We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for D-Glucose (BMDB00122)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-07-06 13:21:32
Accession Number BMDB00122
Common Name D-Glucose
Description Glucose is a monosaccharide containing six carbon atoms and an aldehyde group and is therefore referred to as an aldohexose. The glucose molecule can exist in an open-chain (acyclic) and ring (cyclic) form, the latter being the result of an intramolecular reaction between the aldehyde C atom and the C-5 hydroxyl group to form an intramolecular hemiacetal. In water solution both forms are in equilibrium and at pH 7 the cyclic one is the predominant. Glucose is a primary source of energy for living organisms. It is naturally occurring and is found in fruits and other parts of plants in its free state. In animals glucose arises from the breakdown of glycogen in a process known as glycogenolysis. Glucose is synthesized in the liver and kidneys from non-carbohydrate intermediates, such as pyruvate and glycerol, by a process known as gluconeogenesis.
Synonyms
  1. (+)-Glucose
  2. Anhydrous dextrose
  3. CPC hydrate
  4. Cerelose
  5. Cerelose 2001
  6. Clearsweet 95
  7. Clintose L
  8. Corn sugar
  9. D(+)-Glucose
  10. Dextropur
  11. Dextrose
  12. Dextrosol
  13. Glucodin
  14. Glucolin
  15. Glucose
  16. Goldsugar
  17. Grape sugar
  18. Meritose
  19. Roferose ST
  20. Staleydex 111
  21. Staleydex 95M
  22. Tabfine 097(HS)
  23. Vadex
Chemical IUPAC Name (3R,4R,5S,6S)-6-(hydroxymethyl)oxane-2,3,4,5-tetrol
Chemical Formula C6H12O6
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Carbohydrates and Carbohydrate conjugates
Class
  • Carbohydrates
Sub Class
  • Monosaccharides
Family
  • Mammalian_Metabolite
Species
  • hemiacetal; primary alcohol; secondary alcohol; 1,2-diol; heterocyclic compound
Biofunction
Application
Source
  • Endogenous
Average Molecular Weight 180.156
Monoisotopic Molecular Weight 180.063385
Isomeric SMILES OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O
Canonical SMILES OCC1OC(O)C(O)C(O)C1O
KEGG Compound ID C00031 Link Image
BioCyc ID GLC Link Image
BiGG ID 33582 Link Image
Wikipedia Link Dextrose Link Image
METLIN ID 133 Link Image
PubChem Compound 5793 Link Image
PubChem Substance 833240 Link Image
ChEBI ID 17634 Link Image
CAS Registry Number 50-99-7
InChI Identifier InChI=1/C6H12O6/c7-1-2-3(8)4(9)5(10)6(11)12-2/h2-11H,1H2/t2-,3-,4+,5-,6u/m1/s1
Synthesis Reference Li, Dalin; Ruan, Yi; Song, Wen; Wang, Yongjun. Improved process for producing glucose. Faming Zhuanli Shenqing Gongkai Shuomingshu (2003), 4 pp
Melting Point (Experimental) 146-150 oC
Experimental Water Solubility 1200.0 mg/mL [MULLIN,JW (1972)] Source: PhysProp
Predicted Water Solubility 782.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity -3.24 [SANGSTER (1994)] Source: PhysProp
Predicted LogP/Hydrophobicity -2.57 [Predicted by ALOGPS]; -2.3 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID 1A47 Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
  • endoplasmic reticulum
  • Extracellular
  • golgi apparatus
  • lysosome
Biofluid Location
  • Breast_Milk
  • Rumen
Tissue Location
Tissue References
Adipose Tissue
Adrenal Cortex
Adrenal Gland
Adrenal Medulla
Beta Cell
Bladder
Brain
Brain Plaques
Epidermis
Eye Lens
Fetus
Fibroblasts
Gonads
Gut
Intestine
Kidney
Liver
Lung
Mouth
Muscle
Myelin
Nerve Cells
Neuron
Pancreas
Placenta
Concentrations (Normal)
Biofluid Breast_Milk
Value 76 - 662 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. skim.
References
Biofluid Breast_Milk
Value 1187.859 +/- 0 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. primiparous.
References
Biofluid Breast_Milk
Value 1137.903 +/- 0 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. multiparous.
References
Biofluid Breast_Milk
Value 376 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw.
References
Biofluid Breast_Milk
Value 540 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw.
References
Biofluid Breast_Milk
Value 548 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw.
References
Biofluid Breast_Milk
Value 723 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw.
References
Biofluid Breast_Milk
Value 555.0745 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, fluid, partly skimmed, 2% milkfat.
References
Biofluid Breast_Milk
Value 157 +/- 18 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 2% milk
References
Biofluid Breast_Milk
Value 213 +/- 41 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in skim milk
References
Biofluid Breast_Milk
Value 560 +/- 114 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 1% milk
References
Biofluid Breast_Milk
Value 174 +/- 43 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 3.25% milk
References
Biofluid Breast_Milk
Value NA NA
Age NA
Sex NA
Condition Normal
Comments Detected but not quantified in conventional whole milk
References
Biofluid Rumen
Value 520.41 +/- 94.97 uM
Age N/A
Sex N/A
Condition Normal
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 763.813 +/- 751.731 uM
Age N/A
Sex N/A
Condition Normal
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Biofluid Rumen
Value 2484.4 +/- 1132.24 uM
Age N/A
Sex N/A
Condition Rumen acidosis
Comments Not Available
References
  • The rumen metabolome (in preparation)
Biofluid Rumen
Value 2415.813 +/- 1248.434 uM
Age N/A
Sex N/A
Condition Rumen acidosis
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names
  • Galactose Metabolism
  • Glycolysis
  • Starch and Sucrose Metabolism
HMDB Pathways
Name Galactose Metabolism
Image Show Link Image
Name Glycolysis
Image Show Link Image
Name Starch and Sucrose Metabolism
Image Show Link Image
KEGG Pathways
Name Galactose Metabolism
Image Show Link Image
Name Glycolysis
Image Show Link Image
Name Starch and Sucrose Metabolism
Image Show Link Image
SimCell Pathways
Name Galactose Metabolism
Image Show Link Image
Graph
SBML
Name Glycolysis
Image Show Link Image
Graph Show Link Image
SBML Download (XML) Link Image
Name Starch and Sucrose Metabolism
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Glucosylceramidase
  2. YES1 protein
  3. Beta-1,4-galactosyltransferase 1
  4. Hexokinase-1
  5. Kininogen-2
  6. Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
  7. Phosphatidylinositol 3-kinase regulatory subunit alpha
  8. AMP-activated protein kinase gamma subunit
  9. RAC-alpha serine/threonine-protein kinase
  10. Kininogen-1
  11. Myosin-Ic
  12. Collectin-43
  13. Sodium/myo-inositol cotransporter 2
  14. Peroxisome proliferator-activated receptor gamma
  15. Solute carrier family 2, facilitated glucose transporter member 4
  16. Solute carrier family 2, facilitated glucose transporter member 1
  17. Solute carrier family 2, facilitated glucose transporter member 8
  18. P2Y purinoceptor 14
  19. Solute carrier family 2, facilitated glucose transporter member 12
  20. Solute carrier family 2, facilitated glucose transporter member 3
  21. Solute carrier family 2, facilitated glucose transporter member 5
  22. Angiopoietin-related protein 4
  23. Sorbin and SH3 domain containing 1
  24. Islet amyloid polypeptide
  25. Solute carrier family 2 (Facilitated glucose transporter), member 1
  26. Putative sodium-glucose cotransporter
  27. Chromogranin-A
  28. Solute carrier family 2 (Facilitated glucose transporter), member 3
  29. Solute carrier family 2 (Facilitated glucose transporter), member 6
  30. Glucagon
  31. Solute carrier family 5 member 1
  32. Hypoxia-inducible factor 1 alpha
  33. Interleukin 1-beta
  34. Na+/glucose cotransporter
  35. Sodium-dependent glucose transporter SGLT-I
  36. Kruppel-like factor 15
Enzyme 1 [top]
Enzyme 1 ID 131
Enzyme 1 Name Glucosylceramidase
Enzyme 1 Synonyms
  1. Beta-glucocerebrosidase
  2. Acid beta-glucosidase
  3. D-glucosyl-N-acylsphingosine glucohydrolase
Enzyme 1 Gene Name GBA
Enzyme 1 Protein Sequence >Glucosylceramidase
MELSSPSREEYPMPRGRVGIMAASLMGLLLLHTVSWVSGARPCSPKSFGYSSVVCVCNGT
YCDSLDPLTLPDPGTFSRFESTRSGRRMELSLGTIQANRTGTGLLLTLQPDQKFQKVKGF
GGAMTDAAALNILALSPAARNLLLKSYFSEEGIEYNIIRVPMASCDFSIRTYTYDDSPDD
FQLLNFSLPEEDVKLKIPLIHQALELANRSVSLFASPWTSPTWLKTNGAVNGKGTLKGQA
GDLYHKTWARYFVKFLDAYAEHKLRFWAVTAENEPTAGLLTGYPFQCLGFTPEHQRDFIA
RDLGPILANSTHRDVRLLMLDDQRLLLPRWAQVVLADPEAAKYVHGIAVHWYLDFLAPAK
ATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMRYSHSIITNLLYHVVGWTDW
NLALNPEGGPNWVRNFVDSPIIVDIAKDTFYKQPMFYHLGHFSKFIPEGSQRVGLVASKK
SDLDTVALLRPDGSAVAVVLNRSSKDVPLTIKDPAVGFMETVSPGYSIHTYLWRRQ
Enzyme 1 Number of Residues 536
Enzyme 1 Molecular Weight 59854.0
Enzyme 1 Theoretical pI 8.08
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Involved in cation binding
Enzyme 1 Specific Function D-glucosyl-N-acylsphingosine + H(2)O = D- glucose + N-acylsphingosine
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • 1-39
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 86438386 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q2KHZ8 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name GLCM_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1611 bp
ATGGAGCTTTCAAGTCCTTCCAGAGAGGAGTATCCTATGCCTCGGGGCAGAGTAGGAATC
ATGGCTGCCAGCCTCATGGGATTACTTCTACTTCATACAGTGTCGTGGGTATCAGGTGCC
CGCCCCTGCAGCCCTAAAAGCTTTGGCTACAGCTCGGTGGTGTGTGTCTGCAATGGTACA
TACTGTGATTCTCTGGACCCCTTGACCCTGCCTGACCCTGGCACCTTCAGCCGCTTTGAG
AGCACTCGCAGCGGGCGCCGAATGGAGCTGAGTCTGGGGACCATCCAGGCCAATCGCACA
GGCACAGGGTTGCTGTTGACCTTGCAGCCAGATCAGAAATTCCAGAAAGTGAAGGGATTT
GGAGGGGCCATGACGGATGCTGCTGCCCTCAACATCCTTGCCCTGTCACCTGCTGCACGG
AATTTGCTACTCAAATCATACTTCTCCGAAGAAGGAATTGAATACAACATCATCCGGGTC
CCCATGGCCAGCTGTGACTTCTCCATCCGCACCTATACCTATGACGACAGCCCTGATGAC
TTCCAGCTGCTCAACTTCAGCCTTCCAGAGGAAGATGTCAAGCTCAAGATACCACTGATT
CACCAAGCTCTGGAGTTGGCCAACCGCTCTGTCTCACTCTTCGCCAGTCCCTGGACATCA
CCCACTTGGCTCAAGACTAATGGGGCTGTGAATGGGAAGGGAACACTCAAGGGTCAAGCA
GGGGATCTCTACCACAAGACCTGGGCCAGATACTTTGTCAAGTTCCTGGATGCCTACGCG
GAGCACAAGTTACGGTTCTGGGCAGTGACAGCCGAGAACGAGCCTACTGCAGGGCTCCTT
ACCGGGTACCCCTTCCAATGCTTGGGTTTCACTCCTGAGCACCAGCGAGACTTCATCGCC
CGTGACCTGGGTCCCATCCTCGCCAACAGCACACACCGCGACGTCCGACTGTTGATGCTG
GATGACCAGCGCTTACTGTTGCCTCGCTGGGCCCAGGTGGTGCTGGCAGACCCAGAAGCA
GCTAAGTATGTTCATGGCATTGCTGTACATTGGTACCTGGACTTCCTGGCTCCAGCAAAA
GCCACCCTGGGGGAGACGCACCGCCTGTTCCCCAACACCATGCTCTTTGCCTCAGAGGCC
TGTGTGGGCTCCAAGTTCTGGGAGCAGAGTGTGCGGCTGGGCTCCTGGGATCGAGGGATG
CGGTACAGCCACAGTATCATCACAAACCTCCTCTACCATGTGGTCGGCTGGACCGACTGG
AACCTCGCCCTAAATCCTGAAGGGGGACCCAACTGGGTGCGCAATTTTGTTGATAGCCCC
ATCATTGTGGATATCGCCAAGGACACATTTTACAAGCAGCCTATGTTTTACCACCTTGGC
CACTTCAGCAAGTTCATTCCTGAGGGCTCGCAGAGAGTGGGGCTGGTTGCCAGTAAGAAG
AGCGACTTGGACACGGTGGCACTGTTACGTCCTGACGGCTCTGCGGTTGCGGTCGTGCTG
AACCGCTCCTCTAAGGACGTGCCTCTCACCATCAAGGATCCCGCCGTGGGCTTCATGGAA
ACTGTCTCACCTGGCTACTCCATTCACACCTACCTGTGGCGTCGCCAGTGA
Enzyme 1 GenBank Gene ID BC112823 Link Image
Enzyme 1 GeneCard ID GBA Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 1q21
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 179
Enzyme 2 Name YES1 protein
Enzyme 2 Synonyms Not Available
Enzyme 2 Gene Name YES1
Enzyme 2 Protein Sequence >YES1 protein
MGCIKSKENKSPSIKYRPENTPEPVSTGVGHYGGEHAVVAPTSSTKSTSANFSSLSMTPF
GGSSAVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIIN
NTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIF
LVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTE
HADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKV
AIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKE
GDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIE
DNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVL
EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGEN
L
Enzyme 2 Number of Residues 541
Enzyme 2 Molecular Weight 60596.5
Enzyme 2 Theoretical pI 6.79
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Involved in ATP binding
Enzyme 2 Specific Function ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 154425902 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID A7MB57 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name A7MB57_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1626 bp
ATGGGCTGCATTAAAAGTAAAGAGAACAAAAGTCCATCCATTAAATATAGACCAGAAAAC
ACGCCAGAGCCGGTCAGCACAGGAGTAGGCCATTATGGAGGAGAACACGCTGTGGTGGCA
CCAACATCCTCCACGAAGAGCACATCTGCCAATTTCAGCAGCCTCTCCATGACGCCATTC
GGAGGGTCCTCGGCGGTGACACCTTTTGGAGGAGCATCTTCCTCGTTTTCAGTGGTGCCA
AGTTCATATCCTGCTGGTTTAACAGGTGGTGTTACTATATTTGTGGCCTTATATGATTAT
GAAGCTAGAACTACAGAAGACCTTTCATTTAAGAAAGGTGAAAGATTTCAAATAATTAAC
AACACGGAAGGAGACTGGTGGGAGGCGAGATCAATCGCTACAGGAAAGAACGGCTACATC
CCAAGCAATTACGTAGCCCCGGCGGATTCCATTCAGGCTGAAGAATGGTATTTTGGCAAA
ATGGGGAGAAAAGATGCGGAAAGATTACTTCTGAATCCTGGGAATCAGCGAGGTATTTTC
TTAGTAAGAGAGAGTGAAACTACTAAAGGTGCTTACTCCCTCTCTATTCGGGACTGGGAT
GAGGTGAGGGGTGACAATGTGAAGCACTACAAAATTAGGAAACTTGACAATGGTGGATAC
TACATCACAACCAGAGCACAGTTTGACACTCTGCAGAAACTGGTAAAACACTACACAGAA
CATGCCGATGGTTTATGCCATAAGTTAACAACTGTGTGTCCAACTGTGAAACCCCAGACT
CAAGGTCTAGCAAAAGATGCTTGGGAAATCCCGCGAGAATCTTTGCGACTAGAGGTTAAA
CTAGGACAAGGATGTTTTGGTGAAGTTTGGATGGGAACGTGGAATGGAACCACAAAAGTA
GCGATCAAAACACTGAAGCCAGGTACAATGATGCCAGAAGCTTTTCTTCAAGAGGCTCAG
ATAATGAAAAAACTAAGACATGATAAACTTGTTCCACTATATGCTGTTGTTTCTGAAGAG
CCGATTTACATTGTCACTGAGTTTATGTCAAAAGGGAGCTTATTGGATTTCCTGAAGGAG
GGAGATGGAAAGTATCTGAAGCTCCCACAGCTGGTTGACATGGCTGCTCAGATTGCTGAT
GGTATGGCCTATATTGAAAGAATGAACTATATTCATCGAGATCTTCGGGCTGCTAATATT
CTCGTAGGCGAAAACCTTGTGTGCAAAATAGCAGATTTTGGCTTAGCAAGGTTAATTGAA
GACAATGAATATACGGCAAGACAAGGTGCAAAATTTCCAATCAAGTGGACAGCTCCTGAG
GCTGCACTGTATGGTCGATTTACAATCAAGTCTGATGTATGGTCATTTGGAATTCTACAG
ACAGAACTGGTAACAAAGGGCAGAGTGCCATATCCAGGTATGGTGAACCGCGAGGTGCTG
GAGCAGGTGGAGCGAGGGTACAGGATGCCATGCCCGCAGGGCTGCCCAGAGTCCCTCCAC
GAATTGATGAATCTGTGTTGGAAGAAGGACCCTGATGAGAGACCAACATTTGAGTATATC
CAGTCCTTCCTGGAAGACTATTTCACTGCTACAGAGCCACAGTACCAGCCAGGAGAAAAT
TTATAA
Enzyme 2 GenBank Gene ID BC151348 Link Image
Enzyme 2 GeneCard ID YES1 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 18p11.31-p11.21
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 604
Enzyme 3 Name Beta-1,4-galactosyltransferase 1
Enzyme 3 Synonyms
  1. Beta-1,4-GalTase 1
  2. Beta4Gal-T1
  3. b4Gal-T1
  4. UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1
  5. UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1
  6. Lactose synthase A protein
  7. N-acetyllactosamine synthase
  8. Nal synthetase
  9. Beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
  10. Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase
  11. Processed beta-1,4-galactosyltransferase 1
Enzyme 3 Gene Name B4GALT1
Enzyme 3 Protein Sequence >Beta-1,4-galactosyltransferase 1
MKFREPLLGGSAAMPGASLQRACRLLVAVCALHLGVTLVYYLAGRDLRRLPQLVGVHPPL
QGSSHGAAAIGQPSGELRLRGVAPPPPLQNSSKPRSRAPSNLDAYSHPGPGPGPGSNLTS
APVPSTTTRSLTACPEESPLLVGPMLIEFNIPVDLKLVEQQNPKVKLGGRYTPMDCISPH
