATGTTTAGCAAGATTGCAGTCACC
GGCACTGGTGCCCACCCTGCCTTCAAGTACCTGACTGAGACTTCTGGGAAGGAGCCTACC
TGGAACTTCTGGAAGTACCTGGTGGCCCCAGATGGAAAGGTGATAGGAGCTTGGGACCCA
ACTGTGTCGGTGGAGGAAATCAGGCCCCAGATTACAGCGCTTGTGAGGAAACTCATCCTG
AAGAAGCGAGAAGACTTATAA
Enzyme 18 GenBank Gene ID BC148128 Link Image
Enzyme 18 GeneCard ID GPX7 Link Image
Enzyme 18 GenAtlas ID Not Available
Enzyme 18 HGNC ID Not Available
Enzyme 18 Chromosome Location Chromosome:1
Enzyme 18 Locus 1p32
Enzyme 18 SNPs SNPJam Report Link Image
Enzyme 18 General References Not Available
Enzyme 18 Metabolite References Not Available
Enzyme 19 [top]
Enzyme 19 ID 1267
Enzyme 19 Name Glutathione S-transferase
Enzyme 19 Synonyms Not Available
Enzyme 19 Gene Name Not Available
Enzyme 19 Protein Sequence >Glutathione S-transferase
PPYTIVYFPVQGRXEAMRMLL
Enzyme 19 Number of Residues 21
Enzyme 19 Molecular Weight 2438.9
Enzyme 19 Theoretical pI 9.17
Enzyme 19 GO Classification
Function
Process
Component
Enzyme 19 General Function Involved in glutathione transferase activity
Enzyme 19 Specific Function Not Available
Enzyme 19 Pathways Not Available
Enzyme 19 Reactions Not Available
Enzyme 19 Pfam Domain Function Not Available
Enzyme 19 Signals
  • None
Enzyme 19 Transmembrane Regions
  • None
Enzyme 19 Essentiality Not Available
Enzyme 19 GenBank ID Protein Not Available
Enzyme 19 UniProtKB/Swiss-Prot ID Q9TRQ0 Link Image
Enzyme 19 UniProtKB/Swiss-Prot Entry Name Q9TRQ0_BOVIN Link Image
Enzyme 19 PDB ID 1GSY Link Image
Enzyme 19 PDB File Show
Enzyme 19 3D Structure
Enzyme 19 Cellular Location Not Available
Enzyme 19 Gene Sequence Not Available
Enzyme 19 GenBank Gene ID Not Available
Enzyme 19 GeneCard ID Not Available
Enzyme 19 GenAtlas ID Not Available
Enzyme 19 HGNC ID Not Available
Enzyme 19 Chromosome Location Not Available
Enzyme 19 Locus Not Available
Enzyme 19 SNPs SNPJam Report Link Image
Enzyme 19 General References
  1. [PubMed Link Image]
Enzyme 19 Metabolite References Not Available
Enzyme 20 [top]
Enzyme 20 ID 1268
Enzyme 20 Name Glutathione S-transferase
Enzyme 20 Synonyms Not Available
Enzyme 20 Gene Name GSTA5
Enzyme 20 Protein Sequence >Glutathione S-transferase
MAGKPKLHYFDARGRMEAIRWLLAAAGAEFEEKLIESSEDLDKLRYDGSLVFQQVPMVEI
DGMKLVQTRAILNYIATKYDLYGKDMKERALIDMYTEGVADLGEMIMLLPLCPPDQKNTK
LTLIQERATNRYLPAFENVLKSHRQDYLVGNKLSKADIHLVELLYYVEELDPSLLANFPL
LKGLKTRVSNLPAVKKFLQPGSQRKLPGGEKSLERARKIFKF
Enzyme 20 Number of Residues 222
Enzyme 20 Molecular Weight 25393.4
Enzyme 20 Theoretical pI 9.36
Enzyme 20 GO Classification
Function
Process
Component
Enzyme 20 General Function Involved in glutathione transferase activity
Enzyme 20 Specific Function RX + glutathione = HX + R-S-glutathione
Enzyme 20 Pathways Not Available
Enzyme 20 Reactions Not Available
Enzyme 20 Pfam Domain Function
Enzyme 20 Signals
  • None
Enzyme 20 Transmembrane Regions
  • None
Enzyme 20 Essentiality Not Available
Enzyme 20 GenBank ID Protein 148744853 Link Image
Enzyme 20 UniProtKB/Swiss-Prot ID A5PJE0 Link Image
Enzyme 20 UniProtKB/Swiss-Prot Entry Name A5PJE0_BOVIN Link Image
Enzyme 20 PDB ID Not Available
Enzyme 20 Cellular Location Not Available
Enzyme 20 Gene Sequence >669 bp
ATGGCAGGGAAGCCCAAGCTTCACTATTTCGATGCCCGAGGCAGGATGGAGGCCATCCGG
TGGCTCCTGGCTGCAGCTGGAGCGGAGTTTGAAGAGAAACTTATAGAAAGTTCAGAAGAT
TTGGATAAGTTAAGATATGATGGGAGTTTAGTGTTCCAGCAAGTGCCAATGGTTGAAATT
GATGGGATGAAGCTGGTGCAGACCAGAGCCATTCTCAACTACATTGCCACCAAATATGAT
CTCTATGGGAAAGACATGAAGGAGAGAGCCCTGATTGATATGTACACAGAGGGTGTGGCA
GACTTGGGGGAAATGATCATGCTCTTGCCACTGTGTCCCCCTGATCAAAAAAATACCAAG
TTGACCCTGATCCAAGAGAGGGCAACAAACCGTTATCTCCCTGCATTTGAAAACGTGCTG