KVAIIIPFRNRQEHLKYWLYYLHPILQRQQLDYGIYVINQAGESMFNRAKLLNVGFKEAL
KDYDYNCFVFSDVDLIPMNDHNTYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQ
FLSINGFPNNYWGWGGEDDDIYNRLAFRGMSVSRPNAVIGKCRMIRHSRDKKNEPNPQRF
DRIAHTKETMLSDGLNSLTYMVLEVQRYPLYTKITVDIGTPS
Enzyme 3 Number of Residues 402
Enzyme 3 Molecular Weight 44842.2
Enzyme 3 Theoretical pI 9.60
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Involved in alpha-tubulin binding
Enzyme 3 Specific Function The cell surface form functions as a recognition molecule during a variety of cell to cell and cell to matrix interactions, as those occurring during development and egg fertilization, by binding to specific oligosaccharide ligands on opposing cells or in the extracellular matrix
Enzyme 3 Pathways
  • Protein modification
  • protein glycosylation
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • 25-44
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 382 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID P08037 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name B4GT1_BOVIN Link Image
Enzyme 3 PDB ID 1FR8 Link Image
Enzyme 3 PDB File Show
Enzyme 3 3D Structure
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1209 bp
ATGAAGTTTCGGGAGCCGCTCCTGGGCGGCAGTGCCGCGATGCCGGGCGCGTCCCTGCAG
CGGGCCTGCCGCCTCCTCGTGGCTGTCTGCGCCCTGCATCTTGGCGTCACCCTCGTCTAT
TACCTGGCCGGCCGAGACCTAAGACGCCTGCCTCAGCTGGTCGGAGTCCACCCACCGCTT
CAGGGAAGCTCTCACGGCGCCGCCGCTATCGGGCAGCCCTCCGGGGAGCTCCGGCTGCGA
GGGGTCGCACCGCCGCCGCCTTTGCAGAACTCTTCCAAGCCGCGCTCGCGGGCCCCCTCC
AACCTAGACGCGTACTCTCACCCCGGCCCTGGCCCGGGCCCGGGGAGCAACTTGACTTCG
GCCCCAGTGCCCTCCACCACAACACGCTCGCTGACCGCATGCCCTGAGGAGTCCCCGCTG
CTCGTCGGCCCCATGCTGATTGAGTTTAACATACCTGTGGACCTGAAGCTTATCGAGCAG
CAGAACCCGAAGGTGAAGTTGGGTGGTCGCTACACCCCCATGGACTGCATCTCTCCTCAC
AAGGTGGCCATCATCATTCTATTCCGCAACCGGCAGGAACACCTCAAGTACTGGCTGTAT
TACTTGCACCCAATGGTACAGCGTCAGCAGTTAGACTATGGCATCTATGTTATCAACCAG
GCTGGAGAGTCCATGTTCAACCGCGCAAAGCTCCTCAATGTTGGCTTTAAAGAGGCCTTG
AAGGACTATGACTACAACTGCTTTGTGTTTAGCGATGTGGACCTCATCCCAATGAACGAC
CATAACACCTACAGGTGCTTTTCACAGCCACGGCACATTTCTGTAGCAATGGATAAGTTT
GGATTTAGCCTACCTTACGTGCAGTATTTTGGAGGTGTCTCTGCTCTAAGTAAACAACAG
TTTCTCAGCATCAATGGATTTCCTAATAACTACTGGGGCTGGGGAGGTGAAGATGATGAC
ATTTATAACAGATTAGCTTTTAGAGGCATGTCTGTGTCTCGCCCAAATGCTGTGATCGGG
AAGTGTCGGATGATCCGCCACTCGAGAGACAAGAAAAATGAACCTAATCCTCAGAGGTTT
GACCGAATTGCACATACAAAGGAGACAATGCTCTCTGATGGTTTGAACTCACTCACCTAC
ATGGTGTTAGAGGTCCAGAGGTACCCGTTGTATACCAAAATCACAGTGGACATCGGGACG
CCGAGCTAG
Enzyme 3 GenBank Gene ID X14558 Link Image
Enzyme 3 GeneCard ID B4GALT1 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:9
Enzyme 3 Locus 9p13
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 912
Enzyme 4 Name Hexokinase-1
Enzyme 4 Synonyms
  1. Hexokinase type I
  2. HK I
  3. Brain form hexokinase
Enzyme 4 Gene Name HK1
Enzyme 4 Protein Sequence >Hexokinase-1
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLLDIMNRFKKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQNRPVHMESEVYDTPENIMH
GSGSQLFDHVLECLGDFMEKKKIKDKKLPVGFTFSFPCRQSKIDQAILITWTKRFKARGA
EGNYVVKLLDKAIKKRGDYDANIVAVVNDTVGTMIDCGYDDQHCEVGLIIGTGTNACYME
ELRQIDFGWGDDGRMCINTEWGDLGDDGSLEDIRKEFDREFRRGSLNPGKQRFEKMVSGR
YMEDVVRLVLVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKDKEGLHNAKEILTRLG
VERSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKSTPRLRTTVRVDGSLYKTH
PQYSRRFHKTLRRLVPDSDVRFLLSESGTGKGAAMVTAVAYRLAEQHRQIEETLAHFRLS
KQTLMEVKKRLRTEMEMGLRKETNSNATVNMLPSFLRSIPDGTEDGDFLALDLGGTNFRV
LLVKIRSGKKSTVEMHNKIYRIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGF
TFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAVKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGNQRQMCINMEWGAFGDNGCSDD
IRTDFDKVVDEYSLNSGNQRFENMISGIYLGEIVRNILIDFTKKGFLFRGQISEPLKTRG
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVEKIRENRGLDRLNVTVGVDGTLYKLHPQFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRGESAIS
Enzyme 4 Number of Residues 918
Enzyme 4 Molecular Weight 103063.6
Enzyme 4 Theoretical pI 7.04
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in ATP binding
Enzyme 4 Specific Function ATP + D-hexose = ADP + D-hexose 6-phosphate
Enzyme 4 Pathways
  • Carbohydrate metabolism
  • hexose metabolism
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 163152 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID P27595 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name HXK1_BOVIN Link Image
Enzyme 4 PDB ID 1HKB Link Image
Enzyme 4 PDB File Show
Enzyme 4 3D Structure
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence Not Available
Enzyme 4 GenBank Gene ID M65140 Link Image
Enzyme 4 GeneCard ID HK1 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 10q22
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 913
Enzyme 5 Name Kininogen-2
Enzyme 5 Synonyms
  1. Kininogen II
  2. Thiol proteinase inhibitor
  3. Kininogen-2 heavy chain
  4. Bradykinin
  5. Kallidin I
  6. Lysyl-bradykinin
  7. Kallidin II
  8. Kininogen-2 light chain
Enzyme 5 Gene Name KNG2
Enzyme 5 Protein Sequence >Kininogen-2
MKLITILFLCSRLLPSLTQESSQEIDCNDQDVFKAVDAALTKYNSENKSGNQFVLYRITE
VARMDNPDTFYSLKYQIKEGDCPFQSNKTWQDCDYKDSAQAATGQCTATVAKRGNMKFSV
AIQTCLITPAEGPVVTAQYECLGCVHPISTKSPDLEPVLRYAIQYFNNNTSHSHLFDLKE
VKRAQKQVVSGWNYEVNYSIAQTNCSKEEFSFLTPDCKSLSSGDTGECTDKAHVDVKLRI
SSFSQKCDLYPGEDFLPPMVCVGCPKPIPVDSPDLEEALNHSIAKLNAEHDGTFYFKIDT
VKKATVQVVGGLKYSIVFIARETTCSKGSNEELTKSCEINIHGQILHCDANVYVVPWEEK
VYPTVNCQPLGQTSLMKRPPGFSPFRSVQVMKTEGSTTVSLPHSAMSPVQDEERDSGKEQ
GPTHGHGWDHGKQIKLHGLGLGHKHKHDQGHGHHRSHGLGHGHQKQHGLGHGHKHGHGHG
KHKNKGKNNGKHYDWRTPYLASSYEDSTTSSAQTQEKTEETTLSSLAQPGVAITFPDFQD
SDLIATVMPNTLPPHTESDDDWIPDIQTEPNSLAFKLISDFPETTSPKCPSRPWKPVNGV
NPTVEMKESHDFDLVDALL
Enzyme 5 Number of Residues 619
Enzyme 5 Molecular Weight 68709.6
Enzyme 5 Theoretical pI 6.55
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Inorganic ion transport and metabolism
Enzyme 5 Specific Function (1) Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin- induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects:(4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action); (5) LMW-kininogen inhibits the aggregation of thrombocytes; (6) LMW- kininogen is in contrast to HMW-kininogen not involved in blood clotting
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • 1-18
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 494 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID P01045 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name KNG2_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >1860 bp
ATGAAATTAATCACCATCCTTTTCCTTTGTTCCAGGCTGCTACCAAGTTTAACCCAAGAG
TCCTCTCAAGAAATCGACTGCAATGACCAGGATGTATTTAAAGCTGTGGACGCTGCTCTG
ACAAAATACAACAGTGAAAACAAGAGTGGCAACCAGTTTGTATTGTACCGCATAACCGAG
GTCGCCAGAATGGATAATCCTGACACATTTTATTCCTTGAAGTACCAAATCAAGGAGGGC
GACTGTCCTTTTCAAAGTAACAAAACTTGGCAGGACTGTGACTACAAGGACTCTGCACAA
GCTGCCACAGGACAGTGCACAGCGACCGTGGCCAAGAGAGGGAATATGAAGTTCTCCGTG
GCTATCCAGACCTGCCTGATCACTCCAGCCGAGGGCCCCGTGGTGACAGCCCAGTATGAG
TGCCTTGGCTGTGTGCATCCCATATCTACCAAGAGCCCCGACTTGGAGCCTGTTCTGAGA
TATGCCATCCAATATTTTAACAACAACACCAGTCATTCCCACCTCTTTGATCTGAAAGAA
GTAAAAAGAGCCCAAAAACAGGTGGTGTCTGGATGGAACTATGAAGTTAATTACTCAATT
GCACAAACTAATTGTTCCAAGGAGGAATTTTCATTCTTAACTCCAGACTGCAAGTCCCTT
TCAAGTGGTGATACTGGTGAATGTACAGATAAAGCACATGTAGATGTCAAGCTAAGAATT
TCTTCCTTCTCGCAGAAATGTGACCTTTATCCAGGGGAGGATTTTTTACCCCCCATGGTT
TGTGTCGGCTGCCCCAAACCTATACCTGTTGACAGCCCAGACCTGGAGGAAGCTCTGAAC
CATTCCATCGCAAAGCTTAATGCAGAGCATGATGGAACCTTCTATTTCAAGATTGACACT
GTGAAAAAAGCAACAGTACAGGTGGTAGGTGGATTGAAGTATTCTATTGTGTTCATAGCA
AGGGAAACCACATGTTCTAAGGGAAGTAATGAAGAGCTGACCAAGAGTTGTGAGATCAAT
ATACATGGTCAAATTCTACACTGTGATGCTAATGTCTATGTGGTGCCTTGGGAGGAAAAA
GTTTACCCTACTGTCAACTGTCAACCACTTGGACAGACCTCACTCATGAAAAGGCCTCCG
GGTTTTTCACCTTTCCGATCAGTTCAAGTGATGAAAACTGAAGGAAGCACAACTGTAAGT
CTACCCCACTCTGCCATGTCACCTGTACAAGATGAAGAGCGGGATTCAGGAAAAGAACAA
GGACCCACTCATGGGCATGGCTGGGACCATGGAAAGCAAATAAAATTACATGGCCTTGGC
CTTGGCCATAAACATAAGCATGACCAAGGTCATGGGCACCATAGAAGTCATGGTCTTGGC
CATGGACATCAAAAGCAACATGGTCTTGGCCATGGACATAAGCATGGTCATGGCCACGGA
AAACATAAAAACAAAGGAAAAAACAATGGAAAGCATTATGATTGGAGGACACCCTATTTG
GCAAGTTCTTATGAAGATAGCACTACATCCTCTGCACAGACGCAAGAGAAGACAGAAGAG
ACAACACTCTCTTCCCTAGCCCAGCCAGGTGTAGCCATTACCTTTCCTGACTTTCAGGAC
TCAGATCTCATTGCAACTGTGATGCCTAATACACTACCACCTCACACAGAGAGTGATGAT
GACTGGATCCCTGACATCCAGACAGAGCCAAATAGCCTTGCATTTAAATTGATTTCAGAT
TTTCCAGAAACAACCTCCCCCAAATGTCCTAGTCGCCCCTGGAAGCCAGTTAATGGAGTG
AATCCAACTGTGGAAATGAAAGAGTCTCATGATTTTGATCTTGTTGATGCTCTTCTTTAA
Enzyme 5 GenBank Gene ID V01492 Link Image
Enzyme 5 GeneCard ID KNG2 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Not Available
Enzyme 5 Locus Not Available
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References
  1. [PubMed Link Image]
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 914
Enzyme 6 Name Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
Enzyme 6 Synonyms
  1. UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IVa
  2. N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVa
  3. N-acetylglucosaminyltransferase IVa
  4. GlcNAc-T IVa
  5. GnT-IVa
  6. Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A soluble form
Enzyme 6 Gene Name MGAT4A
Enzyme 6 Protein Sequence >Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase A
MRLRNGTVATVLAFITSFLTLSWYTTWQNGKEKVIAYQREFLALKERLRIAEHRISQRSS
ELSAIVQQFKRVEAETNRSKDPVNKFSDDTLKILKELTSKKSLQVPSIYYHLPHLLQNEG
SLQPAVQIGNGRTGVSIVMGIPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGET
DTDYVNGVVANLEKEFSKEISSGLVEIISPPESYYPDLTNLKETFGDSKERVRWRTKQNL
DYCFLMMYAQEKGTYYIQLEDDIIVKQNYFNTIKNFALQLSSEEWMILEFSQLGFIGKMF
QAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFRPSLFQ
HVGLHSSLTGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWA
ITPVAGDYILFKFDKPVNVESYLFHSGNQDHPGDILLNTTVEVLPLKSEGLDISKETKDK
RLEDGYFRIGKFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKVTN
Enzyme 6 Number of Residues 535
Enzyme 6 Molecular Weight 61617.4
Enzyme 6 Theoretical pI 7.00
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Involved in alpha-1,3-mannosylglycoprotein 4-beta-N-ace
Enzyme 6 Specific Function Glycosyltransferase that participates in the transfer of N-acetylglucosamine (GlcNAc) to the core mannose residues of N- linked glycans. Catalyzes the formation of the GlcNAcbeta1-4 branch on the GlcNAcbeta1-2Manalpha1-3 arm of the core structure of N-linked glycans. Essential for the production of tri- and tetra-antennary N-linked sugar chains. Involved in glucose transport by mediating SLC2A2/GLUT2 glycosylation, thereby controlling cell-surface expression of SLC2A2 in pancreatic beta cells
Enzyme 6 Pathways
  • Protein modification
  • protein glycosylation
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • 7-27
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 3273235 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID O77836 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name MGT4A_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >1608 bp
ATGAGGCTCCGAAATGGAACTGTAGCCACTGTTTTAGCATTTATCACCTCGTTCCTCACT
TTATCTTGGTATACAACATGGCAAAATGGGAAAGAAAAAGTGATTGCTTATCAACGAGAA
TTTCTTGCTCTGAAAGAACGTCTCCGAATAGCTGAACATCGAATCTCTCAGCGCTCTTCT
GAGCTCAGTGCCATTGTACAGCAATTCAAGCGTGTAGAAGCAGAAACAAACAGGAGTAAG
GATCCAGTGAATAAATTTTCAGATGATACCCTAAAGATACTAAAGGAGTTAACAAGCAAA
AAGTCTCTTCAAGTGCCAAGTATTTATTATCATTTGCCTCATTTATTGCAAAATGAAGGA
AGCCTTCAACCTGCCGTGCAGATCGGAAATGGACGAACAGGAGTTTCAATAGTAATGGGA
ATTCCTACAGTGAAGAGAGAAGTTAAATCTTACCTCATAGAAACTCTTCATTCCCTTATT
GATAATCTGTATCCTGAAGAGAAGTTGGACTGTGTTATAGTAGTCTTCATAGGAGAGACA
GATACTGATTATGTAAATGGTGTTGTAGCCAACCTGGAGAAAGAATTTTCTAAAGAAATC
AGTTCTGGCTTGGTGGAAATAATATCACCTCCTGAAAGCTATTATCCTGACCTGACGAAC
TTAAAGGAGACATTTGGAGATTCTAAAGAAAGAGTAAGATGGAGAACAAAGCAAAACCTA
GATTATTGTTTTCTAATGATGTATGCTCAGGAAAAAGGCACATACTACATCCAGCTTGAA
GATGATATTATTGTCAAACAGAATTACTTTAACACCATAAAGAATTTTGCACTTCAACTT
TCTTCTGAGGAATGGATGATACTTGAGTTCTCCCAGCTGGGATTCATTGGTAAAATGTTT
CAAGCACCTGACCTCACTCTGATTGTGGAATTCATATTTATGTTCTATAAGGAGAAGCCC
ATCGACTGGCTCTTGGACCATATTCTGTGGGTCAAAGTCTGCAACCCGGAAAAAGATGCA
AAACACTGTGATCGACAGAAGGCAAATCTGCGAATTCGTTTCAGACCGTCCCTTTTCCAA
CACGTTGGTCTGCATTCTTCACTCACAGGAAAAATTCAGAAACTCACGGATAAAGATTAC
ATGAAACCATTACTGCTCAAAATCCATGTAAACCCCCCTGCAGAGGTATCTACTTCTTTG
AAGGTCTACCAAGGTCATACACTGGAGAAAACTTACATGGGTGAGGACTTCTTCTGGGCT
ATAACCCCAGTAGCTGGAGACTACATCCTATTTAAATTCGACAAGCCAGTCAATGTGGAA
AGTTATTTGTTCCATAGTGGCAACCAGGATCATCCAGGGGATATTCTGCTCAACACAACG
GTGGAAGTTCTGCCTTTGAAGAGTGAAGGTTTGGACATCAGCAAAGAAACCAAAGACAAA
CGATTAGAAGATGGCTATTTCAGAATAGGGAAATTTGAAAACGGTGTTGCGGAAGGGATG
GTGGATCCCAGCCTAAACCCCATTTCGGCCTTCCGACTTTCAGTTATTCAGAATTCTGCT
GTTTGGGCCATTCTTAATGAGATCCATATTAAAAAAGTCACAAACTGA
Enzyme 6 GenBank Gene ID AB000628 Link Image
Enzyme 6 GeneCard ID MGAT4A Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:2
Enzyme 6 Locus 2q12
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References
  1. [PubMed Link Image]
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 915
Enzyme 7 Name Phosphatidylinositol 3-kinase regulatory subunit alpha
Enzyme 7 Synonyms
  1. PI3-kinase p85 subunit alpha
  2. PtdIns-3-kinase p85-alpha
  3. PI3K
Enzyme 7 Gene Name PIK3R1
Enzyme 7 Protein Sequence >Phosphatidylinositol 3-kinase regulatory subunit alpha
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEAKPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGPSKTEADSEQQASTLPDLAE
QFAPPDVAPPLLIKLVEAIEKKGLECSTLYRTQSSSNPAELRQLLDCDTASLDLEMFDVH
VLADAFKRYLLDLPNPVIPVAVSSELISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTL
QYLLKHFFKLSQTSSKNLLNARVLSELFSPLLFRFPAASSENTEHLIKIIEILISTEWNE
RQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVD
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
Enzyme 7 Number of Residues 724
Enzyme 7 Molecular Weight 83496.5
Enzyme 7 Theoretical pI 6.03
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Replication, recombination and repair
Enzyme 7 Specific Function Binds to activated (phosphorylated) protein-tyrosine kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane. Necessary for the insulin-stimulated increase in glucose uptake and glycogen synthesis in insulin-sensitive tissues
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • None
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 163477 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID P23727 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name P85A_BOVIN Link Image
Enzyme 7 PDB ID 1PBW Link Image
Enzyme 7 PDB File Show
Enzyme 7 3D Structure
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence Not Available
Enzyme 7 GenBank Gene ID M61745 Link Image
Enzyme 7 GeneCard ID PIK3R1 Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:5
Enzyme 7 Locus 5q13.1
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References
  1. [PubMed Link Image]
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 916
Enzyme 8 Name AMP-activated protein kinase gamma subunit
Enzyme 8 Synonyms Not Available
Enzyme 8 Gene Name PRKAG3
Enzyme 8 Protein Sequence >AMP-activated protein kinase gamma subunit
MSFLEQGDSTSWPSPAMTTSAEISLGEQRTKVSRWKSQEDVEERELPGLEGGPQSRAAAE
STGLEATFPKATPLAQATPLSAVGTPTTERDSLPSDCTASASSSSTDDLDQGIEFSAPAA
WGDELGLVEERPAQCPSPQVPVLRLGWDDELRKPGAQVYMHFMQEHTCYDAMATSSKLVI
FDTMLQIKKAFFALVANGVRAAPLWDSKKQSFVGMLTITDFILVLHRYYRFPLVQIYEIE
EHKIETWREIYLQGCFKPLVSISPSDSLFEAVYTLIKNRIHRLPVLDPVSGAVLHILTHK
RLLKFLHIFQRTLLPRPSFLYRTIQDLGIGTFRDLAVVLETAPILTALDIFVDRRVSALP
VINEAGQVVGLYSRFDVIHLAAQQTYNHLDISVGEALRRRTLCLEGVLSCQPHETLGEVI
DRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLSPAGIDALGA
Enzyme 8 Number of Residues 465
Enzyme 8 Molecular Weight 51522.5
Enzyme 8 Theoretical pI 5.31
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Involved in kinase activity
Enzyme 8 Specific Function Not Available
Enzyme 8 Pathways Not Available
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • None
Enzyme 8 Transmembrane Regions
  • None
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 56406642 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID Q4G3U3 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name Q4G3U3_BOVIN Link Image
Enzyme 8 PDB ID Not Available
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence Not Available
Enzyme 8 GenBank Gene ID AY692035 Link Image
Enzyme 8 GeneCard ID PRKAG3 Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:2
Enzyme 8 Locus 2q35
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References Not Available
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 917
Enzyme 9 Name RAC-alpha serine/threonine-protein kinase
Enzyme 9 Synonyms
  1. RAC-PK-alpha
  2. Protein kinase B
  3. PKB
Enzyme 9 Gene Name AKT1
Enzyme 9 Protein Sequence >RAC-alpha serine/threonine-protein kinase
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDLEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEETMDF
RSGSPGENSGAEEMEVSLAKPKHRVTMNDFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKEVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMEGVDSERRPHFPQFSYSASATA
Enzyme 9 Number of Residues 480
Enzyme 9 Molecular Weight 55748.0
Enzyme 9 Theoretical pI 5.70
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Involved in ATP binding
Enzyme 9 Specific Function General protein kinase capable of phosphorylating several known proteins. Phosphorylates TBC1D4. Signals downstream of phosphatidylinositol 3-kinase (PI(3)K) to mediate the effects of various growth factors such as platelet-derived growth factor (PDGF), epidermal growth factor (EGF), insulin and insulin-like growth factor I (IGF-I). Plays a role in glucose transport by mediating insulin-induced translocation of the GLUT4 glucose transporter to the cell surface. Mediates the antiapoptotic effects of IGF-I. Mediates insulin-stimulated protein synthesis by phosphorylating TSC2, thereby activating mTORC1 signaling and leading to both phosphorylation of 4E-BP1 and in activation of RPS6KB1. Promotes glycogen synthesis by mediating the insulin- induced activation of glycogen synthase
Enzyme 9 Pathways Not Available
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • None
Enzyme 9 Transmembrane Regions
  • None
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 631 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID Q01314 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name AKT1_BOVIN Link Image
Enzyme 9 PDB ID 1MRY Link Image
Enzyme 9 PDB File Show
Enzyme 9 3D Structure
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence >1443 bp
ATGAACGACGTGGCCATCGTGAAGGAGGGCTGGCTGCACAAGCGAGGTGAGTACATCAAG
ACGTGGCGGCCGCGTTACTTCCTCCTGAAGAACGATGGCACGTTCATTGGCTACAAGGAG
CGGCCGCAGGACCTGGAGCAGCGTGAGTCGCCCCTCAACAACTTCTCCGTGGCCCAATGC
CAGCTGATGAAGACGGAGCGGCCGCGGCCCAACACCTTCATCATCCGCTGCCTGCAGTGG
ACCACGGTCATCGAGCGCACGTTCCACGTGGAGACGCCCGAGGAGCGGGAGGAGTGGACC
ACCGCCATCCAGACGGTGGCCGACGGGCTCAAGAGGCAGGAGGAGGAGACGATGGACTTC
CGGTCGGGCTCACCCGGCGAGAACTCGGGGGCCGAGGAGATGGAGGTGTCGCTGGCCAAG
CCCAAGCACCGCGTGACCATGAATGAGTTTGAGTACGTGAAGCTGCTGGGCAAAGGCACT
TTCGGGAAGGTGATCCTGGTGAAGGAGAAGGCCACAGCGGCCTACTACGCCATGAAGATC
CTAAAGAAGGAGGTCATCGTGGCCAAGGACGAGGTGGCCCACACGCTCACAGAGAACCGC
GTTCTCCAGAACTCCCGGCACCCGTCCCTGACGGCCCTGAAGTACTCCTTCCAGACACAC
GACCGCCTGTGCTTCGTCATGGAGTACGCTAACGGGGGCGAGCTTTTCTTCCACCTGTCC
CGGGAGCGGGTGTTTTCCGAGGACCGGGCCCGTTTCTACGGCGCCGAGATCGTGTCGGCC
CTGGATTACCTGCACTCGGAAAAGGAAGTGGTGTACAGGGACCTCAAGCTGGAGAACCTC
ATGCTGGACAAGGACGGGCACATCAAGATCACCGACTTCGGACTGTGCAAGGAGGGCATC
AAGGATGGCGCCACCATGAAGACTTTCTGCGGGACCCCCGAATACCTGGCTCCCGAGGTG
CTGGAGGACAACGACTACGGCCGGGCAGTGGACTGGTGGGGGCTGGGTGTGGTCATGTAC
GAGATGATGTGCGGCCGCCTGCCCTTCTACAACCAGGACCACGAGAAGCTCTTTGAGCTC
ATTCTCATGGAGGAGATCCGCTTCCCCCGCACACTCAGCCCGGAGGCCAAGTCCCTGCTC
TCTGGGCTACTCAAGAAGGACCCCAAGCAGCGGCTTGGTGGGGGCTCTGAGGACGCCAAG
GAGATCATGCAGCACCGATTCTTCGCCAGCATCGTGTGGCAGGACGTGTACGAGAAGAAG
CTCAGCCCGCCCTTCAAGCCTCAGGTCACATCTGAGACGGACACCAGGTATTTTGATGAG
GAGTTCACGGCCCAGATGATCACCATTACGCCACCTGACCAAGACGACAGCATGGAGGGG
GTGGACAGCGAACGGAGGCCCCACTTCCCCCAGTTCTCCTACTCGGCCAGCGCGACGGCC
TGA
Enzyme 9 GenBank Gene ID X61036 Link Image
Enzyme 9 GeneCard ID AKT1 Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Chromosome:1
Enzyme 9 Locus 14q32.32|14q32.32
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References
  1. [PubMed Link Image]
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 918
Enzyme 10 Name Kininogen-1
Enzyme 10 Synonyms
  1. Kininogen I
  2. Thiol proteinase inhibitor
  3. Kininogen-1 heavy chain
  4. Bradykinin
  5. Kallidin I
  6. Lysyl-bradykinin
  7. Kallidin II
  8. Kininogen-1 light chain
Enzyme 10 Gene Name KNG1
Enzyme 10 Protein Sequence >Kininogen-1
MKLITILFLCSRLLPSLTQESSQEIDCNDQDVFKAVDAALTKYNSENKSGNQFVLYRITE
VARMDNPDTFYSLKYQIKEGDCPFQSNKTWQDCDYKDSAQAATGECTATVAKRGNMKFSV
AIQTCLITPAEGPVVTAQYECLGCVHPISTKSPDLEPVLRYAIQYFNNNTSHSHLFDLKE
VKRAQRQVVSGWNYEVNYSIAQTNCSKEEFSFLTPDCKSLSSGDTGECTDKAHVDVKLRI
SSFSQKCDLYPVKDFVQPPTRLCAGCPKPIPVDSPDLEEPLSHSIAKLNAEHDGAFYFKI
DTVKKATVQVVAGLKYSIVFIARETTCSKGSNEELTKSCEINIHGQILHCDANVYVVPWE
EKVYPTVNCQPLGQTSLMKRPPGFSPFRSVQVMKTEGSTTVSLPHSAMSPVQDEERDSGK
EQGPTHGHGWDHGKQIKLHGLGLGHKHKHDQGHGHHGSHGLGHGHQKQHGLGHGHKHGHG
HGKHKNKGKNNGKHYDWRTPYLASSYEDSTTSSAQTQEKTEETTLSSLAQPGVAITFPDF
QDSDLIATVMPNTLPPHTESDDDWIPDIQTEPNSLAFKLISDFPETTSPKCPSRPWKPVN
GVNPTVEMKESHDFDLVDALL
Enzyme 10 Number of Residues 621
Enzyme 10 Molecular Weight 68889.8
Enzyme 10 Theoretical pI 6.61
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Inorganic ion transport and metabolism
Enzyme 10 Specific Function (1) Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin- induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects:(4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action); (5) LMW-kininogen inhibits the aggregation of thrombocytes; (6) LMW- kininogen is in contrast to HMW-kininogen not involved in blood clotting
Enzyme 10 Pathways Not Available
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • 1-18
Enzyme 10 Transmembrane Regions
  • None
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 492 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID P01044 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name KNG1_BOVIN Link Image
Enzyme 10 PDB ID Not Available
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >1866 bp
ATGAAATTAATCACCATCCTTTTCCTTTGTTCCAGGCTGCTACCAAGTTTAACCCAAGAG
TCCTCTCAAGAAATCGACTGCAACGACCAGGATGTATTTAAAGCTGTGGACGCTGCTCTG
ACAAAATACAACAGTGAAAACAAGAGTGGCAACCAGTTTGTATTGTACCGCATAACCGAG
GTCGCCAGAATGGATAATCCTGACACATTTTATTCCTTGAAGTACCAAATCAAGGAGGGC
GACTGTCCTTTTCAAAGTAACAAAACTTGGCAGGACTGTGACTACAAGGACTCTGCACAA
GCTGCCACAGGAGAGTGCACAGCGACCGTGGCCAAGAGAGGGAATATGAAGTTCTCCGTG
GCTATCCAGACCTGCCTGATCACTCCAGCCGAGGGCCCCGTGGTGACAGCCCAGTATGAG
TGCCTTGGCTGTGTGCATCCCATATCTACCAAGAGCCCCGACTTGGAGCCTGTTCTGAGA
TATGCCATCCAATATTTTAACAACAACACCAGTCATTCCCACCTCTTTGATCTGAAAGAA
GTAAAAAGAGCCCAAAGACAGGTGGTGTCTGGATGGAACTATGAAGTTAATTACTCAATT
GCACAAACTAATTGTTCCAAGGAGGAATTTTCATTCTTAACTCCAGACTGCAAGTCCCTT
TCAAGTGGTGATACTGGTGAATGTACAGATAAAGCACATGTAGATGTCAAGCTAAGAATT
TCTTCCTTCTCGCAGAAATGTGACCTTTATCCAGTGAAGGATTTTGTACAACCACCCACC
AGGCTTTGTGCCGGCTGCCCCAAACCTATACCTGTTGACAGCCCAGACCTGGAGGAGCCT
CTGAGCCATTCCATCGCAAAGCTTAATGCAGAGCATGATGGAGCCTTCTATTTCAAGATT
GACACTGTGAAAAAAGCAACAGTACAGGTGGTAGCTGGATTGAAGTATTCTATTGTGTTC
ATAGCAAGGGAAACCACATGTTCTAAGGGAAGTAATGAAGAGCTGACCAAGAGTTGTGAG
ATCAATATACATGGTCAAATTCTACACTGTGATGCTAATGTCTATGTGGTGCCTTGGGAG
GAAAAAGTTTACCCTACTGTCAACTGTCAACCACTTGGACAGACCTCACTCATGAAAAGG
CCTCCGGGTTTTTCACCTTTCCGATCAGTTCAAGTGATGAAAACTGAAGGAAGCACAACT
GTAAGTCTACCCCACTCTGCCATGTCACCTGTACAAGATGAAGAGCGGGATTCAGGAAAA
GAACAAGGACCCACTCATGGGCATGGCTGGGACCATGGAAAGCAAATAAAATTACATGGC
CTTGGCCTTGGCCATAAACATAAGCATGACCAAGGTCATGGGCACCATGGAAGTCATGGT
CTTGGCCATGGACATCAAAAGCAACATGGTCTTGGCCATGGACATAAGCATGGTCATGGC
CACGGAAAACATAAAAACAAAGGAAAAAACAATGGAAAGCATTATGATTGGAGGACACCC
TATTTGGCAAGTTCTTATGAAGATAGCACTACATCCTCTGCACAGACGCAAGAGAAGACA
GAAGAGACAACACTCTCTTCCCTAGCCCAGCCAGGTGTAGCCATTACCTTTCCTGACTTT
CAGGACTCAGATCTCATTGCAACTGTGATGCCTAATACACTACCACCTCACACAGAGAGT
GATGATGACTGGATCCCTGACATCCAGACAGAGCCAAATAGCCTTGCATTTAAATTGATT
TCAGACTTTCCAGAAACAACCTCCCCCAAATGTCCTAGTCGCCCCTGGAAGCCAGTTAAT
GGAGTGAATCCAACTGTGGAAATGAAAGAGTCTCATGATTTTGATCTTGTTGATGCTCTT
CTTTAA
Enzyme 10 GenBank Gene ID V01491 Link Image
Enzyme 10 GeneCard ID KNG1 Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:3
Enzyme 10 Locus 3q27
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References
  1. [PubMed Link Image]
Enzyme 10 Metabolite References Not Available
Enzyme 11 [top]
Enzyme 11 ID 1330
Enzyme 11 Name Myosin-Ic
Enzyme 11 Synonyms
  1. Myosin I beta
  2. MMI-beta
  3. MMIb
Enzyme 11 Gene Name MYO1C
Enzyme 11 Protein Sequence >Myosin-Ic
MALQVELIPTGEIIRVVHPHRPCKLALGSDGVRVTMESALTARDRVGVQDFVLLENFTSE
AAFIENLRRRFRENLIYTYIGPVLVSVNPYRDLQIYSRQHMERYRGVSFYEVPPHLFAVA
DTVYRALRTERRDQAVMISGESGAGKTEATKRLLQFYAETCPAPERGGAVRDRLLQSNPV
LEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRVVHQNHGERNFHIF
YQLLEGGEEETLRRLGLERNPQSYLYLVKGQCAKVSSINDKSDWKVVRKALTVIDFTEDE
VEDLLSIVASVLHLGNTHFAADEESNAQVTTENQLKYLTRLLGVEGSTLREALTHRKIIA
KGEELLSPLNLEQAAYARDALAKAVYSRTFTWLVAKINRSLASKDAESPSWRSTTVLGLL
DIYGFEVFQHNSFEQFCINYCNEKLQQLFIELTLKSEQEEYEAEGIAWEPVQYFNNKIIC
DLVEEKFKGIISILDEECLRPGEATDLTFLEKLEDTIKQHPHFLTHKLADQRTRKSLDRG
EFRLLHYAGEVTYNVTGFLDKNNDLLFRNLKETMCSSENPILGQCFDRSELSDKKRPETV
ATQFKMSLLELVEILKSKEPAYVRCIKPNDSKQPGRFDEVLIRHQVKYLGLMENLRVRRA
GFAYRRKYEAFLQRYKSLCPETWPTWTGRPQDGVTVLVRHLGYKPEEYKMGRTKIFIRFP
KTLFATEDALEIRRQSLATKIQATWRGFHCRQKFLRVKRSAICIQSWWRGTLGRRKAAKR
KWAAQTIRRLIQGFILRHAPRCPENAFFVDHVRTSFLLNLRRQLPRNILDTSWPTPPPAL
REASELLRELCRKNMVWKYCRSISPEWKQQLQQKAVASEIFKGKKDNYPQSVPRLFISTR
LGADEINPRVLQALGSEPIQYAVPVVKYDRKGYKPRSRQLLLTPNAVVIVEDAKVKQRIE
YTNLTGISVSSLSDSLFVLHVQREDNKQKGDVVLQSDHVIETLTKTALSADRVNNININQ
GSITFAGGPGRDGIIDFTPGSELLITKAKNGHLAVVAPRLNSR
Enzyme 11 Number of Residues 1063
Enzyme 11 Molecular Weight 121934.7
Enzyme 11 Theoretical pI 9.67
Enzyme 11 GO Classification
Function
Process
Component
Enzyme 11 General Function Involved in actin binding
Enzyme 11 Specific Function Isoform 3 is involved in regulation of transcription. Associated with transcriptional active ribosomal genes. Appears to cooperate with the WICH chromatin-remodeling complex to facilitate transcription. Necessary for the formation of the first phosphodiester bond during transcription initiation
Enzyme 11 Pathways Not Available
Enzyme 11 Reactions Not Available
Enzyme 11 Pfam Domain Function
Enzyme 11 Signals
  • None
Enzyme 11 Transmembrane Regions
  • None
Enzyme 11 Essentiality Not Available
Enzyme 11 GenBank ID Protein 436937 Link Image
Enzyme 11 UniProtKB/Swiss-Prot ID Q27966 Link Image
Enzyme 11 UniProtKB/Swiss-Prot Entry Name MYO1C_BOVIN Link Image
Enzyme 11 PDB ID Not Available
Enzyme 11 Cellular Location Not Available
Enzyme 11 Gene Sequence >3087 bp
ATGGAGAGCGCACTGACCGCCCGTGACCGGGTGGGGGTACAGGACTTCGTGCTGCTGGAG
AACTTCACCAGCGAGGCCGCCTTCATCGAGAACCTGCGACGGCGCTTCCGGGAGAACCTG
ATCTACACCTACATTGGCCCCGTGCTGGTCTCTGTCAACCCCTACCGAGACCTGCAGATC
TACAGCCGACAGCACATGGAGCGTTACCGAGGCGTCAGCTTCTATGAGGTTCCACCTCAC
CTGTTCGCGGTGGCTGACACTGTCTATCGGGCACTGCGCACGGAGCGCGGGGACCAGGCA
GTGATGATCTCTGGGGAAAGCGGGGCAGGCAAGACCGAGGCCACCAAGCGGCTGCTGCAG
TTCTATGCCGAGACCTGCCCAGCCCCTGAGCGGGGTGGTGCTGTGCGGGACCGGCTGCTG
CAGAGCAACCCGGTGCTGGAGGCCTTTGGCAACGCGAAGACCCTCCGGAACGATAACTCC
AGCAGGTTTGGGAAGTACATGGACGTGCAGTTTGACTTCAAGGGTGCCCCCGTGGGTGGC
CACATCCTCAGTTACCTCCTGGAGAAGTCCCGGGTGGTGCACCAGAATCACGGGGAGAGG
AACTTCCACATCTTCTACCAGCTGCTGGAGGGGGGTGAGGAGGAGACGCTGCGCAGGCTG
GGCCTGGAACGGAACCCGCAGAGCTACCTGTACCTGGTGAAGGGCCAGTGCGCCAAAGTC
TCCTCCATCAACGACAAGAGTGATTGGAAGGTGGTCAGGAAGGCCCTGACTGTCATCGAC
TTCACCGAGGACGAGGTGGAGGACCTGTTAAGCATCGTGGCCAGCGTCCTGCATCTGGGC
AACACCCACTTTGCCGCCGATGAGGAGAGCAACGCCCAGGTCACCACCGAGAACCAGCTC
AAGTACCTGACCAGGCTCCTTGGTGTGGAAGGCTCAACGCTGCGGGAAGCCCTGACCCAC
AGAAAGATCATCGCCAAGGGCGAAGAGCTCCTGAGCCCGCTGAACCTAGAACAGGCTGCA
TATGCACGGGACGCCCTCGCCAAGGCTGTGTACAGTCGCACCTTTACCTGGCTGGTCGCG
AAGATCAACAGGTCGCTGGCCTCCAAGGATGCCGAGAGCCCCAGCTGGCGGAGCACCACG
GTCCTCGGGCTACTGGGCATTTACGGCTTTGAAGTGTTCCAGCACAACAGCTTTGAGCAG
TTCTGCATCAATTACTGCAATGAGAAGCTACAGCAGCTCTTCATCGAGCTCACCCTCAAG
TCAGAGCAGGAGGAGTATGAGGCCGAGGGCATCGCGTGGGAACCGGTCCAGTATTTCAAC
AACAAGATTATCTGTGACCTGGTGGAGGAGAAGTTCAAAGGCATCATCTCCATTTTGGAC
GAGGAGTGTCTGCGTCCCGGGGAGGCCACGGACCTGACCTTCCTGGAGAAGCTGGAGGAC
ACAATCAAGCAGCATCCACACTTCCTGACGCACAAGCTGGCTGACCAGCGGACCAGGAAA
TCTCTGGACCGCGGGGAGTTCCGCCTCCTGCACTATGCCGGGGAGGTGACCTACAACGTG
ACCGGGTTTCTGGATAAAAACAACGACCTTCTCTTCCGGAACCTGAAGGAGACCATGTGC
AGCTCGGAGAACCCCATCCTGGGCCAGTGCTTCGACCGGAGTGAGCTCAGCAGCAAGAAG
CGGCCAGAGACGGTGGCCACCCAGTTCAAGATGAGCCTCCTGGAGCTGGTAGAGATCTTG
AAGTCAAAGGAGCCTGCCTATGTCCGCTGCATCAAGCCCAATGACTCCAAGCAGCCCGGC
CGCTTTGATGAGGTGCTAATCCGGCACCAGGTGAAGTACCTAGGGCTGATGGAGAACCTG
CGTGTGCGCAGAGCCGGCTTTGCCTACCGCCGCAAATACGAGGCTTTCCTGCAGAGGTAC
AAGTCACTGTGCCCAGAGACATGGCCCACGTGGACAGGACGCCGCCAGGATGGGGTGACT
GTGCTGGTCAGGCACCTGGGCTACAAGCCGGAAGAGTACAAGATGGGCAGGACCAAGATC
TTCATCCGCTTCCCCAAGACCCTGTTTGCCACAGAGGACGCCTTGGAGATCCGACGACAG
AGCCTGGCCACGAAGATCCAGGCCACCTGGAGGGGCTTTCACTGCCGGCAGAAATTCCTC
CGGGTGAAGCGATCAGCGATCTGCATCCAGTCGTGGTGGCGAGGAACGCTGGGCCGGAGG
AAGGCGGCCAAGAGGAAGTGGGCGGCACAGACCATCCGGCGGCTCATCCAGGGCTTCATC
CTGCGCCATGCGCCCCGTTGCCCTGAGAATGCCTTCTTCGTGGACCATGTGCGCACCTCT
TTTCTGCTCAACCTTCGACGGCAGCTGCCCCGGAATATTCTGGACACTTCTTGGCCCACG
CCCCCACCTGCCCTGCGTGAGGCCTCAGAGCTGCTGCGGGAGCTGTGCCGGAAGAACATG
GTGTGGAAATACTGCCGGAGCATCAGCCCTGAATGGAAGCAGCAGCTGCAGCAAAAGGCC
GTTGCGAGTGAGATCTTCAAGGGCAAGAAGGACAATTACCCCCAGAGTGTCCCCAGACTC
TTCATCAGCACGCGGCTCGGTGCAGATGAGATCAACCCCAGAGTGCTGCAGGCCCTGGGC
TCGGAGCCCATCCAGTACGCCGTGCCCGTCGTGAAGTACGACCGCAAGGGCTACAAGCCG
CGCTCCCGGCAGCTGCTGCTGACGCCCAACGCCGTGGTCATTGTGGAGGACGCCAAGGTC
AAGCAGAGGATTGAGTACACCAACCTGACCGGAATCTCCGTCAGCAGCCTGAGCGACAGC
CTCTTTGTGCTCCACGTGCAGCGTGAGGACAATAAGCAGAAGGGGGACGTGGTGCTGCAG