AAGAGCCACAGACAAGACTATCTTGTGGGCAACAAGCTGAGCAAGGCTGACATCCACCTG
GTTGAATTGCTCTATTATGTGGAAGAGCTAGACCCCAGTCTTTTGGCCAATTTCCCTCTG
CTGAAGGGCCTGAAAACCAGAGTCAGCAATCTCCCGGCCGTGAAGAAGTTTCTGCAGCCT
GGCAGCCAGAGGAAGCTTCCGGGGGGTGAGAAAAGTCTTGAACGAGCCAGAAAGATTTTC
AAGTTTTAA
Enzyme 20 GenBank Gene ID BC142067 Link Image
Enzyme 20 GeneCard ID GSTA5 Link Image
Enzyme 20 GenAtlas ID Not Available
Enzyme 20 HGNC ID Not Available
Enzyme 20 Chromosome Location Chromosome:6
Enzyme 20 Locus 6p12.1
Enzyme 20 SNPs SNPJam Report Link Image
Enzyme 20 General References Not Available
Enzyme 20 Metabolite References Not Available
Enzyme 21 [top]
Enzyme 21 ID 1269
Enzyme 21 Name Glutathione S-transferase P
Enzyme 21 Synonyms
  1. GST class-pi
Enzyme 21 Gene Name GSTP1
Enzyme 21 Protein Sequence >Glutathione S-transferase P
MPPYTIVYFPVQGRCEAMRMLLADQGQSWKEEVVAMQSWLQGPLKASCLYGQLPKFQDGD
LTLYQSNAILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKEDYV
KALPQHLKPFETLLSQNKGGQAFIVGDQISFADYNLLDLLRIHQVLAPSCLDSFPLLSAY
VARLNSRPKLKAFLASPEHMNRPINGNGKQ
Enzyme 21 Number of Residues 210
Enzyme 21 Molecular Weight 23613.0
Enzyme 21 Theoretical pI 7.44
Enzyme 21 GO Classification
Function
Process
Component
Enzyme 21 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 21 Specific Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles
Enzyme 21 Pathways Not Available
Enzyme 21 Reactions Not Available
Enzyme 21 Pfam Domain Function
Enzyme 21 Signals
  • None
Enzyme 21 Transmembrane Regions
  • None
Enzyme 21 Essentiality Not Available
Enzyme 21 GenBank ID Protein 404 Link Image
Enzyme 21 UniProtKB/Swiss-Prot ID P28801 Link Image
Enzyme 21 UniProtKB/Swiss-Prot Entry Name GSTP1_BOVIN Link Image
Enzyme 21 PDB ID Not Available
Enzyme 21 Cellular Location Not Available
Enzyme 21 Gene Sequence >633 bp
ATGCCTCCCTACACCATCGTCTACTTCCCGGTTCAAGGGCGCTGCGAGGCCATGCGCATG
CTGCTGGCCGACCAGGGCCAGAGCTGGAAGGAGGAGGTCGTAGCCATGCAGAGCTGGCTG
CAGGGCCCACTCAAGGCCTCCTGCCTGTACGGGCAGCTCCCCAAGTTCCAGGACGGAGAC
CTCACGCTGTACCAGTCCAATGCCATCCTGCGGCACCTGGGCCGCACCCTCGGGCTGTAT
GGGAAGGACCAGCAGGAGGCGGCCCTGGTGGACATGGTGAATGACGGTGTAGAGGACCTT
CGCTGCAAATACGTCTCCCTCATTTACACCAACTACGAGGCGGGCAAGGAGGACTATGTG
AAGGCGCTGCCCCAGCACCTGAAGCCTTTCGAGACCCTGCTGTCCCAGAACAAGGGTGGC
CAGGCCTTCATCGTGGGCGACCAGATCTCCTTTGCGGACTACAACCTGCTGGACCTGCTT
CGGATTCACCAGGTCCTGGCCCCCAGCTGTCTGGACTCCTTCCCCCTGCTCTCAGCCTAC
GTGGCCCGTCTCAACTCCCGGCCCAAGCTCAAGGCCTTCCTGGCCTCCCCCGAGCACATG
AACCGGCCCATCAACGGCAATGGGAAACAGTGA
Enzyme 21 GenBank Gene ID X61233 Link Image
Enzyme 21 GeneCard ID GSTP1 Link Image
Enzyme 21 GenAtlas ID Not Available
Enzyme 21 HGNC ID Not Available
Enzyme 21 Chromosome Location Chromosome:1
Enzyme 21 Locus 11q13
Enzyme 21 SNPs SNPJam Report Link Image
Enzyme 21 General References
  1. [PubMed Link Image]
Enzyme 21 Metabolite References Not Available
Enzyme 22 [top]
Enzyme 22 ID 1270
Enzyme 22 Name Microsomal glutathione S-transferase 2
Enzyme 22 Synonyms
  1. Microsomal GST-2
Enzyme 22 Gene Name MGST2
Enzyme 22 Protein Sequence >Microsomal glutathione S-transferase 2
MAGNSILLAALSVLSACQQSYFAMQVGKARSKYKVTPPSVSGSPDFERIFRAQQNCVEFY
PIFIITLWMAGWYFNQVFATCLGLVYIYSRHQYFWGYAEAAKKRVTGFRLSLGVLALLTV
LGAVGILNSFLDEYLDIDIAKKLRHF
Enzyme 22 Number of Residues 146
Enzyme 22 Molecular Weight 16483.1
Enzyme 22 Theoretical pI 9.55
Enzyme 22 GO Classification
Function
Process
Component
Enzyme 22 General Function Involved in enzyme activator activity
Enzyme 22 Specific Function Can catalyze the production of LTC4 from LTA4 and reduced glutathione. Can catalyze the conjugation of 1-chloro-2,4- dinitrobenzene with reduced glutathione