AGTGACCACGTGATCGAGACCCTGACCAAGACAGCCCTCAGCGCTGACCGAGTGAACAAC
ATCAACATCAACCAGGGCAGCATCACGTTCGCAGGGGGGCCCGGCAGGGATGGCATCATT
GACTTCACACCCGGCTCGGAGCTGCTCATCACCAAGGCCAAGAACGGGCACCTGGCTGTG
GTGGCCCCGCGGCTGAACTCGCGGTGA
Enzyme 11 GenBank Gene ID U03420 Link Image
Enzyme 11 GeneCard ID MYO1C Link Image
Enzyme 11 GenAtlas ID Not Available
Enzyme 11 HGNC ID Not Available
Enzyme 11 Chromosome Location Chromosome:1
Enzyme 11 Locus 17p13
Enzyme 11 SNPs SNPJam Report Link Image
Enzyme 11 General References
  1. [PubMed Link Image]
Enzyme 11 Metabolite References Not Available
Enzyme 12 [top]
Enzyme 12 ID 1617
Enzyme 12 Name Collectin-43
Enzyme 12 Synonyms
  1. 43 kDa collectin
  2. CL-43
Enzyme 12 Gene Name CL43
Enzyme 12 Protein Sequence >Collectin-43
MLPLPLSILLLLTQSQSFLGEEMDVYSEKTLTDPCTLVVCAPPADSLRGHDGRDGKEGPQ
GEKGDPGPPGMPGPAGREGPSGRQGSMGPPGTPGPKGEPGPEGGVGAPGMPGSPGPAGLK
GERGTPGPGGAIGPQGPSGAMGPPGLKGDRGDPGEKGARGETSVLEVDTLRQRMRNLEGE
VQRLQNIVTQYRKAVLFPDGQAVGEKIFKTAGAVKSYSDAEQLCREAKGQLASPRSSAEN
EAVTQLVRAKNKHAYLSMNDISKEGKFTYPTGGSLDYSNWAPGEPNNRAKDEGPENCLEI
YSDGNWNDIECREERLVICEF
Enzyme 12 Number of Residues 321
Enzyme 12 Molecular Weight 33615.3
Enzyme 12 Theoretical pI 4.76
Enzyme 12 GO Classification
Function
Process
Component
Enzyme 12 General Function Carbohydrate transport and metabolism
Enzyme 12 Specific Function Lectin that binds to various sugars:mannose = ManNAc > fucose > GlcNAc > glucose = maltose > galactose > lactose > galNAc. Could play a role in immune defense
Enzyme 12 Pathways Not Available
Enzyme 12 Reactions Not Available
Enzyme 12 Pfam Domain Function
Enzyme 12 Signals
  • 1-20
Enzyme 12 Transmembrane Regions
  • None
Enzyme 12 Essentiality Not Available
Enzyme 12 GenBank ID Protein 18252109 Link Image
Enzyme 12 UniProtKB/Swiss-Prot ID P42916 Link Image
Enzyme 12 UniProtKB/Swiss-Prot Entry Name CL43_BOVIN Link Image
Enzyme 12 PDB ID Not Available
Enzyme 12 Cellular Location Not Available
Enzyme 12 Gene Sequence >966 bp
ATGCTTCCCCTCCCTCTCTCCATATTGCTCCTGCTCACACAGTCCCAGAGTTTCCTGGGC
GAAGAAATGGATGTCTATTCTGAGAAAACCCTCACCGATCCCTGCACCCTGGTTGTGTGT
GCTCCACCAGCAGATAGCCTTCGTGGTCATGATGGACGAGATGGGAAAGAAGGCCCCCAG
GGAGAGAAGGGGGATCCAGGGCCTCCAGGTATGCCTGGACCAGCTGGAAGAGAGGGCCCC
TCAGGGAGGCAGGGGAGCATGGGACCTCCAGGCACACCAGGCCCCAAAGGAGAACCTGGG
CCCGAAGGAGGAGTGGGTGCCCCAGGCATGCCCGGCTCCCCAGGCCCCGCAGGTCTCAAA
GGAGAGAGAGGTACCCCTGGGCCTGGTGGAGCCATCGGTCCACAGGGACCTTCAGGTGCC
ATGGGTCCCCCAGGACTGAAGGGAGACAGAGGTGATCCTGGAGAAAAAGGAGCAAGGGGG
GAGACTTCAGTCCTAGAGGTTGATACTCTAAGGCAGCGGATGAGAAACTTAGAGGGAGAA
GTTCAACGCCTCCAGAACATAGTCACTCAGTACAGGAAAGCGGTGCTCTTCCCTGATGGC
CAGGCTGTCGGGGAGAAGATCTTCAAGACGGCAGGTGCTGTAAAGTCATATTCGGATGCA
GAGCAGCTCTGCAGAGAGGCTAAGGGACAGCTGGCCTCCCCACGCTCTTCAGCCGAGAAC
GAGGCCGTGACACAGCTGGTCAGAGCCAAGAACAAGCATGCTTACCTGAGCATGAATGAC
ATCTCCAAAGAGGGCAAGTTCACCTACCCAACGGGGGGGTCACTGGACTATTCCAACTGG
GCCCCCGGGGAGCCCAACAATAGGGCAAAAGACGAAGGCCCAGAGAACTGTCTTGAGATC
TATTCCGATGGCAATTGGAATGACATAGAATGCAGGGAGGAGCGCCTCGTGATCTGTGAG
TTCTGA
Enzyme 12 GenBank Gene ID AY071821 Link Image
Enzyme 12 GeneCard ID CL43 Link Image
Enzyme 12 GenAtlas ID Not Available
Enzyme 12 HGNC ID Not Available
Enzyme 12 Chromosome Location Not Available
Enzyme 12 Locus Not Available
Enzyme 12 SNPs SNPJam Report Link Image
Enzyme 12 General References
  1. [PubMed Link Image]
Enzyme 12 Metabolite References Not Available
Enzyme 13 [top]
Enzyme 13 ID 1874
Enzyme 13 Name Sodium/myo-inositol cotransporter 2
Enzyme 13 Synonyms
  1. Na+/myo-inositol cotransporter 2
  2. Solute carrier family 5 member 11
Enzyme 13 Gene Name SLC5A11
Enzyme 13 Protein Sequence >Sodium/myo-inositol cotransporter 2
MESSASSPPLTQSDPLEAFPRRTLEAGDIAVLVLYFLFVLAVGLWSTVKTKRDTVKGYFL
AGGNMLWWPVGASLFASNVGSGHFVGLAGSGAAAGLSVTAYELNGLFFVLMLSWIFLPIY
ITGQVTTMPEYLRKRFGGNRIPIILAVLYLFIYIFTKISVDMYAGAIFIQQSLHVNLYLA
IVGLLAVTALYTIAGGLAAVIYTDALQTLIMLIGALILMGYSFAAVGGLEGLEEKYFLAM
ASNRSGNSSCGLPREDAFHIFRDPVTSDLPWPGILFGMSIPSLWYWCTDQVIVQRTLAAK
NLSHAKGGSLMAAYLKVLPLFIMVFPGMVSRVLFPDEVACADPEICRKVCSNPAGCSDIA
YPKLVLELLPTGLRGLMMAVMVAALTSSLTSIFNSASTIFTMDLWNHLRPRASEKELMIV
GRVFVLLLVLVSILWIPVVQASQGGQLFIYIQSISSYLQPPVAVVFIMGCFWKRANEKGA
FFGLVLGLLLGLVRLILDFIYVQPRCDQLDERPAVVKDVHYLYFSMILSSVTLITVCAVS
WFTEPPSKEMVSRLTWFTRHDPVVQKEQVPSATPPPLTLSQNGTPEASGTNTQFEMVQEN
LSKTHSCDMTTKRSKVVKAILWLCGVENKGKEQAPSRADPIIVSLEENPLVKTLLDLNLI
ICISCAIFLWGYFA
Enzyme 13 Number of Residues 674
Enzyme 13 Molecular Weight 73956.4
Enzyme 13 Theoretical pI 7.59
Enzyme 13 GO Classification
Function
Process
Component
Enzyme 13 General Function Involved in sodium ion binding
Enzyme 13 Specific Function Involved in the sodium-dependent cotransport of myo- inositol (MI) with a Na(+):MI stoichiometry of 2:1. Exclusively responsible for apical MI transport and absorption in intestine. Also can transport D-chiro-inositol (DCI) but not L-fructose. Exhibits stereospecific cotransport of both D-glucose and D- xylose. May induce apoptosis through the TNF-alpha, PDCD1 pathway. May play a role in the regulation of MI concentration in serum, involving reabsorption in at least the proximal tubule of the kidney
Enzyme 13 Pathways Not Available
Enzyme 13 Reactions Not Available
Enzyme 13 Pfam Domain Function
Enzyme 13 Signals
  • None
Enzyme 13 Transmembrane Regions
  • 26-46 57-77 103-123 141-161 181-201 209-229 273-293 309-329 375-397 419-439 447-467 480-500 522-542 654-674
Enzyme 13 Essentiality Not Available
Enzyme 13 GenBank ID Protein 73587027 Link Image
Enzyme 13 UniProtKB/Swiss-Prot ID Q3ZC26 Link Image
Enzyme 13 UniProtKB/Swiss-Prot Entry Name SC5AB_BOVIN Link Image
Enzyme 13 PDB ID Not Available
Enzyme 13 Cellular Location Not Available
Enzyme 13 Gene Sequence >2025 bp
ATGGAGAGCAGCGCCAGCAGCCCTCCTCTCACACAGTCAGATCCCCTGGAGGCGTTTCCC
CGGAGGACGCTGGAAGCAGGAGACATCGCAGTGCTGGTTCTATATTTCCTCTTTGTCCTG
GCTGTTGGACTATGGTCCACAGTGAAGACCAAAAGAGACACCGTGAAAGGCTACTTTCTA
GCTGGAGGCAACATGCTGTGGTGGCCAGTGGGTGCATCCTTGTTTGCCAGCAACGTTGGA
AGTGGACATTTCGTTGGCCTGGCAGGGTCAGGTGCTGCTGCGGGTCTTTCTGTAACTGCT
TATGAGCTTAATGGCTTATTTTTCGTGCTGATGTTGTCCTGGATCTTCCTTCCAATCTAC
ATCACTGGTCAGGTCACCACGATGCCAGAGTACCTACGGAAACGTTTTGGTGGCAACAGG
ATTCCCATCATCCTGGCTGTGCTCTACCTGTTTATCTACATCTTCACCAAGATCTCGGTG
GACATGTATGCAGGCGCCATCTTCATTCAGCAGTCTTTGCATGTGAATCTCTACTTGGCC
ATAGTCGGGTTGCTGGCCGTCACAGCTCTATACACCATCGCAGGTGGCCTGGCAGCTGTG
ATCTACACGGATGCTCTACAGACTCTGATCATGCTTATAGGAGCGCTCATCCTGATGGGC
TACAGTTTTGCTGCAGTTGGTGGGTTGGAAGGCTTGGAGGAGAAATATTTTTTGGCAATG
GCCAGCAACCGGAGCGGGAACAGCAGCTGCGGGTTGCCCCGGGAAGATGCCTTCCATATT
TTCCGAGACCCAGTGACGTCTGATCTCCCATGGCCCGGGATCCTATTTGGAATGTCCATC
CCGTCTCTCTGGTATTGGTGCACGGATCAGGTGATTGTTCAGCGGACTCTGGCTGCCAAG
AACCTGTCCCACGCCAAAGGGGGCTCTCTGATGGCCGCATACCTGAAGGTGCTACCCCTT
TTCATCATGGTGTTCCCGGGTATGGTCAGCCGTGTCCTCTTTCCAGACGAAGTAGCTTGT
GCAGACCCAGAAATCTGCCGGAAGGTCTGTAGCAACCCCGCCGGCTGCTCTGACATCGCG
TATCCCAAACTTGTGCTGGAACTCCTGCCTACAGGGCTCCGTGGGCTCATGATGGCTGTG
ATGGTGGCGGCGCTCACGTCTTCCCTCACCTCCATCTTTAACAGTGCCAGCACCATCTTC
ACCATGGACCTCTGGAACCATCTCCGGCCTCGGGCATCTGAGAAGGAGCTCATGATTGTG
GGCAGGGTGTTTGTGTTGCTTCTGGTGTTGGTCTCCATCCTCTGGATCCCTGTGGTCCAG
GCCAGCCAGGGCGGCCAGCTCTTCATCTACATCCAGTCCATCAGCTCCTACCTACAGCCA
CCTGTGGCTGTGGTCTTCATCATGGGATGTTTCTGGAAGCGGGCCAATGAAAAGGGTGCC
TTCTTCGGTCTCGTCTTAGGCCTCCTCCTAGGCTTGGTTAGGCTGATCCTGGACTTCATT
TACGTGCAGCCTCGCTGTGACCAGCTGGATGAGCGCCCAGCCGTGGTAAAGGATGTCCAC
TACCTCTACTTCTCTATGATCCTGTCCTCGGTCACCCTGATCACAGTGTGTGCCGTGAGC
TGGTTCACAGAGCCGCCCTCCAAGGAAATGGTCAGTCGCTTGACCTGGTTTACTCGCCAT
GACCCCGTGGTCCAGAAGGAACAGGTGCCGTCAGCAACCCCACCGCCTCTTACCCTTTCT
CAAAACGGGACACCAGAGGCCAGCGGCACCAACACCCAGTTCGAGATGGTTCAAGAAAAC
CTGTCCAAAACCCACAGCTGCGACATGACCACAAAGCGGTCCAAAGTGGTGAAAGCCATC
TTGTGGCTCTGTGGGGTGGAGAACAAGGGCAAGGAGCAAGCACCCAGCAGAGCGGACCCG
ATCATAGTTTCCCTGGAAGAAAACCCCTTGGTGAAAACCCTTCTGGACCTCAACCTCATC
ATTTGCATCAGCTGTGCCATATTTCTCTGGGGCTACTTTGCTTAA
Enzyme 13 GenBank Gene ID BC102962 Link Image
Enzyme 13 GeneCard ID SLC5A11 Link Image
Enzyme 13 GenAtlas ID Not Available
Enzyme 13 HGNC ID Not Available
Enzyme 13 Chromosome Location Chromosome:1
Enzyme 13 Locus 16pter-p11
Enzyme 13 SNPs SNPJam Report Link Image
Enzyme 13 General References Not Available
Enzyme 13 Metabolite References Not Available
Enzyme 14 [top]
Enzyme 14 ID 1883
Enzyme 14 Name Peroxisome proliferator-activated receptor gamma
Enzyme 14 Synonyms
  1. PPAR-gamma
  2. Nuclear receptor subfamily 1 group C member 3
Enzyme 14 Gene Name PPARG
Enzyme 14 Protein Sequence >Peroxisome proliferator-activated receptor gamma
MGETLGDALIDPESEPFAVTVSARTSQEITMVDTEMPFWPTNFGISSVDLSMMDDHSHAF
DIKPFTTVDFSSISTPHYEDIPFPRADPMVADYKYDLKLQEYQSAIKVEPVSPPYYSEKT
QLYSKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHISPLQE
PSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
Enzyme 14 Number of Residues 505
Enzyme 14 Molecular Weight 57578.8
Enzyme 14 Theoretical pI 6.04
Enzyme 14 GO Classification
Function
Process
Component
Enzyme 14 General Function Involved in protein binding
Enzyme 14 Specific Function Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the receptor binds to a promoter element in the gene for acyl-CoA oxidase and activates its transcription. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis
Enzyme 14 Pathways Not Available
Enzyme 14 Reactions Not Available
Enzyme 14 Pfam Domain Function
Enzyme 14 Signals
  • None
Enzyme 14 Transmembrane Regions
  • None
Enzyme 14 Essentiality Not Available
Enzyme 14 GenBank ID Protein 2653406 Link Image
Enzyme 14 UniProtKB/Swiss-Prot ID O18971 Link Image
Enzyme 14 UniProtKB/Swiss-Prot Entry Name PPARG_BOVIN Link Image
Enzyme 14 PDB ID 1I7I Link Image
Enzyme 14 PDB File Show
Enzyme 14 3D Structure
Enzyme 14 Cellular Location Not Available
Enzyme 14 Gene Sequence >1518 bp
ATGGGTGAAACTCTGGGAGATGCTCTTATTGACCCAGAGAGTGAGCCCTTCGCTGTCACA
GTGTCTGCAAGGACCTCACAAGAAATTACCATGGTTGACACAGAGATGCCGTTTTGGCCC
ACCAACTTTGGGATCAGCTCCGTGGACCTTTCTATGATGGATGACCACTCCCATGCCTTT
GACATCAAGCCCTTCACCACCGTTGACTTCTCCAGCATTTCCACTCCGCACTATGAGGAC
ATTCCGTTCCCAAGAGCTGACCCGATGGTTGCAGATTATAAGTATGACCTGAAGCTCCAA
GAGTACCAAAGTGCAATCAAAGTGGAGCCTGTATCCCCACCTTATTATTCTGAAAAGACT
CAGCTGTACAGTAAGCCTCATGAAGAGCCTTCCAACTCCCTCATGGCCATTGAATGCCGG
GTCTGTGGGGATAAAGCGTCAGGGTTCCACTATGGAGTTCATGCTTGTGAAGGATGCAAG
GGTTTCTTCCGGAGGACAATCAGATTGAAACTTATTTACGATAGGTGTGATCTTAACTGT
CGGATCCACAAGAAAAGTAGAAATAAATGTCAGTACTGTCGGTTTCAGAAGTGCCTTGCT
GTGGGGATGTCTCATAATGCCATCAGGTTTGGGCGCATGCCACAGGCCGAGAAGGAGAAG
CTGTTAGCGGAGATCTCCAGCGATATCGACCAACTGAACCCAGAGTCTGCTGACCTCCGG
GCCCTGGCAAAGCATTTGTATGACTCGTACATAAAGTCCTTCCCGCTGACCAAAGCAAAG
GCGAGGGCGATCTTGACGGGAAAGACGACAGACAAATCACCGTTTGTTATCTATGACATG
AACTCCTTAATGATGGGAGAAGATAAAATCAAGTTCAAGCACATCAGTCCCCTGCAGGAG
CCCAGCAAAGAGGTGGCCATCCGCATCTTCCAGGGGTGTCAGTTTCGCTCCGTGGAAGCC
GTGCAGGAGATCACAGAGTACGCCAAGAATATCCCCGGCTTTGTGAACCTTGACTTGAAC
GACCAAGTAACTCTCCTAAAATACGGCGTGCACGAGATCATTTACACGATGCTGGCCTCC
TTGATGAATAAGGATGGGGTCCTCATATCCGAGGGCCAAGGATTCATGACAAGGGAGTTT
CTAAAGAGCCTGCGAAAGCCCTTTGGTGACTTTATGGAGCCCAAGTTCGAGTTTGCTGTG
AAGTTCAACGCACTGGAATTAGATGACAGCGACTTAGCAATATTTATAGCTGTCATTATT
CTCAGTGGAGACCGCCCAGGTTTGCTGAACGTGAAGCCCATTGAGGACATACAAGACAAT
CTGCTGCAAGCCTTGGAGCTGCAGCTCAAGCTGAACCACCCCGAGTCCTCCCAGCTCTTT
GCCAAGCTGCTCCAGAAAATGACAGACCTCAGACAGATTGTGACAGAACACGTGCAGCTG
TTGCAAGTAATAAAGAAAACAGAGACGGACATGAGTCTCCACCCACTCCTACAGGAAATC
TACAAGGACTTGTATTAG
Enzyme 14 GenBank Gene ID Y12420 Link Image
Enzyme 14 GeneCard ID PPARG Link Image
Enzyme 14 GenAtlas ID Not Available
Enzyme 14 HGNC ID Not Available
Enzyme 14 Chromosome Location Chromosome:3
Enzyme 14 Locus 3p25
Enzyme 14 SNPs SNPJam Report Link Image
Enzyme 14 General References
  1. [PubMed Link Image]
Enzyme 14 Metabolite References Not Available
Enzyme 15 [top]
Enzyme 15 ID 2025
Enzyme 15 Name Solute carrier family 2, facilitated glucose transporter member 4
Enzyme 15 Synonyms
  1. Glucose transporter type 4, insulin-responsive
  2. GLUT-4
Enzyme 15 Gene Name SLC2A4
Enzyme 15 Protein Sequence >Solute carrier family 2, facilitated glucose transporter member 4
MPSGFQQIGSEDGEPPRQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETW
LGRQGPEGPGSIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLFNNALAV
LGGTLMGLAKAAASYEMLILGRFFIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI
VTGILIAQVLGLESMLGTATLWPLLLGITVLPALLQMVLLPLCPESPRYLYIIRNLEGPA
RKSLKRLTGWADVSEVLAELKEEKRKLERERPLSLLQLLGSHTHRQPLVIAIVLQLSQQL
SGINAVFYYSTSIFESAGVEKPAYATIGAGVVNTVFTLVSVFLVERAGRRTLHLLGLAGM
CGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTCNFIIGMGFQYVADAMGPYVFLLFAVLLLGFFIFTFLKVPETRGRTFDQIS
AVFHRTPSLLEQEVKPSTELEYLGPDEHD
Enzyme 15 Number of Residues 509
Enzyme 15 Molecular Weight 55083.3
Enzyme 15 Theoretical pI 7.54
Enzyme 15 GO Classification
Function
Process
Component
Enzyme 15 General Function Carbohydrate transport and metabolism
Enzyme 15 Specific Function Insulin-regulated facilitative glucose transporter
Enzyme 15 Pathways Not Available
Enzyme 15 Reactions Not Available
Enzyme 15 Pfam Domain Function
Enzyme 15 Signals
  • None
Enzyme 15 Transmembrane Regions
  • 25-45 82-102 112-132 143-163 172-192 201-221 288-308 324-344 354-374 385-405 418-438 446-466
Enzyme 15 Essentiality Not Available
Enzyme 15 GenBank ID Protein 2244711 Link Image
Enzyme 15 UniProtKB/Swiss-Prot ID Q27994 Link Image
Enzyme 15 UniProtKB/Swiss-Prot Entry Name GTR4_BOVIN Link Image
Enzyme 15 PDB ID Not Available
Enzyme 15 Cellular Location Not Available
Enzyme 15 Gene Sequence >1530 bp
ATGCCGTCGGGCTTCCAACAGATCGGCTCTGAAGATGGGGAGCCCCCTCGGCAGCGAGTC
ACTGGGACCTTGGTCCTTGGCGTATTCTCCGCTGTTCTTGGCTCCCTGCAGTTTGGCTAC
AACATTGGGGTCATCAATGCCCCCCAGAAGGTGATTGAACAGAGCTACAATGAGACCTGG
CTGGGGAGGCAGGGGCCTGAGGGACCCGGCTCCATCCCACCAGGCACACTTACCACACTC
TGGGCTCTCTCCGTGGCCATCTTCTCTGTGGGTGGCATGATCTCATCCTTCCTGATTGGC
ATCATCTCTCAGTGGCTGGGAAGGAAGAGGGCCATGCTGTTCAGCAACGCCCTGGCAGTG
CTGGGGGGCACCCTCATGGGCCTGGCCAAGGCAGCTGCCTCCTATGAGATGCTCATTCTT
GGACGGTTCTTCATTGGAGCCTACTCAGGACTGACGTCGGGACTGGTACCCATGTACGTG
GGGGAGATTGCCCCTACTCACCTGCGGGGCGCCCTGGGGACACTCAATCAACTAGCCATC
GTCACTGGCATCCTAATCGCCCAGGTGCTAGGTTTGGAGTCCATGCTGGGCACAGCCACC
TTATGGCCACTCCTCCTGGGCATCACCGTGCTGCCTGCCCTCCTGCAGATGGTCCTGCTG
CCCCTCTGCCCGGAAAGCCCCCGCTACCTCTACATCATCCGGAACCTGGAGGGGCCCGCC
AGAAAGAGTCTGAAGCGCCTGACGGGGTGGGCCGACGTGTCTGAGGTGTTGGCTGAGCTG
AAGGAGGAGAAGCGGAAGCTGGAGCGTGAGCGGTCCCTGTCCTTGCTCCAGCTCCTGGGC
AGCCACACCCATCGGCAGCCCCTCGTCATCGCCATTGTGCTGCAGCTGAGCCAGCAGCTC
TCAGGCATCAATGCGGTTTTCTATTATTCCACCAGCATCTTTGAGTCAGCGGGGGTAGAG
AAACCAGCCTATGCCACCATTGGAGCCGGCGTGGTCAACACAGTCTTCACCTTAGTCTCG
GTGTTCTTGGTGGAACGGGCTGGGCACCGGACCCTCCATCTCCTGGGCCTGGCAGGCATG
TGTGCCTGCGCCATCTTGATGACTGTGGCTCTGCTTCTGCTGGAGCGGGTTCCAGCCATG
AGCTATGTCTCCATTGTGGCCATCTTTGGCTTCGTGGCCTTCTTTGAAATTGGCCCTGGC
CCCATCCCCTGTTTCATCGTGGCCGAGCTCTTCAGCCAGGGGCCCCGCCCAGCGGCCATG
GCAGTGGCTGGGTTCTCCAACTGGACATGCAACTTCATCATCGGCATGGGTTTCCAGTAT
GTGGCGGATGCTATGGGTCCCTACGTCTTTCTTCTATTCGCGGTCCTCCTGCTTGGCTTC
TTCATCTTCACCTTCTTAAAAGTGCCTGAAACCCGAGGCAGGACGTTTGACCAGATCTCA