Enzyme 22 Pathways Not Available
Enzyme 22 Reactions Not Available
Enzyme 22 Pfam Domain Function
Enzyme 22 Signals
  • None
Enzyme 22 Transmembrane Regions
  • 6-26 59-79 111-131
Enzyme 22 Essentiality Not Available
Enzyme 22 GenBank ID Protein 95768959 Link Image
Enzyme 22 UniProtKB/Swiss-Prot ID Q2KJG4 Link Image
Enzyme 22 UniProtKB/Swiss-Prot Entry Name MGST2_BOVIN Link Image
Enzyme 22 PDB ID Not Available
Enzyme 22 Cellular Location Not Available
Enzyme 22 Gene Sequence >441 bp
ATGGCAGGGAATTCGATATTGCTGGCTGCACTCTCTGTCCTCTCAGCCTGTCAGCAAAGT
TATTTTGCTATGCAGGTAGGAAAGGCGAGATCAAAATACAAAGTTACGCCCCCATCAGTC
TCTGGGTCGCCAGATTTTGAGAGAATATTTCGTGCACAGCAAAACTGTGTGGAGTTTTAC
CCAATATTCATAATCACATTGTGGATGGCTGGATGGTATTTCAACCAAGTTTTTGCTACT
TGTCTGGGTCTGGTGTACATCTATTCCCGTCACCAGTATTTCTGGGGATACGCAGAAGCT
GCTAAAAAAAGGGTCACTGGTTTCCGGCTGAGTCTGGGGGTTTTGGCCTTATTGACTGTC
CTAGGTGCCGTGGGGATTTTGAACAGCTTTCTGGATGAATACCTGGACATCGATATTGCC
AAGAAACTGAGGCACTTCTAA
Enzyme 22 GenBank Gene ID BT025439 Link Image
Enzyme 22 GeneCard ID MGST2 Link Image
Enzyme 22 GenAtlas ID Not Available
Enzyme 22 HGNC ID Not Available
Enzyme 22 Chromosome Location Chromosome:4
Enzyme 22 Locus 4q28.3
Enzyme 22 SNPs SNPJam Report Link Image
Enzyme 22 General References
  1. [PubMed Link Image]
Enzyme 22 Metabolite References Not Available
Enzyme 23 [top]
Enzyme 23 ID 1271
Enzyme 23 Name Glutathione S-transferase omega 1
Enzyme 23 Synonyms Not Available
Enzyme 23 Gene Name GSTO1
Enzyme 23 Protein Sequence >Glutathione S-transferase omega 1
MSGGSARSLGKGSAPPGPVPEGLIRVYSMRFCPYAQRTRLVLTAKGIRHEVININLKNKP
EWFFKKNPSGLVPVLETSQGQLICESAITCEYLDEAYPGKKLLPGDPYEKACQKMVLESF
SKVPPLILKILRTQNKEDCSGLK
Enzyme 23 Number of Residues 143
Enzyme 23 Molecular Weight 15807.4
Enzyme 23 Theoretical pI 9.68
Enzyme 23 GO Classification
Function
Process
Component
Enzyme 23 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 23 Specific Function Not Available
Enzyme 23 Pathways Not Available
Enzyme 23 Reactions Not Available
Enzyme 23 Pfam Domain Function
Enzyme 23 Signals
  • None
Enzyme 23 Transmembrane Regions
  • None
Enzyme 23 Essentiality Not Available
Enzyme 23 GenBank ID Protein 111307115 Link Image
Enzyme 23 UniProtKB/Swiss-Prot ID Q0VCE1 Link Image
Enzyme 23 UniProtKB/Swiss-Prot Entry Name Q0VCE1_BOVIN Link Image
Enzyme 23 PDB ID Not Available
Enzyme 23 Cellular Location Not Available
Enzyme 23 Gene Sequence >432 bp
ATGTCCGGAGGATCAGCTAGGAGCCTGGGCAAGGGAAGCGCCCCCCCGGGGCCCGTCCCC
GAGGGCCTGATCCGTGTCTACAGCATGAGGTTCTGCCCGTATGCCCAGAGGACTCGCCTG
GTCCTGACGGCCAAGGGTATCCGGCATGAAGTCATCAACATCAACCTGAAAAATAAGCCT
GAGTGGTTCTTCAAGAAGAATCCCTCAGGCCTGGTGCCGGTTCTGGAAACCAGTCAGGGT
CAATTGATCTGTGAATCTGCCATCACTTGTGAGTACCTGGATGAAGCATATCCAGGGAAG
AAGCTGTTGCCAGGCGACCCCTATGAGAAAGCTTGCCAAAAGATGGTCTTGGAGTCCTTT
TCTAAGGTACCACCTTTGATATTGAAGATTCTTAGAACACAAAATAAGGAAGACTGCTCT
GGCCTAAAATAA
Enzyme 23 GenBank Gene ID BC120211 Link Image
Enzyme 23 GeneCard ID GSTO1 Link Image
Enzyme 23 GenAtlas ID Not Available
Enzyme 23 HGNC ID Not Available
Enzyme 23 Chromosome Location Chromosome:1
Enzyme 23 Locus 10q25.1
Enzyme 23 SNPs SNPJam Report Link Image
Enzyme 23 General References Not Available
Enzyme 23 Metabolite References Not Available
Enzyme 24 [top]
Enzyme 24 ID 1272
Enzyme 24 Name Probable glutathione peroxidase 8
Enzyme 24 Synonyms Not Available
Enzyme 24 Gene Name GPX8
Enzyme 24 Protein Sequence >Probable glutathione peroxidase 8
MEPLTAYPLRCSGPKAKAFAVLLSMVLCTVMLFLLQLKFLKPKINSFYTFEVKDANGRVV
SLEKFKGKVALVVNVASDCQLTDRNYLALQELHKEFGPFHFSVLAFPCNQFGESEPRPSK
EVVSFARNNFGVTFPIFHKIKILGSEAEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKT
WRPEEPIEVIRPEIAALIRQMIIKKKEDL
Enzyme 24 Number of Residues 209
Enzyme 24 Molecular Weight 23983.0
Enzyme 24 Theoretical pI 9.81
Enzyme 24 GO Classification
Function
Process
Component
Enzyme 24 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 24 Specific Function 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O
Enzyme 24 Pathways Not Available
Enzyme 24 Reactions Not Available
Enzyme 24 Pfam Domain Function
Enzyme 24 Signals
  • None
Enzyme 24 Transmembrane Regions
  • 18-40
Enzyme 24 Essentiality Not Available
Enzyme 24 GenBank ID Protein 84708688 Link Image
Enzyme 24 UniProtKB/Swiss-Prot ID Q2NL01 Link Image
Enzyme 24 UniProtKB/Swiss-Prot Entry Name GPX8_BOVIN Link Image
Enzyme 24 PDB ID Not Available
Enzyme 24 Cellular Location Not Available
Enzyme 24 Gene Sequence >630 bp
ATGGAGCCTCTCACAGCCTACCCTTTGAGATGTTCAGGGCCCAAAGCAAAGGCATTTGCA
GTCTTGCTGTCTATGGTTCTGTGCACAGTAATGCTATTCCTCCTACAACTCAAATTCCTA
AAGCCTAAAATCAACAGCTTTTATACCTTTGAAGTGAAAGATGCAAATGGAAGGGTGGTT
TCTCTGGAAAAGTTTAAAGGCAAAGTTGCACTAGTTGTAAACGTGGCTAGTGACTGCCAA
CTCACAGACAGAAATTACTTAGCACTGCAGGAACTGCACAAAGAGTTTGGACCATTCCAC
TTCAGCGTCTTGGCTTTTCCATGCAATCAGTTTGGAGAATCGGAGCCCCGCCCGAGCAAG
GAAGTAGTATCTTTTGCAAGAAATAACTTCGGAGTAACATTCCCCATCTTCCACAAGATT
AAGATTCTAGGATCCGAAGCAGAACCTGCATTTAGATTTCTTGTTGATTCTTCAAAGAAG
GAACCAAGGTGGAACTTTTGGAAGTATCTGGTCAACCCTGAAGGTCAAGTTGTGAAGACC
TGGAGGCCAGAGGAACCCATTGAAGTCATCAGGCCTGAGATAGCAGCTCTGATTAGACAA
ATGATTATAAAAAAGAAAGAGGATCTATGA
Enzyme 24 GenBank Gene ID BC111287 Link Image
Enzyme 24 GeneCard ID GPX8 Link Image
Enzyme 24 GenAtlas ID Not Available
Enzyme 24 HGNC ID Not Available
Enzyme 24 Chromosome Location Chromosome:5
Enzyme 24 Locus 5q11.2
Enzyme 24 SNPs SNPJam Report Link Image
Enzyme 24 General References Not Available
Enzyme 24 Metabolite References Not Available
Enzyme 25 [top]
Enzyme 25 ID 1273
Enzyme 25 Name Thioredoxin domain-containing protein 12
Enzyme 25 Synonyms Not Available
Enzyme 25 Gene Name TXNDC12
Enzyme 25 Protein Sequence >Thioredoxin domain-containing protein 12
MELRPRLGATCLLGFSFLLLVTSSHGPNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVI
IHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDP
SGKVRPEIINENGNPSYKYFYISAEQVVQGMKEAQERLTGDAFREKHLEDEL
Enzyme 25 Number of Residues 172
Enzyme 25 Molecular Weight 19221.6
Enzyme 25 Theoretical pI 4.94
Enzyme 25 GO Classification
Function
Process
Component
Enzyme 25 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 25 Specific Function Possesses significant protein thiol-disulfide oxidase activity
Enzyme 25 Pathways Not Available
Enzyme 25 Reactions Not Available
Enzyme 25 Pfam Domain Function Not Available
Enzyme 25 Signals
  • 1-26
Enzyme 25 Transmembrane Regions
  • None
Enzyme 25 Essentiality Not Available
Enzyme 25 GenBank ID Protein 59858533 Link Image
Enzyme 25 UniProtKB/Swiss-Prot ID Q5E936 Link Image
Enzyme 25 UniProtKB/Swiss-Prot Entry Name TXD12_BOVIN Link Image
Enzyme 25 PDB ID 1SEN Link Image
Enzyme 25 PDB File Show
Enzyme 25 3D Structure
Enzyme 25 Cellular Location Not Available
Enzyme 25 Gene Sequence >519 bp
ATGGAGCTGCGGCCTCGTCTCGGGGCCACCTGTTTGCTGGGCTTCAGTTTCCTGCTCCTT
GTCACCTCTTCTCATGGACCTAATGGGCTTGGAAAGGGTTTTGGAGATCACATTCATTGG
AGGACGCTAGAAGATGGGAAGAAGGAAGCAGCTGCCAGTGGATTGCCCCTGATGGTGATT
ATCCATAAGTCCTGGTGTGGAGCTTGCAAAGCTTTAAAGCCCAAATTTGCAGAATCTACA
GAAATTTCAGAACTTTCCCATAATTTTGTTATGGTAAATCTTGAGGATGAAGAGGAGCCC
AAAGATGAAGATTTCAGCCCCGATGGGGGTTATATTCCACGAATCCTGTTCCTGGATCCC
AGTGGCAAAGTGCGTCCTGAAATCATCAATGAGAATGGAAACCCCAGCTACAAGTATTTC
TACATCAGTGCTGAGCAAGTTGTTCAGGGGATGAAGGAAGCTCAGGAAAGGCTGACGGGT