GCCGTTTTCCACCGGACACCTTCTCTTCTGGAGCAGGAAGTGAAACCCAGCACAGAACTG
GAGTACTTAGGGCCAGATGAGCATGACTGA
Enzyme 15 GenBank Gene ID D63150 Link Image
Enzyme 15 GeneCard ID SLC2A4 Link Image
Enzyme 15 GenAtlas ID Not Available
Enzyme 15 HGNC ID Not Available
Enzyme 15 Chromosome Location Chromosome:1
Enzyme 15 Locus 17p13
Enzyme 15 SNPs SNPJam Report Link Image
Enzyme 15 General References
  1. [PubMed Link Image]
Enzyme 15 Metabolite References Not Available
Enzyme 16 [top]
Enzyme 16 ID 2034
Enzyme 16 Name Solute carrier family 2, facilitated glucose transporter member 1
Enzyme 16 Synonyms
  1. Glucose transporter type 1, erythrocyte/brain
  2. GLUT-1
Enzyme 16 Gene Name SLC2A1
Enzyme 16 Protein Sequence >Solute carrier family 2, facilitated glucose transporter member 1
MEPTSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVQRYGEPIPPAT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTELRGALGTLHQLGIVVGILIAQVFGLDSIM
GNQELWPLLLSVIFIPALLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRD
LQEMKEESRQMMREKKVTILELFRSAAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLER
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
Enzyme 16 Number of Residues 492
Enzyme 16 Molecular Weight 54131.4
Enzyme 16 Theoretical pI 8.92
Enzyme 16 GO Classification
Function
Process
Component
Enzyme 16 General Function Carbohydrate transport and metabolism
Enzyme 16 Specific Function Facilitative glucose transporter. This isoform may be responsible for constitutive or basal glucose uptake. Has a very broad substrate specificity; can transport a wide range of aldoses including both pentoses and hexoses
Enzyme 16 Pathways Not Available
Enzyme 16 Reactions Not Available
Enzyme 16 Pfam Domain Function
Enzyme 16 Signals
  • None
Enzyme 16 Transmembrane Regions
  • 13-33 67-87 96-116 127-147 156-176 186-206 272-292 307-327 338-358 369-389 402-422 430-450
Enzyme 16 Essentiality Not Available
Enzyme 16 GenBank ID Protein 163105 Link Image
Enzyme 16 UniProtKB/Swiss-Prot ID P27674 Link Image
Enzyme 16 UniProtKB/Swiss-Prot Entry Name GTR1_BOVIN Link Image
Enzyme 16 PDB ID Not Available
Enzyme 16 Cellular Location Not Available
Enzyme 16 Gene Sequence >1479 bp
ATGGAGCCCACCAGCAAGAAGCTGACAGGCCGCCTCATGCTGGCCGTGGGAGGGGCAGTG
CTCGGCTCCCTGCAGTTTGGCTACAACACTGGAGTCATCAACGCCCCCCAGAAGGTGATT
GAAGAGTTCTACAACCAGACGTGGGTCCAGCGCTATGGGGAGCCCATCCCGCCCGCCACG
CTGACCACGCTCTGGTCCCTGTCTGTGGCCATCTTCTCGGTGGGAGGCATGATTGGTTCC
TTCTCCGTGGGCCTTTTTGTTAACCGTTTCGGCCGGCGGAATTCAATGCTGATGATGAAC
CTGCTGGCCTTCGTGTCCGCTGTGCTCATGGGCTTCTCAAAACTGGGAAAGTCCTTTGAG
ATGCTGATCCTGGGTCGCTTCATCATCGGTGTGTACTGCGGCCTGACCACTGGTTTTGTG
CCCATGTACGTGGGGGAGGTATCCCCCACGGAGCTTCGAGGGGCCCTGGGCACCCTGCAC
CAGCTAGGCATCGTCGTCGGCATCCTCATCGCCCAGGTGTTCGGCCTGGACTCCATCATG
GGCAACCAGGAACTGTGGCCCCTGCTGCTGAGCGTCATCTTCATCCCAGCCCTGTTGCAG
TGCATCCTGCTGCCCTTCTGCCCCGAGAGCCCCCGCTTCCTGCTCATTAACCGCAACGAG
GAGAACCGGGCCAAGAGCGTGCTGAAGAAGCTGCGTGGGACCGCGGACGTGACCCGCGAC
CTGCAGGAGATGAAGGAGGAGAGCCGGCAGATGATGCGGGAGAAGAAGGTCACCATCCTG
GAGCTGTTCCGCTCAGCCGCCTACCGCCAGCCCATCCTCATTGCCGTGGTGCTGCAGCTG
TCCCAGCAGCTGTCCGGCATCAACGCTGTTTTCTATTACTCCACAAGCATCTTCGAGAAG
GCGGGGGTGCAGCAGCCCGTGTATGCCACCATCGGCTCTGGCATCGTCAACACAGCCTTC
ACTGTCGTGTCGCTATTTGTGGTGGAACGAGCCGGCCGGCGGACCCTGCACCTCATAGGC
CTGGCCGGCATGGCAGGCTGTGCAGTGCTCATGACCATCGCGCTGGCGCTGCTGGAGCGG
CTGCCCTGGATGTCCTACCTGAGCATTGTGGCCATCTTTGGCTTTGTGGCCTTTTTTGAA
GTGGGCCCAGGCCCCATCCCATGGTTCATCGTGGCTGAACTCTTCAGCCAGGGCCCTCGC
CCTGCTGCCATTGCCGTCGCTGGCTTCTCCAACTGGACTTCGAATTTCATTGTGGGCATG
TGCTTCCAGTATGTGGAGCAACTGTGCGGACCCTACGTCTTCATCATCTTCACCGTGCTC
CTGGTTCTGTTCTTCATCTTCACCTACTTCAAAGTTCCCGAGACAAAAGGCCGGACCTTC
GATGAGATTGCTTCTGGCTTCCGGCAGGGAGGAGCAAGTCAAAGTGACAAGACACCTGAG
GAGCTGTTCCACCCCCTGGGAGCTGACTCCCAAGTGTGA
Enzyme 16 GenBank Gene ID M60448 Link Image
Enzyme 16 GeneCard ID SLC2A1 Link Image
Enzyme 16 GenAtlas ID Not Available
Enzyme 16 HGNC ID Not Available
Enzyme 16 Chromosome Location Chromosome:1
Enzyme 16 Locus 1p35-p31.3
Enzyme 16 SNPs SNPJam Report Link Image
Enzyme 16 General References Not Available
Enzyme 16 Metabolite References Not Available
Enzyme 17 [top]
Enzyme 17 ID 2036
Enzyme 17 Name Solute carrier family 2, facilitated glucose transporter member 8
Enzyme 17 Synonyms
  1. Glucose transporter type 8
  2. GLUT-8
  3. Glucose transporter type X1
Enzyme 17 Gene Name SLC2A8
Enzyme 17 Protein Sequence >Solute carrier family 2, facilitated glucose transporter member 8
MTPEDQEETQPLLRPPGGSAPRGRRVFLAAFAAALGPLSFGFALGYSSPAIPSLRRAAPP
APHLDEDAASWFGAIVTLGAAAGGVLGGWLLDRAGRKLSLVLCALPFVAGFAVITAAQNL
WMLLGGRLLTGLACGIASLVAPVYISEIAYPEVRGLLGSCVQLMVVTGILLAYLAGWVLE
WRWLAVLGCVPPSFMLLLMCFMPETPRFLLSQHKHQEAMAAMQFLWGYAQGWEEPPLGAQ
HQDFHVAQLRRPGVYKPFIIGISLMAFQQLSGVNAVMFYAETIFEEAKFKDSSLASVVVG
VIQVLFTATAALIMDRAGRRLLLTLSGVVMVFSTSAFGTYFKLTEGGPSNSSHVDLPALV
SMEAADTNVGLAWLAVGSMCLFIAGFAVGWGPIPWLLMSEIFPLHVKGVATGVCVLTNWF
MAFLVTKEFSSLMEVLRPYGAFWLASAFCIFGVLFTLACVPETKGKTLEQITAHFEGR
Enzyme 17 Number of Residues 478
Enzyme 17 Molecular Weight 51416.1
Enzyme 17 Theoretical pI 6.92
Enzyme 17 GO Classification
Function
Process
Component
Enzyme 17 General Function Carbohydrate transport and metabolism
Enzyme 17 Specific Function Insulin-regulated facilitative glucose transporter. Binds cytochalasin B in a glucose-inhibitable manner. Seems to be a dual-specific sugar transporter as it is inhibitable by fructose
Enzyme 17 Pathways Not Available
Enzyme 17 Reactions Not Available
Enzyme 17 Pfam Domain Function
Enzyme 17 Signals
  • None
Enzyme 17 Transmembrane Regions
  • 26-46 71-91 98-118 128-148 159-179 183-203 258-278 294-314 321-341 369-389 406-426 440-460
Enzyme 17 Essentiality Not Available
Enzyme 17 GenBank ID Protein 37784546 Link Image
Enzyme 17 UniProtKB/Swiss-Prot ID P58354 Link Image
Enzyme 17 UniProtKB/Swiss-Prot Entry Name GTR8_BOVIN Link Image
Enzyme 17 PDB ID Not Available
Enzyme 17 Cellular Location Not Available
Enzyme 17 Gene Sequence >1437 bp
ATGACGCCTGAGGACCAAGAGGAGACCCAGCCGCTCCTACGGCCGCCCGGCGGCAGCGCT
CCCCGCGGCCGCCGCGTCTTCCTCGCTGCCTTCGCCGCTGCCCTGGGACCGCTCAGCTTC
GGCTTCGCCCTCGGCTACAGCTCCCCGGCCATCCCGAGCCTGAGGCGCGCCGCGCCCCCG
GCCCCGCACCTCGACGAAGACGCAGCCTCCTGGTTCGGGGCCATCGTGACCCTGGGCGCC
GCGGCCGGGGGCGTGCTGGGCGGCTGGCTCCTGGACCGCGCGGGGCGCAAGCTGAGCCTA
GTCCTCTGCGCCTTGCCCTTCGTGGCCGGCTTCGCCGTCATCACCGCGGCTCAGAACCTG
TGGATGCTGCTCGGAGGCCGCCTGCTCACCGGCCTGGCCTGCGGCATTGCCTCGCTCGTG
GCCCCGGTCTATATCTCTGAAATTGCCTACCCTGAGGTGCGAGGGCTGCTCGGCTCCTGT
GTGCAGCTGATGGTAGTCACAGGCATCCTCCTAGCCTACCTGGCAGGCTGGGTGCTCGAG
TGGCGCTGGCTGGCCGTGCTGGGCTGTGTGCCCCCCTCCTTCATGCTGCTGCTCATGTGT
TTCATGCCTGAGACCCCTCGCTTCCTGCTGTCTCAGCACAAGCACCAGGAGGCCATGGCC
GCCATGCAGTTCCTGTGGGGCTATGCCCAGGGTTGGGAGGAGCCTCCCCTTGGGGCTCAG
CACCAGGACTTCCACGTGGCCCAGCTGCGGCGTCCTGGTGTCTACAAGCCCTTCATCATC
GGCATCTCCCTGATGGCCTTCCAGCAGCTGTCAGGCGTCAATGCCGTCATGTTCTACGCG
GAGACCATCTTTGAGGAGGCTAAGTTCAAGGACAGCAGCCTGGCCTCAGTCGTCGTGGGC
GTCATCCAGGTGCTGTTCACTGCCACGGCGGCCCTGATCATGGACAGAGCTGGGCGAAGG
CTGCTCTTGACCTTGTCAGGTGTGGTCATGGTGTTCAGCACCAGCGCCTTTGGTACCTAC
TTCAAGCTGACCGAGGGCGGCCCCAGCAACTCCTCCCACGTGGACCTCCCGGCGCTCGTC
TCCATGGAGGCCGCCGATACCAACGTGGGGCTGGCCTGGCTGGCGGTGGGCAGCATGTGC
CTCTTCATCGCCGGCTTCGCTGTGGGCTGGGGGCCCATCCCGTGGCTCCTCATGTCTGAG
ATCTTCCCTCTGCATGTCAAGGGCGTGGCCACCGGCGTCTGCGTCCTCACCAACTGGTTC
ATGGCCTTTCTGGTGACCAAAGAGTTCAGCAGTCTCATGGAGGTGCTCAGGCCCTACGGT
GCCTTCTGGCTGGCCTCTGCCTTCTGCATCTTCGGTGTCCTTTTCACTCTGGCCTGTGTC
CCTGAGACCAAAGGGAAGACTTTGGAGCAAATCACAGCCCATTTTGAGGGGCGATGA
Enzyme 17 GenBank Gene ID AY208940 Link Image
Enzyme 17 GeneCard ID SLC2A8 Link Image
Enzyme 17 GenAtlas ID Not Available
Enzyme 17 HGNC ID Not Available
Enzyme 17 Chromosome Location Chromosome:9
Enzyme 17 Locus 9q33.3
Enzyme 17 SNPs SNPJam Report Link Image
Enzyme 17 General References
  1. [PubMed Link Image]
Enzyme 17 Metabolite References Not Available
Enzyme 18 [top]
Enzyme 18 ID 2044
Enzyme 18 Name P2Y purinoceptor 14
Enzyme 18 Synonyms
  1. P2Y14
  2. UDP-glucose receptor
Enzyme 18 Gene Name P2RY14
Enzyme 18 Protein Sequence >P2Y purinoceptor 14
MNATSVPPAEGSCPSNALITKQIIPMLYFVVFVAGILLNGMSGWVFFYVPSSKSFIVYLK
NIVIADFLMSLTFPFKILGDLGLGLWQVKVFVCRVSAVLFYINMYVSIVFFGLIGFDRYY
KIVKPLLTSFIQSISYSKLLSVLVWSLTLLIALPNMILTNRNVTEATRVKCMDLKSDLGL
KWHKASSYIFVGIFWIVFLSLIIFYTAITKKIFKSHFKSRKNSVSVKKKSSRNIFSIMFV
FFICFVPYHIARIPYTQSQTEAHYSCQSKQILFYVKEFSLLLSAANVCLDPIIYFFLCQP
FREVLCKKLHIQLKTQHDSETSKIKRENIIQESTDTL
Enzyme 18 Number of Residues 337
Enzyme 18 Molecular Weight 38696.8
Enzyme 18 Theoretical pI 10.05
Enzyme 18 GO Classification
Function
Process
Component
Enzyme 18 General Function Involved in purinergic nucleotide receptor activity, G-
Enzyme 18 Specific Function Receptor for UDP-glucose and other UDP-sugar coupled to G-proteins. Not activated by ATP, ADP, UTP or ATP
Enzyme 18 Pathways Not Available
Enzyme 18 Reactions Not Available
Enzyme 18 Pfam Domain Function
Enzyme 18 Signals
  • None
Enzyme 18 Transmembrane Regions
  • 29-49 55-75 96-116 139-159 188-208 234-254 278-298
Enzyme 18 Essentiality Not Available
Enzyme 18 GenBank ID Protein 152941166 Link Image
Enzyme 18 UniProtKB/Swiss-Prot ID Q3SX17 Link Image
Enzyme 18 UniProtKB/Swiss-Prot Entry Name P2Y14_BOVIN Link Image
Enzyme 18 PDB ID Not Available
Enzyme 18 Cellular Location Not Available
Enzyme 18 Gene Sequence >1014 bp
ATGAATGCCACCAGCGTCCCACCTGCGGAGGGGTCCTGCCCCTCCAACGCCCTCATCACC
AAGCAGATCATCCCCATGCTGTACTTCGTGGTCTTTGTGGCCGGCATCCTGCTCAATGGC
ATGTCAGGGTGGGTGTTCTTCTACGTGCCCAGCTCCAAGAGTTTCATCGTCTATCTCAAG
AATATTGTCATTGCCGACTTCCTGATGAGCCTGACTTTTCCTTTCAAGATCCTGGGGGAC
TTGGGCCTGGGCCTCTGGCAGGTCAAAGTCTTTGTGTGCAGGGTCTCGGCCGTGCTCTTC
TACATCAACATGTACGTCAGCATCGTGTTCTTCGGGCTCATTGGCTTTGACAGATATTAC
AAAATCGTGAAGCCTCTCTTGACTTCTTTCATCCAGTCCATAAGCTACAGCAAACTCCTG
TCGGTGCTGGTGTGGAGCCTCACACTGCTCATCGCCCTTCCCAACATGATCCTGACCAAT
CGGAATGTCACAGAGGCCACACGCGTGAAATGTATGGACCTGAAGAGTGACCTGGGCCTC
AAGTGGCACAAAGCCTCCAGCTACATCTTTGTGGGCATCTTCTGGATTGTGTTTCTTTCC
TTAATCATCTTCTACACTGCTATCACAAAGAAGATCTTTAAGTCCCACTTCAAGTCCAGA
AAGAATTCTGTATCAGTCAAGAAGAAATCTAGCCGTAATATATTCAGCATTATGTTCGTG
TTTTTTATCTGCTTTGTACCTTACCACATTGCCAGAATCCCCTACACACAGAGCCAAACA
GAAGCTCATTACAGCTGCCAGTCAAAACAAATCCTGTTCTATGTGAAAGAATTCTCTCTG
CTACTGTCAGCTGCAAACGTATGCCTGGACCCCATTATTTATTTCTTTCTATGCCAGCCA
TTTAGAGAGGTCTTGTGTAAGAAATTGCATATCCAATTAAAAACTCAGCATGACTCAGAA
ACTTCCAAAATCAAAAGGGAAAATATAATACAAGAAAGCACAGATACTCTGTGA
Enzyme 18 GenBank Gene ID BT030704 Link Image
Enzyme 18 GeneCard ID P2RY14 Link Image
Enzyme 18 GenAtlas ID Not Available
Enzyme 18 HGNC ID Not Available
Enzyme 18 Chromosome Location Chromosome:3
Enzyme 18 Locus 3q24-q25.1
Enzyme 18 SNPs SNPJam Report Link Image
Enzyme 18 General References
  1. [PubMed Link Image]
Enzyme 18 Metabolite References Not Available
Enzyme 19 [top]
Enzyme 19 ID 2051
Enzyme 19 Name Solute carrier family 2, facilitated glucose transporter member 12
Enzyme 19 Synonyms
  1. Glucose transporter type 12
  2. GLUT-12
Enzyme 19 Gene Name SLC2A12
Enzyme 19 Protein Sequence >Solute carrier family 2, facilitated glucose transporter member 12
MVPVENAEGPSLLKPKGRAAETDGSDRASGGPHPPWARGCGMYTLLSSVTAAVSGFLVGY
ELGIISGALLQIRTLLVLTCHEQEMVVSSLLIGALLASLIGGVLIDRYGRRAAIILSSCL
LGLGSLVLIISLSYTTLIGGRIAIGVFISLSSTATCVYIAEIAPQHRRGLLVSLNELMIV
IGILFAYISNYAFANISHGWKYMFGLVIPLGVLQAIAMYFLPPSPRFLVMKGHEEAASKV
LGKLRAVLDTTEELTVIKSSLKDEYQYSFWDLFRSKDNMRTRIMIGLTLVFFVQITGQPN
ILFYASTVLKSVGFQSNEAASLASTGVGVVKVISTIPATLLVDQVGSKTFLCIGSSVMAA
SLVTMGIVNLNIHMNFTSICRNHSPINQSLDESVFYGPGNLSASNDTLRESFKGMTFHSR
SSLRPTRNDINGRGETTLASLPNAGLSQTEYQIVTDSADVPTFLKWLSLASLLVYVAAFS
IGLGPMPWLVLSEIFPGGIRGRAMALTSSMNWGINLLISLTFLTVTDLIGLPWVCFIYTV
MSLASLVFVIVFIPETKGCSLEQISVELAKENYVKNNICFMSHHREELVPKQLQKRKPQE
QFLESKKLRGKGQPRQLSSEV
Enzyme 19 Number of Residues 621
Enzyme 19 Molecular Weight 67467.2
Enzyme 19 Theoretical pI 8.85
Enzyme 19 GO Classification
Function
Process
Component
Enzyme 19 General Function Carbohydrate transport and metabolism
Enzyme 19 Specific Function Facilitative glucose transporter
Enzyme 19 Pathways Not Available
Enzyme 19 Reactions Not Available
Enzyme 19 Pfam Domain Function
Enzyme 19 Signals
  • None
Enzyme 19 Transmembrane Regions
  • 49-69 85-105 112-132 142-162 169-189 202-222 283-303 322-342 350-370 471-491 503-523 533-553
Enzyme 19 Essentiality Not Available
Enzyme 19 GenBank ID Protein 41400463 Link Image
Enzyme 19 UniProtKB/Swiss-Prot ID Q5J316 Link Image
Enzyme 19 UniProtKB/Swiss-Prot Entry Name GTR12_BOVIN Link Image
Enzyme 19 PDB ID Not Available
Enzyme 19 Cellular Location Not Available
Enzyme 19 Gene Sequence >1866 bp
ATGGTACCTGTTGAAAACGCAGAGGGCCCCAGTCTGCTGAAACCGAAGGGGCGAGCGGCG
GAGACTGATGGCAGCGACAGAGCCAGCGGCGGCCCGCATCCTCCCTGGGCGCGAGGTTGT
GGCATGTATACTCTCCTGTCGTCTGTCACAGCTGCTGTCAGTGGCTTCCTGGTGGGGTAT
GAACTTGGAATCATCTCTGGGGCTCTTCTGCAAATAAGAACCTTGTTAGTCCTGACCTGC
CATGAGCAGGAAATGGTGGTGAGCTCCCTGCTTATCGGGGCCCTCCTGGCCTCTCTAATC
GGAGGAGTCCTGATTGACAGGTACGGGAGAAGGGCCGCCATCATTTTGTCCTCCTGCCTC
CTCGGACTTGGAAGCCTGGTCTTGATTATCAGTTTATCTTACACCACTCTTATAGGGGGG
CGCATCGCTATTGGAGTTTTCATTTCACTCTCCTCCACCGCCACTTGTGTCTACATCGCA
GAAATTGCTCCCCAACACAGAAGAGGCCTTCTCGTGTCACTGAATGAACTGATGATTGTC
ATCGGCATTCTTTTTGCCTACATTTCAAATTATGCATTTGCCAACATTTCCCATGGCTGG
AAATACATGTTTGGCCTTGTTATTCCCTTGGGAGTTTTGCAAGCCATTGCAATGTACTTT
CTTCCTCCAAGTCCTCGATTTCTGGTGATGAAGGGACATGAGGAAGCTGCTAGTAAGGTT
CTTGGAAAGCTGAGAGCTGTCTTGGATACAACAGAGGAACTCACGGTGATAAAGTCTTCC
CTGAAAGATGAATATCAGTACAGTTTTTGGGATCTGTTTCGTTCAAAAGACAACATGAGG
ACCCGAATCATGATAGGCTTAACGCTGGTATTTTTTGTACAGATCACTGGCCAGCCAAAC
ATATTATTCTATGCATCTACTGTTTTGAAGTCTGTTGGCTTCCAAAGCAATGAGGCAGCT
AGCCTCGCCTCCACCGGGGTTGGGGTCGTCAAGGTCATCAGCACCATCCCAGCCACCCTT
CTCGTAGACCAGGTTGGGAGCAAAACCTTCCTGTGTATCGGTTCCTCTGTGATGGCAGCT
TCGTTGGTGACCATGGGCATCGTGAATCTCAACATCCACATGAACTTCACCAGTATCTGC
AGAAACCATAGTCCTATCAACCAGTCCTTGGATGAGTCTGTGTTTTATGGACCAGGTAAC
TTGTCAGCCAGCAATGACACTCTTAGAGAATCCTTTAAAGGGATGACTTTCCACAGCAGA
AGCTCACTGAGGCCCACGAGAAATGACATAAATGGGAGAGGAGAAACGACCCTGGCATCC
TTACCAAATGCTGGACTAAGCCAAACTGAATACCAGATCGTCACAGACTCTGCAGATGTC
CCCACTTTTTTGAAATGGCTTTCTTTAGCCAGCTTGCTTGTTTACGTTGCTGCCTTTTCA
ATTGGTCTAGGACCAATGCCCTGGTTGGTGCTGAGCGAGATTTTTCCCGGAGGAATTCGA
GGACGTGCCATGGCTCTAACTTCCAGCATGAACTGGGGCATCAATCTCCTCATCTCTCTG
ACATTTTTGACGGTGACGGATCTCATTGGCCTGCCGTGGGTGTGCTTTATATATACAGTT
ATGAGTCTAGCATCCCTGGTTTTTGTTATTGTGTTTATACCTGAAACAAAGGGATGCTCT
TTGGAACAAATATCAGTGGAGCTGGCAAAAGAGAACTATGTGAAAAACAACATTTGTTTT
ATGAGTCATCACCGGGAGGAATTAGTGCCAAAACAGCTTCAAAAAAGAAAACCCCAAGAG
CAGTTCTTGGAGTCTAAAAAGCTAAGGGGTAAGGGACAGCCAAGGCAGCTTTCTTCAGAG
GTCTAA
Enzyme 19 GenBank Gene ID AY514443 Link Image
Enzyme 19 GeneCard ID SLC2A12 Link Image
Enzyme 19 GenAtlas ID Not Available
Enzyme 19 HGNC ID Not Available
Enzyme 19 Chromosome Location Chromosome:6
Enzyme 19 Locus 6q23.2
Enzyme 19 SNPs SNPJam Report Link Image
Enzyme 19 General References
  1. [PubMed Link Image]
Enzyme 19 Metabolite References Not Available
Enzyme 20 [top]
Enzyme 20 ID 2056
Enzyme 20 Name Solute carrier family 2, facilitated glucose transporter member 3