GATGCCTTCAGAGAGAAACATCTGGAAGATGAGTTGTAA
Enzyme 25 GenBank Gene ID BT021084 Link Image
Enzyme 25 GeneCard ID TXNDC12 Link Image
Enzyme 25 GenAtlas ID Not Available
Enzyme 25 HGNC ID Not Available
Enzyme 25 Chromosome Location Chromosome:1
Enzyme 25 Locus 1p32.3
Enzyme 25 SNPs SNPJam Report Link Image
Enzyme 25 General References
  1. [PubMed Link Image]
Enzyme 25 Metabolite References Not Available
Enzyme 26 [top]
Enzyme 26 ID 1274
Enzyme 26 Name Glutathione S-transferase mu 4
Enzyme 26 Synonyms Not Available
Enzyme 26 Gene Name GSTM4
Enzyme 26 Protein Sequence >Glutathione S-transferase mu 4
MAMTLGYWDIRGLAHAIRLLLEYTDSNYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHRLTQSKAILRYIARKHNMCGETEEEKIRVDVLENQTMDTANELAILCYNPEF
EKLKSQYLKEIPGKMKLYSEFLGRRPWFAGDKLTFVDFLVYDVLDIHRIFEPKCLDAFPN
LKDFISHFEGLKRISAYMKSSRFLPHPVYSKMAVWGNK
Enzyme 26 Number of Residues 218
Enzyme 26 Molecular Weight 25669.4
Enzyme 26 Theoretical pI 7.59
Enzyme 26 GO Classification
Function
Process
Component
Enzyme 26 General Function Involved in glutathione transferase activity
Enzyme 26 Specific Function Not Available
Enzyme 26 Pathways Not Available
Enzyme 26 Reactions Not Available
Enzyme 26 Pfam Domain Function
Enzyme 26 Signals
  • None
Enzyme 26 Transmembrane Regions
  • None
Enzyme 26 Essentiality Not Available
Enzyme 26 GenBank ID Protein 119224106 Link Image
Enzyme 26 UniProtKB/Swiss-Prot ID A1A4L7 Link Image
Enzyme 26 UniProtKB/Swiss-Prot Entry Name A1A4L7_BOVIN Link Image
Enzyme 26 PDB ID Not Available
Enzyme 26 Cellular Location Not Available
Enzyme 26 Gene Sequence >657 bp
ATGGCGATGACCCTGGGTTACTGGGACATCCGCGGGCTAGCCCACGCCATCCGCCTGCTC
CTGGAGTACACAGACTCAAACTATGAGGAAAAGAAGTACACGATGGGGGACGCTCCCGAC
TATGACAGAAGCCAGTGGCTGAATGAAAAATTCAAGCTGGGCCTGGACTTTCCCAATTTG
CCCTACTTAATTGATGGAGCTCACAGGCTCACCCAGAGCAAGGCCATCCTTCGCTACATT
GCTCGCAAGCACAACATGTGTGGGGAGACGGAGGAGGAGAAGATTCGCGTGGATGTATTG
GAGAACCAGACTATGGACACTGCTAATGAATTGGCTATACTCTGCTACAACCCTGAATTT
GAGAAACTAAAGTCTCAATACTTGAAGGAGATCCCTGGAAAGATGAAGCTCTACTCAGAG
TTTCTGGGGAGGAGGCCTTGGTTTGCAGGGGACAAGCTCACCTTTGTGGATTTCCTGGTT
TATGATGTTCTTGACATTCACCGCATATTTGAGCCCAAGTGCCTGGATGCATTCCCAAAC
CTGAAAGACTTCATCTCTCATTTTGAGGGCCTGAAGAGGATCTCTGCCTACATGAAGTCC
AGCCGCTTCCTCCCACACCCTGTATATTCAAAGATGGCTGTGTGGGGCAACAAGTAG
Enzyme 26 GenBank Gene ID BC126696 Link Image
Enzyme 26 GeneCard ID GSTM4 Link Image
Enzyme 26 GenAtlas ID Not Available
Enzyme 26 HGNC ID Not Available
Enzyme 26 Chromosome Location Chromosome:1
Enzyme 26 Locus 1p13.3
Enzyme 26 SNPs SNPJam Report Link Image
Enzyme 26 General References Not Available
Enzyme 26 Metabolite References Not Available
Enzyme 27 [top]
Enzyme 27 ID 1275
Enzyme 27 Name Glutathione S-transferase A2
Enzyme 27 Synonyms
  1. Glutathione S-transferase alpha-2
  2. GST class-alpha member 2
Enzyme 27 Gene Name GSTA2
Enzyme 27 Protein Sequence >Glutathione S-transferase A2
MAGKPKLHYFNGRGRMECIRWLLAAAGVEFEEKFIEQPEDLDKLRNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYSEGVEDLGEMIMHLPLCPPDQKDAK
IAQIKERTTNRYFPAFEKVLKNHGQDYLVGNKLSKADIHLVELLYYVEELDPSLLANFPL
LKGLKARVSSLPAVKKFLQPGSQRKPPMDEKNLEEAKRIFRIK
Enzyme 27 Number of Residues 223
Enzyme 27 Molecular Weight 25716.8
Enzyme 27 Theoretical pI 8.93
Enzyme 27 GO Classification
Function
Process
Component
Enzyme 27 General Function Involved in glutathione transferase activity
Enzyme 27 Specific Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles
Enzyme 27 Pathways Not Available
Enzyme 27 Reactions Not Available
Enzyme 27 Pfam Domain Function
Enzyme 27 Signals
  • None
Enzyme 27 Transmembrane Regions
  • None
Enzyme 27 Essentiality Not Available
Enzyme 27 GenBank ID Protein 2598116 Link Image
Enzyme 27 UniProtKB/Swiss-Prot ID O18879 Link Image
Enzyme 27 UniProtKB/Swiss-Prot Entry Name GSTA2_BOVIN Link Image
Enzyme 27 PDB ID Not Available
Enzyme 27 Cellular Location Not Available
Enzyme 27 Gene Sequence >669 bp
ATGGCGGGGAAACCCAAGTTACACTACTTCAATGGACGTGGCAGAATGGAGTGCATTCGG
TGGCTCCTGGCTGCAGCCGGAGTGGAGTTTGAAGAGAAATTTATAGAACAACCAGAAGAC
CTGGATAAGCTAAGAAACGATGGGAGTTTGATGTTCCAGCAAGTGCCAATGGTTGAAATT
GATGGGATGAGCTGGTGCAGACCAGAGCCATTCTCAACTACTTGCCACCAAATACACCTC
TACGGGAAAGACATGAAGGAGAGAGCCCTGATTGATATGTACTCAGAGGGCGTGGAAGAC
TTGGGGGAAATGATCATGCATTTACCACTGTGCCCACCTGATCAAAAAGATGCTAAAATA
GCTCAGATCAAAGAGAGAACAACAAACCGTTATTTCCCTGCATTTGAAAAAGTGCTGAAG
AATCACGGACAAGATTATCTTGTGGGCAACAAGCTGAGCAAGGCTGACATCCACCTGGTT
GAACTTCTCTACTATGTGGAAGAGCTGGACCCTAGCCTTTTGGCCAACTTCCCTCTGCTG
AAGGGCCTGAAAGCCAGAGTCAGCAGTCTCCCGGCTGTGAAGAAGTTTCTGCAGCCTGGC
AGCCAGAGGAAGCCTCCCATGGATGAGAAAAATTTGGAAGAAGCAAAGAGGATTTTCAGG
ATTAAATAA
Enzyme 27 GenBank Gene ID AF027386 Link Image
Enzyme 27 GeneCard ID GSTA2 Link Image
Enzyme 27 GenAtlas ID Not Available
Enzyme 27 HGNC ID Not Available
Enzyme 27 Chromosome Location Chromosome:6
Enzyme 27 Locus 6p12.1
Enzyme 27 SNPs SNPJam Report Link Image
Enzyme 27 General References
  1. [PubMed Link Image]
Enzyme 27 Metabolite References Not Available
Enzyme 28 [top]
Enzyme 28 ID 1276
Enzyme 28 Name Glutathione S-transferase A1
Enzyme 28 Synonyms
  1. Glutathione S-transferase alpha-1
  2. GST class-alpha member 1
Enzyme 28 Gene Name GSTA1
Enzyme 28 Protein Sequence >Glutathione S-transferase A1
MAGKPTLHYFNGRGRMECIRWLLAAAGVEFEEKFIEKPEDLDKLKNDGSLMFQQVPMVEI
DGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYSEGVADLGEMIMHFPLCPPAEKDAK
LTLIREKTTNRYLPAFENVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDPSLLANFPL
LKALKARVSNIPAVKKFLQPGSQRKPPTDEKKIEEARKVFKF
Enzyme 28 Number of Residues 222
Enzyme 28 Molecular Weight 25451.5
Enzyme 28 Theoretical pI 8.93
Enzyme 28 GO Classification
Function
Process
Component
Enzyme 28 General Function Involved in glutathione transferase activity
Enzyme 28 Specific Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles
Enzyme 28 Pathways Not Available
Enzyme 28 Reactions Not Available
Enzyme 28 Pfam Domain Function
Enzyme 28 Signals
  • None
Enzyme 28 Transmembrane Regions
  • None
Enzyme 28 Essentiality Not Available
Enzyme 28 GenBank ID Protein 1215748 Link Image
Enzyme 28 UniProtKB/Swiss-Prot ID Q28035 Link Image
Enzyme 28 UniProtKB/Swiss-Prot Entry Name GSTA1_BOVIN Link Image
Enzyme 28 PDB ID Not Available
Enzyme 28 Cellular Location Not Available
Enzyme 28 Gene Sequence >669 bp
ATGGCAGGGAAGCCCACTCTTCACTATTTCAATGGACGCGGCAGAATGGAGTGCATTCGG
TGGCTCCTAGCTGCAGCTGGAGTGGAGTTTGAAGAGAAATTTATAGAAAAACCAGAAGAC
TTGGATAAGTTAAAAAATGATGGGAGTTTGATGTTCCAGCAAGTGCCAATGGTTGAAATT
GATGGGATGAAGCTGGTGCAGACCAGAGCCATTCTCAACTACATTGCCACCAAATACAAC
CTCTACGGGAAAGACATGAAGGAGAGAGCCCTGATTGATATGTATTCAGAGGGTGTGGCA
GATTTGGGTGAAATGATCATGCATTTTCCACTGTGCCCACCTGCTGAAAAAGATGCCAAG
CTGACCCTAATCCGAGAAAAGACAACAAACCGTTATCTCCCTGCATTTGAAAATGTGCTG
AAGAGCCATGGACAAGACTACCTGGTGGGCAACAAGCTGAGCAGGGCTGACATCCACTTG
GTTGAACTTCTCTACTATGTGGAAGAGCTGGACCCCAGCCTTTTGGCCAACTTCCCTCTG
CTAAAGGCCCTAAAAGCCAGAGTCAGCAGTCTCCCGGCTGTGAAGAAATTTCTGCAGCCT
GGCAGCCAGAGGAAGCCTCCCACGGATGAGAAAAAAATAGAAGAAGCCAGGAAGGTTTTC
AAGTTTTAG
Enzyme 28 GenBank Gene ID U49179 Link Image
Enzyme 28 GeneCard ID GSTA1 Link Image
Enzyme 28 GenAtlas ID Not Available
Enzyme 28 HGNC ID Not Available
Enzyme 28 Chromosome Location Chromosome:6
Enzyme 28 Locus 6p12.1
Enzyme 28 SNPs SNPJam Report Link Image