Enzyme 20 Synonyms
  1. Glucose transporter type 3, brain
  2. GLUT-3
Enzyme 20 Gene Name SLC2A3
Enzyme 20 Protein Sequence >Solute carrier family 2, facilitated glucose transporter member 3
MGTTKVTAPLIFAISVATIGSFQFGYNTGVINAPEAIIKDFLNYTLEERSEPPPSSVLLT
SLWSLSVAIFSVGGMIGSFSVGLFVNRFGRGNSMLIVNLLAIAGGCLMGFCKIAESVEML
ILGRLIIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLKVILGT
EDLWPLLLGFTILPAIIQCAALPFCPESPRFLLINRKEEEKAKEILQRLWGTEDVAQDIQ
EMKDESMRMSQEKQVTVLELFRAPNYRQPIIISIMLQLSQQLSGINAVFYYSTGIFKDAG
VQEPVYATIGAGVVNTIFTVVSVFLVERAGRRTLHLIGLGGMAFCSILMTISLLLKDNYS
WMSFICIGAILVFVAFFEIGPGPIPWFIVAELFGQGPRPAAMAVAGCSNWTSNFLVGLLF
PSAAFYLGAYVFIVFTVFLVIFWVFTFFKVPETRGRTFEEITRAFEGQTQTGTRGEKGPI
MEMNSIQPTKDTNA
Enzyme 20 Number of Residues 494
Enzyme 20 Molecular Weight 54019.1
Enzyme 20 Theoretical pI 5.28
Enzyme 20 GO Classification
Function
Process
Component
Enzyme 20 General Function Carbohydrate transport and metabolism
Enzyme 20 Specific Function Facilitative glucose transporter. Probably a neuronal glucose transporter
Enzyme 20 Pathways Not Available
Enzyme 20 Reactions Not Available
Enzyme 20 Pfam Domain Function
Enzyme 20 Signals
  • None
Enzyme 20 Transmembrane Regions
  • 6-26 65-85 94-114 125-145 160-180 184-204 270-290 306-326 335-355 364-384 400-420 425-445
Enzyme 20 Essentiality Not Available
Enzyme 20 GenBank ID Protein 14626416 Link Image
Enzyme 20 UniProtKB/Swiss-Prot ID P58352 Link Image
Enzyme 20 UniProtKB/Swiss-Prot Entry Name GTR3_BOVIN Link Image
Enzyme 20 PDB ID Not Available
Enzyme 20 Cellular Location Not Available
Enzyme 20 Gene Sequence >1485 bp
ATGGGGACCACGAAGGTCACCGCACCTCTGATCTTCGCCATCTCGGTTGCTACCATAGGC
TCTTTCCAGTTTGGCTACAACACTGGAGTCATCAATGCTCCTGAGGCGATCATAAAAGAC
TTTCTCAATTACACTTTGGAAGAGCGGTCAGAACCGCCCCCGTCCAGCGTGCTCCTCACA
TCCCTGTGGTCCTTGTCTGTGGCCATCTTCTCCGTGGGTGGTATGATTGGCTCCTTCTCC
GTCGGACTCTTTGTCAACCGATTTGGCAGGGGCAATTCAATGCTTATTGTCAACCTGTTG
GCCATAGCTGGCGGCTGCCTTATGGGATTCTGCAAAATAGCAGAGTCGGTTGAAATGCTG
ATCTTGGGCCGACTGATTATCGGCCTCTTCTGCGGACTCTGCACAGGATTCGTGCCCATG
TACATTGGAGAGATCTCCCCTACTGCCCTGCGGGGCGCCTTTGGCACTCTCAACCAGCTG
GGCATCGTTATCGGAATTCTGGTGGCCCAGATCTTTGGTCTAAAAGTCATCTTGGGGACT
GAAGATCTCTGGCCTCTGCTCCTGGGCTTCACCATCTTACCAGCCATCATCCAGTGCGCT
GCCCTTCCATTTTGCCCTGAAAGTCCTAGATTCTTGCTCATTAACAGAAAGGAGGAGGAG
AAGGCAAAGGAGATCCTCCAGAGACTCTGGGGCACCGAGGACGTGGCTCAGGATATCCAG
GAGATGAAGGATGAGAGTATGCGGATGTCGCAGGAGAAGCAAGTCACAGTGCTAGAGCTC
TTCCGCGCCCCCAACTACCGGCAACCCATCATTATCTCTATCATGCTCCAGCTCTCCCAG
CAGCTCTCTGGGATCAATGCAGTGTTCTACTACTCGACAGGAATCTTCAAAGATGCGGGT
GTCCAGGAGCCGGTCTATGCCACTATCGGCGCAGGTGTGGTCAACACCATCTTCACCGTG
GTGTCTGTGTTCTTGGTGGAAAGGGCTGGGAGGAGGACTCTTCACCTGATTGGCCTTGGA
GGGATGGCTTTTTGTTCCATCCTCATGACGATTTCTTTGTTACTGAAGGATAATTATAGC
TGGATGAGCTTTATCTGTATTGGGGCCATCCTGGTCTTCGTGGCCTTCTTTGAAATTGGC
CCAGGCCCTATTCCCTGGTTTATTGTGGCTGAACTCTTTGGTCAGGGACCCCGTCCAGCT
GCCATGGCAGTGGCTGGTTGTTCCAACTGGACCTCCAACTTTTTGGTTGGACTCCTCTTC
CCCTCGGCCGCGTTCTACTTAGGCGCCTATGTTTTCATCGTCTTCACTGTCTTCCTCGTT
ATCTTCTGGGTCTTCACCTTCTTCAAAGTTCCTGAGACCCGTGGCAGGACTTTTGAGGAA
ATTACACGAGCCTTTGAAGGGCAGACGCAGACAGGAACCCGCGGTGAGAAAGGCCCCATC
ATGGAGATGAACAGCATCCAGCCCACGAAGGACACCAATGCCTAA
Enzyme 20 GenBank Gene ID AY033938 Link Image
Enzyme 20 GeneCard ID SLC2A3 Link Image
Enzyme 20 GenAtlas ID Not Available
Enzyme 20 HGNC ID Not Available
Enzyme 20 Chromosome Location Chromosome:1
Enzyme 20 Locus 12p13.3
Enzyme 20 SNPs SNPJam Report Link Image
Enzyme 20 General References Not Available
Enzyme 20 Metabolite References Not Available
Enzyme 21 [top]
Enzyme 21 ID 2075
Enzyme 21 Name Solute carrier family 2, facilitated glucose transporter member 5
Enzyme 21 Synonyms
  1. Glucose transporter type 5, small intestine
  2. GLUT-5
  3. Fructose transporter
Enzyme 21 Gene Name SLC2A5
Enzyme 21 Protein Sequence >Solute carrier family 2, facilitated glucose transporter member 5
MEPQDPVKREGRLTPVIVLATLIAAFGSSFQYGYNVAAINSPSEFMKDFYNYTYYDRVGE
YMNEFYLTLLWSVTVSMFPFGGFLGSLMVGPLVNNLGRKGTLLFNNIFSIVPALLMGFSE
LAKSFEMIIVARVLVGICAGLSSNVVPMYLGELAPKNWRGALGVVPQLFITIGILVAQIF
GLRSLLANEEGWPILLGLTGIPAVLQLLFLPFFPESPRYLLIQKKDEAAAKSALRRLRGW
HDVDAEIEEILEEDRAEKAVGFISVLKLFKMRSLRWQVISIIVLMAGQQLSGVNAIYYYA
DQIYLSAGVNEDDVQYVTAGTGAVNVLITVCAIFVVELMGRRFLLLLGFSVCFTACCVLT
GALALQDVISWMPYVSIACVISYVIGHALGPSPIPALLVTEIFLQSSRPAAYMVAGTVHW
LSNFTVGLVFPFIQVGLGAYSFVIFAVICLLTTVYIFLIIPETKSKTFIEINRIFIKMNK
VPGVHPEKEELKEFPPSTARQ
Enzyme 21 Number of Residues 501
Enzyme 21 Molecular Weight 55392.9
Enzyme 21 Theoretical pI 6.52
Enzyme 21 GO Classification
Function
Process
Component
Enzyme 21 General Function Carbohydrate transport and metabolism
Enzyme 21 Specific Function Cytochalasin B-sensitive carrier. Seems to function primarily as a fructose transporter
Enzyme 21 Pathways Not Available
Enzyme 21 Reactions Not Available
Enzyme 21 Pfam Domain Function
Enzyme 21 Signals
  • None
Enzyme 21 Transmembrane Regions
  • 13-33 69-89 99-119 121-141 162-182 193-213 278-298 319-339 343-363 369-389 413-433 440-460
Enzyme 21 Essentiality Not Available
Enzyme 21 GenBank ID Protein 154426212 Link Image
Enzyme 21 UniProtKB/Swiss-Prot ID P58353 Link Image
Enzyme 21 UniProtKB/Swiss-Prot Entry Name GTR5_BOVIN Link Image
Enzyme 21 PDB ID Not Available
Enzyme 21 Cellular Location Not Available
Enzyme 21 Gene Sequence >1506 bp
ATGGAGCCGCAGGATCCAGTCAAGAGGGAAGGGAGGCTGACACCCGTGATTGTTCTGGCG
ACACTGATAGCTGCCTTTGGGTCGTCCTTCCAGTATGGGTACAACGTGGCTGCTATTAAC
TCCCCTTCAGAGTTCATGAAAGACTTCTACAACTATACCTACTATGACAGAGTCGGTGAA
TACATGAACGAGTTCTACTTGACCTTGCTGTGGTCGGTTACCGTGTCCATGTTTCCCTTC
GGAGGCTTCCTCGGCTCTCTCATGGTTGGCCCCTTGGTAAATAACTTAGGCAGAAAAGGA
ACCTTGCTGTTCAACAACATCTTCTCCATCGTGCCTGCACTCTTAATGGGATTCAGTGAG
CTCGCCAAGTCATTTGAGATGATAATTGTGGCCAGGGTTTTGGTGGGAATATGTGCAGGT
CTGTCTTCCAATGTCGTCCCCATGTACTTAGGGGAGCTGGCCCCTAAGAACTGGAGGGGG
GCCCTGGGGGTGGTGCCCCAGCTCTTCATCACCATCGGAATCCTTGTGGCCCAGATCTTT
GGTCTTCGGAGTCTCCTGGCAAACGAAGAAGGCTGGCCCATCCTCCTCGGATTGACTGGG
ATCCCCGCTGTGCTGCAGCTCCTCTTCCTGCCCTTCTTCCCTGAGAGTCCCAGGTACCTG
CTGATTCAGAAGAAAGATGAAGCAGCTGCCAAAAGCGCTCTGAGGAGGCTGCGTGGCTGG
CATGACGTGGATGCGGAGATAGAGGAGATCCTGGAGGAGGACAGGGCTGAGAAGGCTGTG
GGCTTCATCTCCGTGCTGAAGCTGTTCAAGATGAGGTCCCTGCGGTGGCAGGTCATCTCC
ATCATCGTCCTCATGGCGGGCCAGCAGCTCTCCGGAGTGAATGCGATCTACTACTACGCA
GACCAGATTTACCTGAGTGCTGGAGTGAATGAGGACGATGTCCAATATGTGACGGCGGGC
ACAGGTGCTGTCAATGTGCTGATAACTGTCTGCGCTATTTTCGTGGTGGAACTAATGGGG
AGGAGATTCCTGCTCCTCCTGGGCTTCTCTGTCTGTTTCACCGCTTGCTGCGTGCTGACG
GGTGCCTTGGCTCTGCAGGACGTGATATCCTGGATGCCCTACGTCAGCATCGCCTGTGTC
ATCTCCTACGTCATAGGGCATGCCCTTGGGCCCAGTCCCATCCCCGCACTGCTGGTCACC
GAGATCTTCCTGCAGTCCTCCCGGCCAGCTGCCTACATGGTGGCGGGTACTGTTCACTGG
CTCTCCAACTTCACTGTGGGCTTGGTCTTCCCATTCATCCAAGTGGGCCTCGGAGCTTAC
AGCTTCGTCATTTTTGCGGTGATATGTCTTCTCACCACCGTCTACATCTTCCTGATCATC
CCTGAAACCAAGTCCAAGACCTTCATAGAAATCAATCGGATCTTCATCAAGATGAACAAA
GTGCCAGGGGTGCACCCAGAAAAGGAGGAGCTAAAGGAGTTTCCACCGTCGACTGCAAGG
CAGTAA
Enzyme 21 GenBank Gene ID BC151530 Link Image
Enzyme 21 GeneCard ID SLC2A5 Link Image
Enzyme 21 GenAtlas ID Not Available
Enzyme 21 HGNC ID Not Available
Enzyme 21 Chromosome Location Chromosome:1
Enzyme 21 Locus 1p36.2
Enzyme 21 SNPs SNPJam Report Link Image
Enzyme 21 General References
  1. [PubMed Link Image]
Enzyme 21 Metabolite References Not Available
Enzyme 22 [top]
Enzyme 22 ID 2145
Enzyme 22 Name Angiopoietin-related protein 4
Enzyme 22 Synonyms
  1. Angiopoietin-like 4
Enzyme 22 Gene Name ANGPTL4
Enzyme 22 Protein Sequence >Angiopoietin-related protein 4
MRCAPTAGAALMLCAATAGLLSAQGRPEPPETPRFASWDEVNVLAHGLLQLGHGLREHVE
RTRGQLGELERRLGACGAACKDPEGSAAPPRAQANLVNPGGGDASPETLRSLKTQLEAQN
SRIQQLFQKVAQQQRHLEKQQLRIQNLQSQMDHLAPRHLGHEMAKPARRKRLPKMAQLAG
PAHNISRLHRLPRDCQELFEEGERESGLFQIQPQGSPPFLVNCKMTSDGGWTVIQRRQDG
SVDFNQPWEAYKDGFGDPQGEFWLGLEKVHHILGDRGSRLAVQLQDWEGNAESLQFPIHL
GGEDTAYSLQLTPPVASKLGATTFSPSGLSLPFSTWDQDHDLRGDKNCARSLSGGWWFGT
CSHSNLNGQYFHSIPRQRQQRKKGIFWKTWRGRYYPLQATTILVQPTAAS
Enzyme 22 Number of Residues 410
Enzyme 22 Molecular Weight 45553.1
Enzyme 22 Theoretical pI 8.93
Enzyme 22 GO Classification
Function
Process
Component
Enzyme 22 General Function Involved in receptor binding
Enzyme 22 Specific Function Protein with hypoxia-induced expression in endothelial cells. May act as a regulator of angiogenesis and modulate tumorgenesis. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. May exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM). The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. It also decreases motility of endothelial cells and inhibits the sprouting and tube formation
Enzyme 22 Pathways Not Available
Enzyme 22 Reactions Not Available
Enzyme 22 Pfam Domain Function
Enzyme 22 Signals
  • 1-23
Enzyme 22 Transmembrane Regions
  • None
Enzyme 22 Essentiality Not Available
Enzyme 22 GenBank ID Protein 85816362 Link Image
Enzyme 22 UniProtKB/Swiss-Prot ID Q2KJ51 Link Image
Enzyme 22 UniProtKB/Swiss-Prot Entry Name ANGL4_BOVIN Link Image
Enzyme 22 PDB ID Not Available
Enzyme 22 Cellular Location Not Available
Enzyme 22 Gene Sequence >1233 bp
ATGCGCTGTGCGCCGACAGCCGGAGCAGCCCTGATGCTGTGCGCCGCCACCGCCGGGCTG
CTGAGCGCTCAGGGCCGCCCGGAGCCTCCCGAGACGCCGCGCTTTGCTTCCTGGGACGAG
GTGAACGTGCTGGCACACGGCCTCTTGCAGCTCGGCCACGGGCTGCGCGAACACGTGGAG
CGCACCCGTGGGCAGCTGGGCGAGCTGGAACGGCGTCTGGGCGCGTGTGGGGCCGCCTGC
AAGGATCCTGAGGGGTCCGCCGCGCCTCCGCGTGCCCAGGCCAATTTGGTCAATCCCGGC
GGCGGCGACGCCTCCCCAGAAACCCTCCGCAGCTTGAAGACTCAGCTGGAGGCTCAGAAC
AGCAGGATCCAGCAACTCTTCCAGAAGGTGGCCCAGCAGCAGCGGCACTTGGAGAAGCAG
CAGCTGCGAATCCAGAATCTACAGAGCCAGATGGATCACCTGGCCCCCAGGCACCTGGGC
CACGAGATGGCCAAGCCCGCCAGGAGGAAGAGGCTGCCCAAGATGGCCCAGCTTGCTGGC
CCAGCTCACAATATCAGCCGCCTGCACAGACTGCCCAGGGACTGCCAGGAGCTGTTTGAA
GAGGGAGAGAGGGAAAGTGGATTGTTCCAGATCCAGCCCCAGGGATCCCCGCCTTTCCTG
GTTAACTGCAAAATGACCTCAGATGGAGGCTGGACCGTAATTCAGAGGCGTCAGGATGGC
TCCGTGGACTTTAACCAGCCCTGGGAAGCCTACAAAGATGGCTTCGGAGACCCCCAAGGC
GAGTTCTGGCTGGGCCTGGAGAAGGTGCATCACATCCTTGGGGACCGTGGCAGCCGCCTG
GCTGTGCAGCTGCAGGACTGGGAGGGCAATGCCGAGTCCTTGCAGTTCCCCATCCACCTG
GGGGGTGAAGACACCGCCTACAGCCTGCAGCTCACGCCACCGGTGGCCAGCAAACTGGGC
GCCACCACCTTCTCGCCCAGTGGCCTCTCCCTGCCCTTCTCCACTTGGGACCAGGACCAC
GACCTCCGCGGAGACAAGAACTGCGCCAGGAGCCTCTCTGGTGGCTGGTGGTTTGGCACC
TGCAGTCACTCCAACCTGAACGGCCAGTATTTCCACTCCATTCCAAGGCAGCGGCAGCAG
CGTAAGAAGGGCATCTTCTGGAAGACCTGGCGGGGCCGCTACTACCCACTGCAGGCCACC
ACCATCCTGGTACAGCCCACAGCGGCCTCCTAG
Enzyme 22 GenBank Gene ID DQ355521 Link Image
Enzyme 22 GeneCard ID ANGPTL4 Link Image
Enzyme 22 GenAtlas ID Not Available
Enzyme 22 HGNC ID Not Available
Enzyme 22 Chromosome Location Chromosome:1
Enzyme 22 Locus 19p13.3
Enzyme 22 SNPs SNPJam Report Link Image
Enzyme 22 General References Not Available
Enzyme 22 Metabolite References Not Available
Enzyme 23 [top]
Enzyme 23 ID 2146
Enzyme 23 Name Sorbin and SH3 domain containing 1
Enzyme 23 Synonyms Not Available
Enzyme 23 Gene Name SORBS1
Enzyme 23 Protein Sequence >Sorbin and SH3 domain containing 1
MSSECDAGASKAVVNGLAPGSNGQDKDMDPTRICTGKGAVTLRASSSYREIPSSSPVSPQ
ETPKQERKTVLESENSSADEWRLSSNADANGNAQPSSLAAKGYRSVHPSLPSSKPQDSSP
LLNEVSSSHAGTDSQTFASVSKPSSAYPSTTIVNPTIVLLQHNREQQKRLSSLSDPVSER
RAGEQDSAPAQEKPTSPGRAAERKAKDDSRRVAKSAQDLSDVCMDEVGIPLRNTERSKDW
YKTMFKQIHKLNRDDDSDLYSPRYSFSEDTKSPLSVPRSKSEMSCIDGEKVVKRSATLPL
PTRSSSLKSSPERTDWEPPDKKVDTRKYRAEPRSIYEYQPGKSSVLTNEKMSSAVSPTPD
ISSEPPGYVYSSNFHAVKRESDGAPGDLTSLENERQIYKSVLEGGDIPLQGLSGLKRPSS
SASTKGNGV
Enzyme 23 Number of Residues 429
Enzyme 23 Molecular Weight 46460.6
Enzyme 23 Theoretical pI 8.28
Enzyme 23 GO Classification
Function
Process
Component
Enzyme 23 General Function Involved in insulin receptor binding
Enzyme 23 Specific Function Not Available
Enzyme 23 Pathways Not Available
Enzyme 23 Reactions Not Available
Enzyme 23 Pfam Domain Function
Enzyme 23 Signals
  • None
Enzyme 23 Transmembrane Regions
  • None
Enzyme 23 Essentiality Not Available
Enzyme 23 GenBank ID Protein 111305110 Link Image
Enzyme 23 UniProtKB/Swiss-Prot ID Q0VCF1 Link Image
Enzyme 23 UniProtKB/Swiss-Prot Entry Name Q0VCF1_BOVIN Link Image
Enzyme 23 PDB ID Not Available
Enzyme 23 Cellular Location Not Available
Enzyme 23 Gene Sequence >1290 bp
ATGAGCTCTGAATGTGATGCGGGTGCTTCCAAAGCTGTGGTGAACGGGTTGGCACCGGGC
AGCAATGGGCAAGACAAAGATATGGATCCTACAAGAATCTGCACTGGGAAGGGAGCGGTG
ACTCTCCGGGCCTCGTCCTCCTACAGGGAGATCCCAAGCAGTAGCCCTGTGAGCCCCCAG
GAGACCCCGAAGCAGGAGAGGAAAACAGTTCTGGAGTCAGAGAATTCCTCAGCAGATGAG
TGGAGGCTTTCTTCCAATGCCGATGCCAATGGAAATGCCCAGCCCTCTTCACTCGCTGCC
AAGGGCTACCGAAGTGTGCATCCCAGCCTTCCCTCCAGCAAGCCCCAGGACTCGAGTCCT
CTATTAAATGAAGTTTCTTCATCCCACGCTGGAACTGATTCCCAGACCTTTGCATCAGTT
AGCAAGCCATCATCTGCCTACCCGTCCACAACGATCGTCAATCCCACTATTGTGCTCTTG
CAACACAACCGAGAACAGCAGAAACGACTCAGTAGCCTTTCAGATCCTGTCTCGGAAAGA
AGAGCGGGAGAGCAGGACTCGGCACCAGCTCAGGAAAAACCCACCTCCCCTGGCAGGGCT
GCTGAGAGGAAGGCGAAGGATGATAGCCGGCGGGTGGCCAAGAGCGCTCAGGACCTAAGC
GATGTTTGCATGGATGAAGTGGGCATCCCACTCCGGAACACCGAGCGATCAAAAGACTGG
TACAAGACCATGTTTAAACAGATCCACAAACTAAACAGAGATGATGACTCAGATCTGTAC
TCTCCTCGATATTCCTTTTCTGAAGACACAAAATCTCCCCTTTCTGTGCCTCGCTCAAAA
AGTGAGATGAGCTGCATTGATGGTGAGAAGGTAGTTAAGAGGTCAGCCACACTTCCCCTC
CCGACCCGCTCTTCCTCGCTAAAATCAAGCCCAGAGAGGACTGACTGGGAGCCCCCAGAT
AAGAAAGTGGATACAAGAAAATACCGCGCAGAGCCCAGAAGCATTTACGAGTATCAGCCG
GGCAAGTCCTCTGTTCTGACCAACGAAAAGATGAGCTCAGCAGTCAGCCCGACTCCAGAC
ATTTCTTCAGAGCCTCCTGGATATGTATATTCTTCCAACTTCCATGCGGTGAAGAGGGAA
TCCGATGGGGCTCCGGGGGATCTCACCAGCTTGGAGAATGAGAGGCAGATTTATAAAAGT
GTCCTGGAAGGAGGAGACATCCCCCTCCAGGGCCTGAGTGGGCTCAAGCGGCCATCCAGC
TCGGCCTCCACTAAAGGTAATGGGGTGTAG
Enzyme 23 GenBank Gene ID BC120200 Link Image
Enzyme 23 GeneCard ID SORBS1 Link Image
Enzyme 23 GenAtlas ID Not Available
Enzyme 23 HGNC ID Not Available
Enzyme 23 Chromosome Location Chromosome:1
Enzyme 23 Locus 10q23.3-q24.1
Enzyme 23 SNPs SNPJam Report Link Image
Enzyme 23 General References Not Available
Enzyme 23 Metabolite References Not Available
Enzyme 24 [top]
Enzyme 24 ID 2147
Enzyme 24 Name Islet amyloid polypeptide
Enzyme 24 Synonyms
  1. Amylin
Enzyme 24 Gene Name IAPP
Enzyme 24 Protein Sequence >Islet amyloid polypeptide
MGILKLPVVLIVLCVALNHLEGGGKPTESHQMEKRKCGTATCETQRLANFLAPSSNKLGA
IFSPTKMGSNTYGKRKKVEILKREPLSYLPI
Enzyme 24 Number of Residues 91
Enzyme 24 Molecular Weight 9952.8
Enzyme 24 Theoretical pI 10.37
Enzyme 24 GO Classification
Function
Process
Component
Enzyme 24 General Function Involved in hormone activity
Enzyme 24 Specific Function Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle, while not affecting adipocyte glucose metabolism
Enzyme 24 Pathways Not Available
Enzyme 24 Reactions Not Available
Enzyme 24 Pfam Domain Function
Enzyme 24 Signals
  • 1-22
Enzyme 24 Transmembrane Regions
  • None
Enzyme 24 Essentiality Not Available
Enzyme 24 GenBank ID Protein 1488283 Link Image
Enzyme 24 UniProtKB/Swiss-Prot ID Q28207 Link Image
Enzyme 24 UniProtKB/Swiss-Prot Entry Name IAPP_BOVIN Link Image
Enzyme 24 PDB ID Not Available
Enzyme 24 Cellular Location Not Available
Enzyme 24 Gene Sequence Not Available
Enzyme 24 GenBank Gene ID U62626 Link Image