Enzyme 28 General References
  1. [PubMed Link Image]
Enzyme 28 Metabolite References Not Available
Enzyme 29 [top]
Enzyme 29 ID 2087
Enzyme 29 Name Multidrug resistance-associated protein 1
Enzyme 29 Synonyms
  1. ATP-binding cassette sub-family C member 1
  2. Leukotriene C(4) transporter
  3. LTC4 transporter
Enzyme 29 Gene Name ABCC1
Enzyme 29 Protein Sequence >Multidrug resistance-associated protein 1
MALRDFCSVDGSDLFWEWNVTWNTSNPDFTKCFQNTVLVWVPCSYLWVCFPFYFLYLSHH
DRGYIQMTHLNKAKTALGFLLWIVCWADLFYSFWERSMGKLLAPVFLVSPTLLGITMLLA
TFLIQIERRRGVQSSGIMLTFWLIALLCALAILRSKIMTALKEDARVDVFRDVTFYIYFS
LVLIQLVLSCFSDRSPLFSETINDPNPCPESSASFLSRITFWWITGMMVQGYRQPLESTD
LWSLNKEDTSEQVVPVLVKNWKKECAKSRKQPVKIVYSSKDPAKPKGSSKVDVNEEAEAL
IVKCPQKERDPSLFKVLYKTFGPYFLMSFLFKAVHDLMMFAGPEILKLLINFVNDKKAPE
WQGYFYTALLFISACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNAARKSSTV
GEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPLN
AVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLAAVGTFTWVCTPFLVALSTFAVYVTVDENNILDAQKAFVSLALFNILRFPLNILP
MVISSIVQASVSLKRLRVFLSHEDLDPDSIQRRPIKDAGATNSITVKNATFTWARNDPPT
LHGITFSVPEGSLVAVVGQVGCGKSSLLSALLAEMDKVEGHVTVKGSVAYVPQQAWIQNI
SLRENILFGRQLQERYYKAVVEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLAR
AVYCDSDVYLLDDPLSAVDAHVGKHIFENVIGPKGLLKNKTRLLVTHAISYLPQMDVIIV
MSGGKISEMGSYQELLARDGAFAEFLRTYASAEQEQGQPEDGLAGVGGPGKEVKQMENGM
LVTDTAGKQMQRQLSSSSSYSRDVSQHHTSTAELRKPGPTEETWKLVEADKAQTGQVKLS
VYWDYMKAIGLFISFLSIFLFLCNHVASLVSNYWLSLWTDDPIVNGTQEHTQVRLSVYGA
LGISQGITVFGYSMAVSIGGIFASRRLHLDLLHNVLRSPISFFERTPSGNLVNRFSKELD
TVDSMIPQVIKMFMGSLFNVIGACIIILLATPMAAVIIPPLGLIYFFVQRFYVASSRQLK
RLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIRQSDLKVDENQKAYYPSIVANRWLAV
RLECVGNCIVLFASLFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAV
ERLKEYSETEKEAPWQIQDMAPPKDWPQVGRVEFRDYGLRYREDLDLVLKHINVTIDGGE
KVGIVGRTGAGKSSLTLGLFRIKESAEGEIIIDDINIAKIGLHDLRFKITIIPQDPVLFS
GSLRMNLDPFSQYSDEEVWTSLELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLA
RALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFDDCTVLTIAHRLNTIMDYTRVIVLD
KGEIQEWGSPSDLLQQRGLFYSMAKDSGLV
Enzyme 29 Number of Residues 1530
Enzyme 29 Molecular Weight 171664.0
Enzyme 29 Theoretical pI 7.71
Enzyme 29 GO Classification
Function
Process
Component
Enzyme 29 General Function Defense mechanisms
Enzyme 29 Specific Function Mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o- glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs. May protect milk against xenobiotics. Hydrolyzes ATP with low efficiency
Enzyme 29 Pathways Not Available
Enzyme 29 Reactions Not Available
Enzyme 29 Pfam Domain Function
Enzyme 29 Signals
  • None
Enzyme 29 Transmembrane Regions
  • 34-54 75-95 101-121 134-154 173-193 317-337 364-384 441-461 465-485 548-568 591-611 967-987 1025-1045 1089-1109 1111-1131 1203-1223 1226-1246
Enzyme 29 Essentiality Not Available
Enzyme 29 GenBank ID Protein 22779202 Link Image
Enzyme 29 UniProtKB/Swiss-Prot ID Q8HXQ5 Link Image
Enzyme 29 UniProtKB/Swiss-Prot Entry Name MRP1_BOVIN Link Image
Enzyme 29 PDB ID Not Available
Enzyme 29 Cellular Location Not Available
Enzyme 29 Gene Sequence Not Available
Enzyme 29 GenBank Gene ID AB082124 Link Image
Enzyme 29 GeneCard ID ABCC1 Link Image
Enzyme 29 GenAtlas ID Not Available
Enzyme 29 HGNC ID Not Available
Enzyme 29 Chromosome Location Chromosome:1
Enzyme 29 Locus 16p13.1
Enzyme 29 SNPs SNPJam Report Link Image
Enzyme 29 General References
  1. [PubMed Link Image]
Enzyme 29 Metabolite References Not Available
Enzyme 30 [top]
Enzyme 30 ID 2681
Enzyme 30 Name GSTM2 protein
Enzyme 30 Synonyms Not Available