Enzyme 24 GeneCard ID IAPP Link Image
Enzyme 24 GenAtlas ID Not Available
Enzyme 24 HGNC ID Not Available
Enzyme 24 Chromosome Location Chromosome:1
Enzyme 24 Locus 12p12.3-p12.1
Enzyme 24 SNPs SNPJam Report Link Image
Enzyme 24 General References
  1. [PubMed Link Image]
Enzyme 24 Metabolite References Not Available
Enzyme 25 [top]
Enzyme 25 ID 2148
Enzyme 25 Name Solute carrier family 2 (Facilitated glucose transporter), member 1
Enzyme 25 Synonyms Not Available
Enzyme 25 Gene Name SLC2A1
Enzyme 25 Protein Sequence >Solute carrier family 2 (Facilitated glucose transporter), member 1
MEPTSKKLTGRLMLAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVQRYGEPIPPAT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMMNLLAFVSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTELRGALGTLHQLGIVVGILIAPVFGLDSIM
GNQELWPLLLSVIFIPALLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRD
LQEMKEESRQMMREKKVTILELFRSAAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLER
LPWMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
Enzyme 25 Number of Residues 492
Enzyme 25 Molecular Weight 54100.4
Enzyme 25 Theoretical pI 8.92
Enzyme 25 GO Classification
Function
Process
Component
Enzyme 25 General Function Carbohydrate transport and metabolism
Enzyme 25 Specific Function Not Available
Enzyme 25 Pathways Not Available
Enzyme 25 Reactions Not Available
Enzyme 25 Pfam Domain Function
Enzyme 25 Signals
  • None
Enzyme 25 Transmembrane Regions
  • None
Enzyme 25 Essentiality Not Available
Enzyme 25 GenBank ID Protein 119936106 Link Image
Enzyme 25 UniProtKB/Swiss-Prot ID A1L519 Link Image
Enzyme 25 UniProtKB/Swiss-Prot Entry Name A1L519_BOVIN Link Image
Enzyme 25 PDB ID Not Available
Enzyme 25 Cellular Location Not Available
Enzyme 25 Gene Sequence >1479 bp
ATGGAGCCCACCAGCAAGAAGCTGACAGGCCGCCTCATGCTGGCCGTGGGAGGGGCAGTG
CTCGGCTCCCTGCAGTTTGGCTACAACACTGGAGTCATCAACGCCCCCCAGAAGGTGATT
GAAGAGTTCTACAACCAGACGTGGGTCCAGCGCTATGGGGAGCCCATCCCGCCCGCCACG
CTGACCACGCTCTGGTCCCTGTCTGTGGCCATCTTCTCGGTGGGAGGCATGATTGGTTCC
TTCTCCGTGGGCCTTTTTGTTAACCGTTTCGGCCGGCGGAATTCAATGCTGATGATGAAC
CTGCTGGCCTTCGTGTCCGCTGTGCTCATGGGCTTCTCAAAACTGGGAAAGTCCTTTGAG
ATGCTGATCCTGGGTCGCTTCATCATCGGTGTGTACTGCGGCCTGACCACTGGTTTTGTG
CCCATGTACGTGGGGGAGGTATCCCCCACGGAGCTTCGAGGGGCCCTGGGCACCCTGCAC
CAGCTAGGCATCGTCGTCGGCATCCTCATCGCCCCGGTGTTCGGCCTGGACTCCATCATG
GGCAACCAGGAACTGTGGCCCCTGCTGCTGAGCGTCATCTTCATCCCAGCCCTGTTGCAG
TGCATCCTGCTGCCCTTCTGCCCCGAGAGCCCCCGCTTCCTGCTCATTAACCGCAACGAG
GAGAACCGGGCCAAGAGCGTGCTGAAGAAGCTGCGTGGGACCGCGGACGTGACCCGCGAC
CTGCAGGAGATGAAGGAGGAGAGCCGGCAGATGATGCGGGAGAAGAAGGTCACCATCCTG
GAGCTGTTCCGCTCAGCCGCCTACCGCCAGCCCATCCTCATTGCCGTGGTGCTGCAGCTG
TCCCAGCAGCTGTCCGGCATCAACGCTGTTTTCTATTACTCCACAAGCATCTTCGAGAAG
GCGGGGGTGCAGCAGCCCGTGTATGCCACCATCGGCTCTGGCATCGTCAACACAGCCTTC
ACTGTCGTGTCGCTATTTGTGGTGGAACGAGCCGGCCGGCGGACCCTGCACCTCATAGGC
CTGGCCGGCATGGCAGGCTGTGCAGTGCTCATGACCATCGCGCTGGCGCTGCTGGAGCGG
CTGCCCTGGATGTCCTACCTGAGCATTGTGGCCATCTTTGGCTTTGTGGCCTTTTTTGAA
GTGGGCCCAGGCCCCATCCCATGGTTCATCGTGGCTGAACTCTTCAGCCAGGGCCCTCGC
CCTGCTGCCATTGCCGTCGCTGGCTTCTCCAACTGGACTTCGAATTTCATTGTGGGCATG
TGCTTCCAGTATGTGGAGCAACTGTGCGGACCCTACGTCTTCATCATCTTCACCGTGCTC
CTGGTTCTGTTCTTCATCTTCACCTACTTCAAAGTTCCCGAGACAAAAGGCCGGACCTTC
GATGAGATTGCTTCTGGCTTCCGGCAGGGAGGAGCAAGTCAAAGTGACAAGACACCTGAG
GAGCTGTTCCACCCCCTGGGAGCTGACTCCCAAGTGTGA
Enzyme 25 GenBank Gene ID BT029806 Link Image
Enzyme 25 GeneCard ID SLC2A1 Link Image
Enzyme 25 GenAtlas ID Not Available
Enzyme 25 HGNC ID Not Available
Enzyme 25 Chromosome Location Chromosome:1
Enzyme 25 Locus 1p35-p31.3
Enzyme 25 SNPs SNPJam Report Link Image
Enzyme 25 General References
  1. [PubMed Link Image]
Enzyme 25 Metabolite References Not Available
Enzyme 26 [top]
Enzyme 26 ID 2149
Enzyme 26 Name Putative sodium-glucose cotransporter
Enzyme 26 Synonyms Not Available
Enzyme 26 Gene Name sglt1
Enzyme 26 Protein Sequence >Putative sodium-glucose cotransporter
VPSECEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFT
MDIYTKIRKKASEKELMIAGRLFMLVLIGVSIAWVPIVQSAQSGQLFDYIQSITSYLGPP
IAAVFLLAIFCKRVNEPGAFWGLIIGFLIGVSRMITEFAYGTGSCMEPSNCPTIICGVHY
LYFAIILFVITIIVILAVSLFTKPIADVHLYRLCWSLRNSKEERIDLDAEDEDVQDARED
ALEIDTEASEEKKGCFRRAYDMFCGLDQQKAPKMTKEEEAAMKLKMTDTSENRLWRMVVN
INGIILLAVAVF
Enzyme 26 Number of Residues 312
Enzyme 26 Molecular Weight 34773.5
Enzyme 26 Theoretical pI 5.04
Enzyme 26 GO Classification
Function
Process
Component
Enzyme 26 General Function Involved in glucose transmembrane transporter activity
Enzyme 26 Specific Function Not Available
Enzyme 26 Pathways Not Available
Enzyme 26 Reactions Not Available
Enzyme 26 Pfam Domain Function
Enzyme 26 Signals
  • None
Enzyme 26 Transmembrane Regions
  • None
Enzyme 26 Essentiality Not Available
Enzyme 26 GenBank ID Protein 6065760 Link Image
Enzyme 26 UniProtKB/Swiss-Prot ID Q9TTR6 Link Image
Enzyme 26 UniProtKB/Swiss-Prot Entry Name Q9TTR6_BOVIN Link Image
Enzyme 26 PDB ID Not Available
Enzyme 26 Cellular Location Not Available
Enzyme 26 Gene Sequence Not Available
Enzyme 26 GenBank Gene ID AJ250368 Link Image
Enzyme 26 GeneCard ID sglt1 Link Image
Enzyme 26 GenAtlas ID Not Available
Enzyme 26 HGNC ID Not Available
Enzyme 26 Chromosome Location Chromosome:2
Enzyme 26 Locus 22q13.1|22q12.3
Enzyme 26 SNPs SNPJam Report Link Image
Enzyme 26 General References
  1. [PubMed Link Image]
Enzyme 26 Metabolite References Not Available
Enzyme 27 [top]
Enzyme 27 ID 2150
Enzyme 27 Name Chromogranin-A
Enzyme 27 Synonyms
  1. CgA
  2. Pituitary secretory protein I
  3. SP-I
  4. Vasostatin-1
  5. Chromostatin
  6. Chromacin
  7. Pancreastatin
  8. WE-14
  9. Catestatin
Enzyme 27 Gene Name CHGA
Enzyme 27 Protein Sequence >Chromogranin-A
MRSAAVLALLLCAGQVIALPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSKECFETL
RGDERILSILRHQNLLKELQDLALQGAKERTHQQKKHSSYEDELSEVLEKPNDQAEPKEV
TEEVSSKDAAEKRDDFKEVEKSDEDSDGDRPQASPGLGPGPKVEEDNQAPGEEEEAPSNA
HPLASLPSPKYPGPQAKEDSEGPSQGPASREKGLSAEQGRQTEREEEEEKWEEAEAREKA
VPEEESPPTAAFKPPPSLGNKETQRAAPGWPEDGAGKMGAEEAKPPEGKGEWAHSRQEEE
EMARAPQVLFRGGKSGEPEQEEQLSKEWEDAKRWSKMDQLAKELTAEKRLEGEEEEEEDP
DRSMRLSFRARGYGFRGPGLQLRRGWRPNSREDSVEAGLPLQVRGYPEEKKEEEGSANRR
PEDQELESLSAIEAELEKVAHQLEELRRG
Enzyme 27 Number of Residues 449
Enzyme 27 Molecular Weight 50014.5
Enzyme 27 Theoretical pI 4.40
Enzyme 27 GO Classification
Function
Process
Component
Enzyme 27 General Function Intracellular trafficking, secretion, and vesicular transport
Enzyme 27 Specific Function Vasostatin-1 has antibacterial activity against Gram- positive bacteria M.luteus, B.megaterium. Not active against Gram- positive bacteria B.cereus, B.subtilis, S.pyogenes, M.fortuitum, S.aureus and L.monocytogenes and against Gram-negative bacteria E.coli, E.cloacae, S.typhimurium, K.pneumoniae and P.aeruginosa. Possesses antifungal activity against N.crassa, A.fumigatus, A.brassicicola, N.hematococca, F.culmorum and F.oxyporum and against the yeast S.cerevisiae and C.albicans. Inactive against T.mentagrophytes
Enzyme 27 Pathways Not Available
Enzyme 27 Reactions Not Available
Enzyme 27 Pfam Domain Function
Enzyme 27 Signals
  • 1-18
Enzyme 27 Transmembrane Regions
  • None
Enzyme 27 Essentiality Not Available
Enzyme 27 GenBank ID Protein 198 Link Image
Enzyme 27 UniProtKB/Swiss-Prot ID P05059 Link Image
Enzyme 27 UniProtKB/Swiss-Prot Entry Name CMGA_BOVIN Link Image
Enzyme 27 PDB ID Not Available
Enzyme 27 Cellular Location Not Available
Enzyme 27 Gene Sequence >1350 bp
ATGCGCTCCGCCGCGGTCCTGGCGCTTCTGCTCTGCGCGGGGCAAGTCATTGCCCTGCCT
GTGAACAGCCCCATGAATAAAGGGGACACTGAGGTGATGAAGTGTATCGTCGAGGTCATC
TCTGACACACTCTCCAAGCCCAGCCCCATGCCAGTCAGCAAGGAGTGTTTTGAGACACTC
CGAGGAGATGAACGGATCCTCTCAATCCTGCGACATCAGAATTTGCTGAAAGAGCTCCAA
GACCTCGCTCTCCAAGGAGCCAAGGAGCGGACACATCAGCAGAAGAAGCACAGCAGTTAC
GAGGATGAACTCTCAGAGGTGCTTGAGAAGCCGAACGACCAGGCCGAGCCAAAAGAGGTG
ACAGAAGAGGTGTCCTCCAAGGATGCTGCAGAAAAAAGAGACGATTCTAAAGAGGTGGAG
AAGAGTGATGAAGACTCGGACGGAGACAGGCCTCAGGCCTCCCCAGGGCTTGGGCCGGGG
CCCAAGGTTGAGGAGGACAACCAGGCCCCTGGGGAGGAGGAGGAGGCCCCCTCCAACGCC
CACCCCCTAGCCAGCCTCCCCAGCCCGAAATACCCAGGCCCACAGGCCAAGGAGGACAGC
GAGGGTCCCTCCCAGGGTCCAGCCAGCAGGGAGAAGGGCCTGAGTGCAGAGCAAGGGAGG
CAGACAGAGAGAGAAGAGGAGGAGGAGAAGTGGGAGGAGGCGGAGGCTAGAGAGAAGGCC
GTCCCGGAGGAAGAAAGCCCGCCCACCGCAGCGTTTAAACCCCCACCGAGCCTCGGCAAC
AAGGAGACGCAGAGGGCTGCTCCAGGTTGGCCCGAGGATGGAGCCGGGAAGATGGGGGCT
GAGGAGGCCAAGCCCCCCGAGGGGAAGGGGGAGTGGGCACACTCCCGGCAGGAGGAAGAG
GAGATGGCAAGGGCCCCTCAAGTCCTCTTCCATGGTGGGAAGAGCGGGGAGCCCAAGCAG
GAGGAGCAGCTCTCCAAGGAGTGGGAGGACGCCAAGCGATGGAGCAAGATGGACCAGCTG
GCCAAGGAGCTGACGGCCGAGAAGCGGCTGGAGGGGGAGGAGGAGGAAGAGGAGGACCCG
GACCGCTCCATGAGGCTCTCCTTCCGGGCCCGGGGCTACGGCTTCAGGGGTCCCGGGCTG
CAGCTGCGGCGAGGCTGGAGGCCGAACTCCCAGGAGGACAGCGTGGAGGCCGGCCTGCCC
CTCCAGGTGCGCGGCTACCCGGAAGAGAAGAAGGAGGAGGAGGGCAGCGCCAACCGCAGA
CCAGAGGACCAGGAGCTGGAGAGCTTGTCGGCCATCGAGGCAGAGCTGGAGAAGGTGGCC
CACCAGCTGGAGGAGCTGCGGCGGGGCTGA
Enzyme 27 GenBank Gene ID X04012 Link Image
Enzyme 27 GeneCard ID CHGA Link Image
Enzyme 27 GenAtlas ID Not Available
Enzyme 27 HGNC ID Not Available
Enzyme 27 Chromosome Location Chromosome:1
Enzyme 27 Locus 14q32
Enzyme 27 SNPs SNPJam Report Link Image
Enzyme 27 General References
  1. [PubMed Link Image]
Enzyme 27 Metabolite References Not Available
Enzyme 28 [top]
Enzyme 28 ID 2151
Enzyme 28 Name Solute carrier family 2 (Facilitated glucose transporter), member 3
Enzyme 28 Synonyms Not Available
Enzyme 28 Gene Name SLC2A3
Enzyme 28 Protein Sequence >Solute carrier family 2 (Facilitated glucose transporter), member 3
MGTTKVTAPLIFAISVATIGSFQFGYNTGVINAPEAIIKDFLNYTLEERSEPPPSSVLLT
SLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAIAGGCLMGFCKIAESVEML
ILGRLIIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLKVILGT
EDLWPLLLGFTILPAIIQCAALPFCPESPRFLLINRKEEEKAKEILQRLWGTEDVAQDIQ
EMKDESMRMSQEKQVTVLELFRAPNYRQPIIISIMLQLSQQLSGINAVFYYSTGIFKDAG
VQEPVYATIGAGVVNTIFTVVSVFLVERAGRRTLHLIGLGGMAFCSILMTISLLLKDNYS
WMSFICIGAILVFVAFFEIGPGPIPWFIVAELFGQGPRPAAMAVAGCSNWTSNFLVGLLF
PSAAFYLGAYVFIVFTVFLVIFWVFTFFKVPETRGRTFEEITRAFEGQTQTGTRGEKGPI
MEMNSIQPTKDTNA
Enzyme 28 Number of Residues 494
Enzyme 28 Molecular Weight 54118.3
Enzyme 28 Theoretical pI 5.56
Enzyme 28 GO Classification
Function
Process
Component
Enzyme 28 General Function Carbohydrate transport and metabolism
Enzyme 28 Specific Function Not Available
Enzyme 28 Pathways Not Available
Enzyme 28 Reactions Not Available
Enzyme 28 Pfam Domain Function
Enzyme 28 Signals
  • None
Enzyme 28 Transmembrane Regions
  • None
Enzyme 28 Essentiality Not Available
Enzyme 28 GenBank ID Protein 124829176 Link Image
Enzyme 28 UniProtKB/Swiss-Prot ID A2VDL2 Link Image
Enzyme 28 UniProtKB/Swiss-Prot Entry Name A2VDL2_BOVIN Link Image
Enzyme 28 PDB ID Not Available
Enzyme 28 Cellular Location Not Available
Enzyme 28 Gene Sequence >1485 bp
ATGGGGACCACGAAGGTCACCGCACCTCTGATCTTCGCCATCTCGGTTGCTACCATAGGC
TCTTTCCAGTTTGGCTACAACACTGGAGTCATCAATGCTCCTGAGGCGATCATAAAAGAC
TTTCTCAATTACACTTTGGAAGAGCGGTCAGAACCGCCCCCGTCCAGCGTGCTCCTCACA
TCCCTGTGGTCCTTGTCTGTGGCCATCTTCTCCGTGGGTGGTATGATTGGCTCCTTCTCC
GTCGGACTCTTTGTCAACCGATTTGGCAGGCGCAATTCAATGCTTATTGTCAACCTGTTG
GCCATAGCTGGCGGCTGCCTTATGGGATTCTGCAAAATAGCAGAGTCGGTTGAAATGCTG
ATCTTGGGCCGACTGATTATCGGCCTCTTCTGCGGACTCTGCACAGGATTCGTGCCCATG
TACATTGGAGAGATCTCCCCTACTGCCCTGCGGGGCGCCTTTGGCACTCTCAACCAGCTG
GGCATCGTTATCGGAATTCTGGTGGCCCAGATCTTTGGTCTAAAAGTCATCTTGGGGACT
GAAGATCTCTGGCCTCTGCTCCTGGGCTTCACCATCTTACCAGCCATCATCCAGTGCGCT
GCCCTTCCATTTTGCCCTGAAAGTCCTAGATTCTTGCTCATTAACAGAAAGGAGGAGGAG
AAGGCAAAGGAGATCCTCCAGAGACTCTGGGGCACCGAGGACGTGGCTCAGGATATCCAG
GAGATGAAGGATGAGAGTATGCGGATGTCGCAGGAGAAGCAAGTCACAGTGCTAGAGCTC
TTCCGCGCCCCCAACTACCGGCAACCCATCATTATCTCTATCATGCTCCAGCTCTCCCAG
CAGCTCTCTGGGATCAATGCAGTGTTCTACTACTCGACAGGAATCTTCAAAGATGCGGGT
GTCCAGGAGCCGGTCTATGCCACTATCGGCGCAGGTGTGGTCAACACCATCTTCACCGTG
GTGTCTGTGTTCTTGGTGGAAAGGGCTGGGAGGAGGACTCTTCACCTGATTGGCCTTGGA
GGGATGGCTTTTTGTTCCATCCTCATGACGATTTCTTTGTTACTGAAGGATAATTATAGC
TGGATGAGCTTTATCTGTATTGGGGCCATCCTGGTCTTCGTGGCCTTCTTTGAAATTGGC
CCAGGCCCTATTCCCTGGTTTATTGTGGCTGAACTCTTTGGTCAGGGACCCCGTCCAGCT
GCCATGGCAGTGGCTGGTTGTTCCAACTGGACCTCCAACTTTTTGGTTGGACTCCTCTTC
CCCTCGGCCGCGTTCTACTTAGGCGCCTATGTTTTCATCGTCTTCACTGTCTTCCTCGTT
ATCTTCTGGGTCTTCACCTTCTTCAAAGTTCCTGAGACCCGTGGCAGGACTTTTGAGGAA
ATTACACGAGCCTTTGAAGGGCAGACGCAGACAGGAACCCGCGGTGAGAAAGGCCCCATC
ATGGAGATGAACAGCATCCAGCCCACGAAGGACACCAATGCCTAA
Enzyme 28 GenBank Gene ID BC133291 Link Image
Enzyme 28 GeneCard ID SLC2A3 Link Image
Enzyme 28 GenAtlas ID Not Available
Enzyme 28 HGNC ID Not Available
Enzyme 28 Chromosome Location Chromosome:1
Enzyme 28 Locus 12p13.3
Enzyme 28 SNPs SNPJam Report Link Image
Enzyme 28 General References Not Available
Enzyme 28 Metabolite References Not Available
Enzyme 29 [top]
Enzyme 29 ID 2152
Enzyme 29 Name Solute carrier family 2 (Facilitated glucose transporter), member 6
Enzyme 29 Synonyms Not Available
Enzyme 29 Gene Name SLC2A6
Enzyme 29 Protein Sequence >Solute carrier family 2 (Facilitated glucose transporter), member 6
MQEPLLGAEGRDYDTFPEKPPPSPGERTRVGVLQNKRVFLATFAAVLGNFSFGYALVYTS
PVIPALEHSSDPNLNLTKTQASWFGSVFTLGAAAGGLSAMVLNDLLGRKLSIMFSAVPSA
AGYALMAGAHGLWMLLLGRMLTGFAGGLTAACIPVYVSEIAPPSVRGALGATPQLMAVFG
SLSLYALGLLLPWRWLAVAGEGPVLVMVLLLSCMPNSPRFLLSKGRDAEALQALAWLRGP
DADTRWEFEQIQDTVRRQSSHLSWAEARDPHMYRPIVIALLMRFLQQLTGITPILVYLQS
IFDSTAVLLPPKVDAAIVGAVRLLSVLIAALTMDLAGRKALLFVSAAGMFAANLTLGLYV
HFGPKSLAPNSSMGLGREALAGTEQPLAAPTSYLTLVPLLATMLFIMGYAVGWGPITWLL
MSEILPLRARGVASGLCVLVSWLTAFALTKSFLLVTNAFGLQAPFFFFAAVCLVNLAFTG
CCVPETKGRSLEQIESFFRTGRRSFLH
Enzyme 29 Number of Residues 507
Enzyme 29 Molecular Weight 54398.4
Enzyme 29 Theoretical pI 9.15
Enzyme 29 GO Classification
Function
Process
Component
Enzyme 29 General Function Carbohydrate transport and metabolism
Enzyme 29 Specific Function Not Available
Enzyme 29 Pathways Not Available
Enzyme 29 Reactions Not Available
Enzyme 29 Pfam Domain Function
Enzyme 29 Signals
  • None
Enzyme 29 Transmembrane Regions
  • None
Enzyme 29 Essentiality Not Available
Enzyme 29 GenBank ID Protein 119936015 Link Image
Enzyme 29 UniProtKB/Swiss-Prot ID A1L502 Link Image
Enzyme 29 UniProtKB/Swiss-Prot Entry Name A1L502_BOVIN Link Image
Enzyme 29 PDB ID Not Available
Enzyme 29 Cellular Location Not Available
Enzyme 29 Gene Sequence >1524 bp
ATGCAGGAGCCGCTGCTGGGAGCCGAAGGCCGGGACTATGACACCTTCCCCGAGAAGCCG
CCCCCGTCACCAGGGGAGAGGACGCGGGTCGGGGTCCTGCAGAACAAGAGAGTGTTCCTG
GCTACCTTCGCTGCTGTGCTGGGCAATTTCAGCTTCGGGTATGCCCTGGTCTACACGTCC
CCCGTCATCCCCGCCCTGGAGCACTCCTCGGATCCAAACCTGAATCTGACCAAAACCCAG
GCATCCTGGTTCGGGTCCGTGTTCACCCTGGGTGCGGCGGCCGGGGGACTCAGTGCCATG
GTCCTCAATGACCTCCTGGGCCGGAAACTCAGCATCATGTTCTCAGCTGTGCCCTCGGCA
GCCGGCTATGCGCTGATGGCAGGCGCCCACGGCCTCTGGATGCTGCTTCTGGGAAGGATG
CTGACAGGCTTCGCAGGGGGGCTCACAGCTGCCTGCATCCCGGTGTACGTGTCTGAGATT
GCCCCGCCCAGCGTTCGCGGGGCCCTGGGTGCCACACCCCAGCTCATGGCGGTGTTCGGG
TCACTATCCCTCTATGCCCTTGGCCTGCTGCTGCCCTGGCGCTGGCTGGCCGTGGCCGGG