Enzyme 30 Gene Name GSTM2
Enzyme 30 Protein Sequence >GSTM2 protein
SFSFLSVITCTMPMILGYWDIRGLAHAIRLLLEYTDTNYEERQYSVGDAPDYDRSQWLDE
KFKLGLDFPNLPYLIDGTHKLTQSNAILRYIARKHNMCGETEEEMIRVDILENQVMDVRF
AMARICYSPDFEKLKPGFLKEIPEKIKLFSEFLGKRPWFAGDKLSYVDFLVYDVLDMHRI
FEPKCLDAFPNLKDFISRFEGLKKISAYMKSSRFLPGPLFLKLAVWGNK
Enzyme 30 Number of Residues 229
Enzyme 30 Molecular Weight 26841.9
Enzyme 30 Theoretical pI 6.92
Enzyme 30 GO Classification
Function
Process
Component
Enzyme 30 General Function Involved in glutathione transferase activity
Enzyme 30 Specific Function Not Available
Enzyme 30 Pathways Not Available
Enzyme 30 Reactions Not Available
Enzyme 30 Pfam Domain Function
Enzyme 30 Signals
  • None
Enzyme 30 Transmembrane Regions
  • None
Enzyme 30 Essentiality Not Available
Enzyme 30 GenBank ID Protein 148744125 Link Image
Enzyme 30 UniProtKB/Swiss-Prot ID A5PKM0 Link Image
Enzyme 30 UniProtKB/Swiss-Prot Entry Name A5PKM0_BOVIN Link Image
Enzyme 30 PDB ID Not Available
Enzyme 30 Cellular Location Not Available
Enzyme 30 Gene Sequence Not Available
Enzyme 30 GenBank Gene ID BC142536 Link Image
Enzyme 30 GeneCard ID GSTM2 Link Image
Enzyme 30 GenAtlas ID Not Available
Enzyme 30 HGNC ID Not Available
Enzyme 30 Chromosome Location Chromosome:1
Enzyme 30 Locus 1p13.3
Enzyme 30 SNPs SNPJam Report Link Image
Enzyme 30 General References Not Available
Enzyme 30 Metabolite References Not Available
Enzyme 31 [top]
Enzyme 31 ID 2682
Enzyme 31 Name GSTM1 protein
Enzyme 31 Synonyms Not Available
Enzyme 31 Gene Name GSTM1
Enzyme 31 Protein Sequence >GSTM1 protein
MPMILGYWDIRGLAHAIRLLLEYTDSNYEEKKYTMGDAPDYDRSQWLSEKFTLGLDFPNL
PYLIDGAHKLTQSNAILRYIARKHNMCGETEEEKIRVDILENQTMDVRLHMARICYSPDF
ETLKPGFLKEIPEKMKLFSDFLAKRPWFAGDKLTYVDFLAYDVLDRHRIFEPTCLDEFPN
LKDFITRFEGLKRISAYMKSSRFHPNPMFLKLAVWGNK
Enzyme 31 Number of Residues 218
Enzyme 31 Molecular Weight 25779.5
Enzyme 31 Theoretical pI 7.13
Enzyme 31 GO Classification
Function
Process
Component
Enzyme 31 General Function Involved in glutathione transferase activity
Enzyme 31 Specific Function Not Available
Enzyme 31 Pathways Not Available
Enzyme 31 Reactions Not Available
Enzyme 31 Pfam Domain Function
Enzyme 31 Signals
  • None
Enzyme 31 Transmembrane Regions
  • None
Enzyme 31 Essentiality Not Available
Enzyme 31 GenBank ID Protein 134024679 Link Image
Enzyme 31 UniProtKB/Swiss-Prot ID A4IFG0 Link Image
Enzyme 31 UniProtKB/Swiss-Prot Entry Name A4IFG0_BOVIN Link Image
Enzyme 31 PDB ID Not Available
Enzyme 31 Cellular Location Not Available
Enzyme 31 Gene Sequence >657 bp
ATGCCCATGATCCTGGGTTACTGGGACATCCGTGGGCTGGCCCATGCCATCCGCCTGCTC
CTGGAGTATACAGACTCAAACTATGAGGAGAAGAAGTACACGATGGGGGACGCTCCTGAC
TATGACAGAAGCCAGTGGCTGAGTGAAAAATTCACGCTGGGCCTGGACTTCCCCAATTTG
CCCTACTTAATTGATGGAGCTCACAAGCTCACCCAGAGCAACGCCATCCTTCGCTACATT
GCTCGCAAGCACAATATGTGTGGGGAGACAGAGGAGGAGAAGATCCGTGTGGACATTTTG
GAGAACCAGACTATGGACGTCCGCTTGCACATGGCCAGGATCTGTTACAGCCCTGACTTT
GAGACACTGAAGCCTGGTTTCTTGAAGGAGATTCCTGAAAAGATGAAGCTCTTCTCAGAT
TTTCTGGCGAAGAGGCCTTGGTTCGCAGGGGACAAGCTCACCTATGTGGATTTCTTGGCT
TATGATGTCCTTGACCGGCACCGCATATTTGAACCTACATGTCTGGATGAATTTCCAAAC
TTGAAAGACTTCATTACCCGTTTCGAGGGCCTGAAGAGGATCTCTGCCTACATGAAGTCT
AGCCGCTTCCACCCAAACCCTATGTTTCTAAAGCTTGCCGTGTGGGGAAACAAGTAA
Enzyme 31 GenBank Gene ID BC134565 Link Image
Enzyme 31 GeneCard ID GSTM1 Link Image
Enzyme 31 GenAtlas ID Not Available
Enzyme 31 HGNC ID Not Available
Enzyme 31 Chromosome Location Chromosome:1
Enzyme 31 Locus 1p13.3
Enzyme 31 SNPs SNPJam Report Link Image
Enzyme 31 General References Not Available
Enzyme 31 Metabolite References Not Available