GAGGGGCCGGTGCTCGTCATGGTCCTGCTGCTCAGCTGCATGCCCAACTCCCCTCGCTTC
CTGCTCTCCAAGGGCAGGGACGCGGAGGCGCTGCAGGCACTGGCCTGGCTGCGAGGGCCC
GATGCCGACACCCGCTGGGAGTTCGAGCAGATCCAGGACACCGTCCGGAGACAGAGCAGC
CACCTGTCGTGGGCCGAGGCCCGGGACCCGCACATGTACCGCCCGATTGTCATCGCCCTG
CTGATGCGCTTCCTGCAGCAGCTGACAGGCATCACGCCCATCCTCGTGTACCTGCAGTCC
ATCTTTGACAGCACCGCGGTCCTGCTGCCTCCCAAGGTTGACGCCGCCATCGTGGGCGCC
GTGAGGCTCCTGTCCGTGCTGATTGCCGCCCTCACCATGGACTTGGCCGGCCGCAAGGCC
CTGCTCTTCGTCTCGGCGGCCGGCATGTTTGCTGCCAACCTGACCCTGGGGCTATACGTG
CATTTTGGTCCGAAGTCTCTGGCCCCCAACAGCAGCATGGGCCTGGGACGCGAGGCCCTG
GCGGGCACAGAGCAGCCCCTGGCCGCGCCCACCAGCTACCTCACCCTGGTGCCCCTGCTG
GCCACCATGCTCTTCATCATGGGCTATGCCGTGGGCTGGGGCCCCATCACCTGGCTCCTC
ATGTCGGAGATCCTGCCGCTGCGGGCCCGTGGCGTGGCCTCAGGGCTCTGCGTGCTGGTC
AGCTGGCTCACCGCCTTTGCCCTCACCAAGTCCTTCCTGCTGGTGACGAACGCCTTCGGC
CTGCAGGCCCCCTTCTTCTTCTTTGCCGCCGTGTGCCTGGTGAACCTGGCCTTCACCGGC
TGCTGCGTGCCTGAGACCAAGGGCCGGTCGCTGGAGCAGATCGAGTCCTTCTTCCGCACC
GGGAGGAGGTCCTTCCTGCACTAG
Enzyme 29 GenBank Gene ID BT029789 Link Image
Enzyme 29 GeneCard ID SLC2A6 Link Image
Enzyme 29 GenAtlas ID Not Available
Enzyme 29 HGNC ID Not Available
Enzyme 29 Chromosome Location Chromosome:9
Enzyme 29 Locus 9q34
Enzyme 29 SNPs SNPJam Report Link Image
Enzyme 29 General References
  1. [PubMed Link Image]
Enzyme 29 Metabolite References Not Available
Enzyme 30 [top]
Enzyme 30 ID 2153
Enzyme 30 Name Glucagon
Enzyme 30 Synonyms
  1. Glicentin
  2. Glicentin-related polypeptide
  3. GRPP
  4. Oxyntomodulin
  5. OXY
  6. OXM
  7. Glucagon
  8. Glucagon-like peptide 1
  9. GLP-1
  10. Glucagon-like peptide 1(7-37)
  11. GLP-1(7-37)
  12. Glucagon-like peptide 1(7-36)
  13. GLP-1(7-36)
  14. Glucagon-like peptide 2
  15. GLP-2
Enzyme 30 Gene Name GCG
Enzyme 30 Protein Sequence >Glucagon
MKSLYFVAGLFVMLVQGSWQRSLQNTEEKSSSFPAPQTDPLGDPDQINEDKRHSQGTFTS
DYSKYLDSRRAQDFVQWLMNTKRNKNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFI
AWLVKGRGRRDFPEEVNIVEELRRRHADGSFSDEMNTVLDSLATRDFINWLLQTKITDRK
Enzyme 30 Number of Residues 180
Enzyme 30 Molecular Weight 20944.1
Enzyme 30 Theoretical pI 6.53
Enzyme 30 GO Classification
Function
Process
Component
Enzyme 30 General Function Involved in hormone activity
Enzyme 30 Specific Function Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity
Enzyme 30 Pathways Not Available
Enzyme 30 Reactions Not Available
Enzyme 30 Pfam Domain Function
Enzyme 30 Signals
  • 1-20
Enzyme 30 Transmembrane Regions
  • None
Enzyme 30 Essentiality Not Available
Enzyme 30 GenBank ID Protein 163082 Link Image
Enzyme 30 UniProtKB/Swiss-Prot ID P01272 Link Image
Enzyme 30 UniProtKB/Swiss-Prot Entry Name GLUC_BOVIN Link Image
Enzyme 30 PDB ID 1GCN Link Image
Enzyme 30 PDB File Show
Enzyme 30 3D Structure
Enzyme 30 Cellular Location Not Available
Enzyme 30 Gene Sequence >543 bp
ATGAAAAGCCTTTACTTTGTGGCTGGATTGTTTGTAATGCTGGTACAAGGCAGCTGGCAA
CGTTCCCTTCAGAACACAGAGGAGAAATCCAGTTCATTCCCAGCTCCCCAGACCGACCCG
CTCGGCGATCCAGATCAGATCAATGAAGATAAGCGCCACTCGCAGGGCACATTCACCAGT
GACTACAGCAAGTACCTGGACTCCAGGCGTGCCCAGGACTTCGTGCAGTGGTTGATGAAT
ACCAAGAGAAACAAGAATAACATTGCCAAACGTCATGATGAATTTGAGAGACATGCTGAA
GGGACCTTTACCAGTGATGTAAGTTCTTATTTGGAAGGCCAAGCTGCCAAGGAATTCATT
GCTTGGCTGGTGAAAGGCCGAGGAAGGCGAGATTTCCCAGAAGAAGTCAACATCGTTGAA
GAACTCCGCCGCAGACACGCCGATGGCTCTTTCTCTGATGAGATGAACACTGTTCTCGAT
AGTCTTGCCACCCGAGACTTTATAAACTGGTTGCTTCAGACGAAAATTACTGACAGGAAG
TAA
Enzyme 30 GenBank Gene ID K00107 Link Image
Enzyme 30 GeneCard ID GCG Link Image
Enzyme 30 GenAtlas ID Not Available
Enzyme 30 HGNC ID Not Available
Enzyme 30 Chromosome Location Chromosome:2
Enzyme 30 Locus 2q36-q37
Enzyme 30 SNPs SNPJam Report Link Image
Enzyme 30 General References
  1. [PubMed Link Image]
Enzyme 30 Metabolite References Not Available
Enzyme 31 [top]
Enzyme 31 ID 2154
Enzyme 31 Name Solute carrier family 5 member 1
Enzyme 31 Synonyms Not Available
Enzyme 31 Gene Name SLC5A1
Enzyme 31 Protein Sequence >Solute carrier family 5 member 1
VIYFVVVMAVGLWAMFSTNRGTV
Enzyme 31 Number of Residues 23
Enzyme 31 Molecular Weight 2561.1
Enzyme 31 Theoretical pI 9.34
Enzyme 31 GO Classification
Function
Process
Component
Enzyme 31 General Function Involved in glucose transmembrane transporter activity
Enzyme 31 Specific Function Not Available
Enzyme 31 Pathways Not Available
Enzyme 31 Reactions Not Available
Enzyme 31 Pfam Domain Function Not Available
Enzyme 31 Signals
  • None
Enzyme 31 Transmembrane Regions
  • None
Enzyme 31 Essentiality Not Available
Enzyme 31 GenBank ID Protein 146229942 Link Image
Enzyme 31 UniProtKB/Swiss-Prot ID A5HNF2 Link Image
Enzyme 31 UniProtKB/Swiss-Prot Entry Name A5HNF2_BOVIN Link Image
Enzyme 31 PDB ID Not Available
Enzyme 31 Cellular Location Not Available
Enzyme 31 Gene Sequence Not Available
Enzyme 31 GenBank Gene ID EF544430 Link Image
Enzyme 31 GeneCard ID SLC5A1 Link Image
Enzyme 31 GenAtlas ID Not Available
Enzyme 31 HGNC ID Not Available
Enzyme 31 Chromosome Location Chromosome:2
Enzyme 31 Locus 22q13.1|22q12.3
Enzyme 31 SNPs SNPJam Report Link Image
Enzyme 31 General References Not Available
Enzyme 31 Metabolite References Not Available
Enzyme 32 [top]
Enzyme 32 ID 2155
Enzyme 32 Name Hypoxia-inducible factor 1 alpha
Enzyme 32 Synonyms
  1. HIF-1 alpha
  2. HIF1 alpha
Enzyme 32 Gene Name HIF1A
Enzyme 32 Protein Sequence >Hypoxia-inducible factor 1 alpha
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDEMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQSQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWIETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET
DDQQLEEVPLYNDVMLPSSNEKLQNINLAMSPLPASETPKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQPASPSDGSTRQSSPEPNSPSEYCFDVDSDMVNEFKLELVEKLF
AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLENSSTSPQSASTNTVFQ
PTQMQKPPIATVTTTATSDELKTVTKDGMEDIKILIAFPSPPHVPKEPPCATTSPYSDTG
SRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTAPEEELNPKILALQNAQRKRKIE
HDGSLFQAVGIGTLLQQPDDRATTTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLL
GQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
Enzyme 32 Number of Residues 823
Enzyme 32 Molecular Weight 92127.1
Enzyme 32 Theoretical pI 4.93
Enzyme 32 GO Classification
Function
Process
Component
Enzyme 32 General Function Signal transduction mechanisms
Enzyme 32 Specific Function Functions as a master transcriptional regulator of the adaptive response to hypoxia. Under hypoxic conditions activates the transcription of over 40 genes, including, erythropoietin, glucose transporters, glycolytic enzymes, vascular endothelial growth factor, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. Plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. Activation requires recruitment of transcriptional coactivators such as CREBPB and EP300. Activity is enhanced by interaction with both, NCOA1 or NCOA2. Interaction with redox regulatory protein APEX seems to activate CTAD and potentiates activation by NCOA1 and CREBBP
Enzyme 32 Pathways Not Available
Enzyme 32 Reactions Not Available
Enzyme 32 Pfam Domain Function
Enzyme 32 Signals
  • None
Enzyme 32 Transmembrane Regions
  • None
Enzyme 32 Essentiality Not Available
Enzyme 32 GenBank ID Protein 5019612 Link Image
Enzyme 32 UniProtKB/Swiss-Prot ID Q9XTA5 Link Image
Enzyme 32 UniProtKB/Swiss-Prot Entry Name HIF1A_BOVIN Link Image
Enzyme 32 PDB ID Not Available
Enzyme 32 Cellular Location Not Available
Enzyme 32 Gene Sequence >2472 bp
ATGGAGGGCGCCGGGGGCGCGAACGACAAGAAAAAGATAAGTTCTGAACGTCGAAAAGAG
AAGTCTAGAGATGCAGCCAGATCTCGTCGAAGTAAAGAGTCTGAAGTTTTTTATGAGCTT
GCTCATCAGTTGCCACTCCCCCATAATGTAAGCTCGCATCTTGATAAGGCTTCTGTTATG
AGGCTCACCATCAGCTATTTGCGTGTGAGGAAACTTCTGGATGCTGGTGATTTGGATATT
GAAGATGAAATGAAGGCACAGATGAATTGCTTTTATTTGAAAGCCTTGGATGGTTTTGTT
ATGGTTCTCACAGATGATGGTGACATGATTTACATTTCTGATAATGTGAACAAATACATG
GGATTAACTCAGTTTGAACTAACTGGACACAGTGTGTTTGATTTTACTCATCCATGTGAC
CACGAGGAAATGAGAGAAATGCTTACACACAGAAATGGCCTTGTGAAAAAGGGTAAAGAG
CAAAATACACAGCGGAGCTTTTTTCTCAGAATGAAGTGTACCCTAACTAGCCGGGGGAGA
ACTATGAACATAAAATCTGCAACATGGAAAGTACTTCACTGCACAGGCCATATTCATGTA
TACGATACCAACAGTAACCAATCTCAGTGTGGGTATAAGAAACCACCGATGACGTGCTTG
GTGCTGATTTGTGAACCCATTCCTCATCCATCAAATATTGAAATTCCTTTAGACAGCAAG
ACTTTTCTCAGTCGTCACAGTCTGGATATGAAATTTTCTTATTGTGATGAAAGAATTACA
GAATTGATGGGATATGAGCCAGAAGAACTTTTGGGCCGCTCAATTTATGAATATTATCAT
GCCTTGGACTCTGACCATCTGACCAAAACTCATCATGATATGTTTACTAAAGGACAAGTC
ACAACAGGACAGTACAGAATGCTTGCCAAAAGAGGTGGATATGTCTGGATAGAAACTCAA
GCAACTGTCATATATAACACTAAGAACTCTCAGCCCCAGTGCATTGTATGTGTAAATTAT
GTTGTGAGTGGTATTATTCAGCACGACTTGATTTTCTCCCTTCAACAAACAGAATGTGTT
CTCAAACCAGTTGAATCTTCAGACATGAAAATGACTCAGCTATTCACCAAAGTTGAATCA
GAAGATACAAGCAGTCTCTTTGATAAACTTAAGAAGGAGCCTGATGCTTTAACTTTGCTG
GCCCCAGCTGCTGGAGACACAATCATATCTTTAGATTTTGGCAGCAATGACACAGAGACT
GATGACCAACAACTTGAGGAAGTTCCATTGTATAATGATGTAATGCTCCCCTCATCTAAT
GAGAAATTGCAGAATATAAATTTGGCAATGTCTCCATTACCTGCCTCTGAAACTCCAAAG
CCACTTAGAAGTAGTGCTGACCCTGCACTCAACCAAGAAGTTGCATTAAAGTTAGAACCA
AATCCAGAGTCACTGGAACTTTCTTTTACCATGCCCCAGATTCAAGATCAGCCAGCTAGT
CCTTCTGATGGAAGCACCAGACAAAGTTCACCTGAGCCTAACAGTCCCAGTGAATATTGT
TTTGATGTGGATAGTGATATGGTCAATGAATTCAAGTTGGAATTGGTAGAGAAACTTTTT
GCTGAAGATACAGAAGCAAAGAATCCATTTTCCACTCAGGACACTGATTTAGACTTGGAG
ATGTTAGCTCCTTATATCCCAATGGATGATGACTTCCAGTTACGTTCCTTCGATCAGTTG
TCACCACTGGAAAACAGTTCTACAAGTCCTCAGAGTGCAAGCACAAATACAGTATTCCAG
CCCACTCAAATGCAAAAACCTCCTATAGCCACCGTCACTACCACAGCCACCAGTGATGAA
TTGAAAACAGTGACAAAAGATGGTATGGAAGACATTAAAATACTGATTGCATTTCCATCT
CCTCCCCACGTACCTAAAGAACCTCCTTGTGCCACAACGTCACCATATAGTGATACTGGA
AGTCGGACAGCCTCACCCAACAGAGCAGGAAAAGGAGTCATAGAACAGACAGAAAAATCT
CATCCAAGAAGCCCTAATGTGTTATCTGTCGCTTTGAGTCAAAGAACTACTGCTCCTGAG
GAAGAACTAAATCCAAAGATACTAGCTTTGCAGAATGCTCAGAGAAAGCGAAAAATTGAA
CATGATGGTTCACTTTTTCAAGCAGTAGGAATTGGAACATTATTACAGCAACCAGATGAT
CGTGCAACTACCACATCACTTTCTTGGAAACGTGTAAAAGGATGCAAATCTAGTGAACAA
AATGGAATGGAGCAAAAGACAATTATTTTAATACCCTCTGATTTAGCATGTAGACTGCTG
GGGCAATCAATGGATGAGAGTGGACTACCACAGCTGACCAGTTATGATTGTGAAGTTAAT
GCTCCTATACAAGGCAGCAGAAACCTACTGCAGGGTGAAGAATTACTCAGAGCTTTGGAT
CAAGTTAACTGA
Enzyme 32 GenBank Gene ID AB018398 Link Image
Enzyme 32 GeneCard ID HIF1A Link Image
Enzyme 32 GenAtlas ID Not Available
Enzyme 32 HGNC ID Not Available
Enzyme 32 Chromosome Location Chromosome:1
Enzyme 32 Locus 14q21-q24
Enzyme 32 SNPs SNPJam Report Link Image
Enzyme 32 General References
  1. [PubMed Link Image]
Enzyme 32 Metabolite References Not Available
Enzyme 33 [top]
Enzyme 33 ID 2156
Enzyme 33 Name Interleukin 1-beta
Enzyme 33 Synonyms Not Available
Enzyme 33 Gene Name Not Available
Enzyme 33 Protein Sequence >Interleukin 1-beta
VFCMSFVQGEERDNKIPVALGIKDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFV
FYKTEIKNTVEFESVLYPNWYISTSQIEERPVFLGHFRGGQDITDFRMETLSP
Enzyme 33 Number of Residues 113
Enzyme 33 Molecular Weight 13246.1
Enzyme 33 Theoretical pI 5.93
Enzyme 33 GO Classification
Function
Process
Component
Enzyme 33 General Function Involved in cytokine activity
Enzyme 33 Specific Function Not Available
Enzyme 33 Pathways Not Available
Enzyme 33 Reactions Not Available
Enzyme 33 Pfam Domain Function
Enzyme 33 Signals
  • None
Enzyme 33 Transmembrane Regions
  • None
Enzyme 33 Essentiality Not Available
Enzyme 33 GenBank ID Protein 56681176 Link Image
Enzyme 33 UniProtKB/Swiss-Prot ID Q5MAC0 Link Image
Enzyme 33 UniProtKB/Swiss-Prot Entry Name Q5MAC0_BOVIN Link Image
Enzyme 33 PDB ID Not Available
Enzyme 33 Cellular Location Not Available
Enzyme 33 Gene Sequence Not Available
Enzyme 33 GenBank Gene ID AY851162 Link Image
Enzyme 33 GeneCard ID Not Available
Enzyme 33 GenAtlas ID Not Available
Enzyme 33 HGNC ID Not Available
Enzyme 33 Chromosome Location Not Available
Enzyme 33 Locus Not Available
Enzyme 33 SNPs SNPJam Report Link Image
Enzyme 33 General References Not Available
Enzyme 33 Metabolite References Not Available
Enzyme 34 [top]
Enzyme 34 ID 2157
Enzyme 34 Name Na+/glucose cotransporter
Enzyme 34 Synonyms Not Available
Enzyme 34 Gene Name SGLT1
Enzyme 34 Protein Sequence >Na+/glucose cotransporter
MDSSTWSPPATATAEPLPPYERIRNAADISVIVIYFVVVMAVGLWAMFSTNRGTVGGFFL
AGRSMVWWPIGASLFASNIGSGHFVGLAGTGAAAGIATGGFEWNALILVVVLGWVFVPIY
IKAGVVTMPEYLRKRFGGQRIQVYLSVLSLVLYIFTKISADIFSGAIFINLALGLDLYLA
IFILLAITALYTITGGLAAVIHTDTLQTVIMLLGSFILTGFAFHEVGGYGAFVTKYMNAI
PTVTSYGNTTIKAECYTPRADSFHIFRDPLKGDLPWPGLIFGLTIISLWYWCTDQVIVQR
CLSAKNMSHVKAGCIMCGYLKLLPMFLMVMPGMISRILFTEKVACTVPSECEKYCGTKVG
CTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYTKIRKKASEK
ELMIAGRLFMLVLIGVSIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFCKRV
NEPGAFWGLIIGFLIGVSRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFVITIIV
ILAVSLFTKPIADVHLYRLCWSLRNSKEERIDLDAEDEDVQDAREDALEIDTEASEEKKG
CFRRAYDMFCGLDQQKAPKMTKEEEAAMKLKMTDTSENRLWRMVVNINGIILLAVAVFCH
AYFA
Enzyme 34 Number of Residues 664
Enzyme 34 Molecular Weight 73075.6
Enzyme 34 Theoretical pI 7.30
Enzyme 34 GO Classification
Function
Process
Component
Enzyme 34 General Function Involved in glucose transmembrane transporter activity
Enzyme 34 Specific Function Not Available
Enzyme 34 Pathways Not Available
Enzyme 34 Reactions Not Available
Enzyme 34 Pfam Domain Function
Enzyme 34 Signals
  • None
Enzyme 34 Transmembrane Regions
  • None
Enzyme 34 Essentiality Not Available
Enzyme 34 GenBank ID Protein 21070365 Link Image
Enzyme 34 UniProtKB/Swiss-Prot ID Q8MKB7 Link Image
Enzyme 34 UniProtKB/Swiss-Prot Entry Name Q8MKB7_BOVIN Link Image
Enzyme 34 PDB ID Not Available
Enzyme 34 Cellular Location Not Available
Enzyme 34 Gene Sequence >1995 bp
ATGGACAGTAGCACCTGGAGCCCCCCGGCCACGGCCACCGCCGAGCCCCTCCCGCCCTAC
GAGCGCATCCGCAATGCAGCTGACATCTCTGTCATCGTCATCTACTTCGTGGTGGTGATG
GCTGTCGGGCTGTGGGCCATGTTTTCCACTAACCGTGGGACCGTTGGAGGCTTCTTCCTG
GCAGGTCGAAGTATGGTGTGGTGGCCGATTGGAGCCTCTCTGTTTGCCAGTAACATTGGA
AGCGGCCACTTTGTGGGACTGGCGGGGACCGGAGCAGCTGCAGGAATTGCCACTGGGGGC
TTTGAATGGAATGCCCTGATTTTGGTGGTTGTGCTGGGCTGGGTGTTTGTCCCCATTTAC
ATTAAGGCGGGGGTGGTGACGATGCCAGAGTACCTGCGGAAGCGATTTGGAGGCCAGCGG
ATCCAGGTCTACCTGTCTGTCCTGTCCCTGGTGCTGTACATTTTCACCAAGATCTCGGCA
GACATCTTTTCTGGGGCCATATTCATCAACTTGGCCTTGGGCCTGGATCTCTACCTGGCC
ATCTTTATCTTATTGGCAATCACCGCCCTTTACACAATCACAGGGGGCCTGGCGGCTGTG
ATTCACACAGACACCTTGCAGACGGTGATTATGCTCCTGGGGTCTTTCATCCTGACTGGG
TTTGCTTTCCACGAAGTGGGAGGGTATGGTGCCTTCGTGACAAAATACATGAATGCCATT
CCAACTGTGACCTCTTATGGAAACACCACCATCAAGGCAGAGTGCTACACCCCGAGGGCT
GACTCCTTCCACATCTTCCGCGATCCTCTCAAGGGAGACCTGCCCTGGCCTGGGCTCATC
TTTGGGCTGACCATCATCTCCCTGTGGTACTGGTGCACAGACCAGGTCATTGTGCAGCGC
TGCCTCTCTGCCAAAAACATGTCCCACGTGAAGGCCGGCTGCATCATGTGTGGGTACCTG
AAGCTGCTGCCCATGTTCCTCATGGTGATGCCAGGGATGATCAGCCGCATCCTGTTCACA
GAGAAAGTTGCCTGCACCGTCCCCTCAGAGTGTGAGAAATACTGCGGCACCAAGGTTGGC
TGTACCAACATCGCCTACCCGACCTTGGTGGTGGAGCTCATGCCCAATGGACTGCGAGGC
CTGATGCTGTCGGTCATGCTGGCCTCGCTCATGAGCTCGCTGACCTCCATCTTCAACAGT
GCCAGCACCCTCTTCACCATGGACATCTACACCAAGATCCGGAAGAAAGCCTCTGAGAAA
GAGCTCATGATCGCAGGACGGTTGTTCATGCTGGTGCTGATCGGTGTCAGCATCGCCTGG
GTGCCCATCGTGCAGTCAGCACAGAGTGGACAGCTCTTCGACTACATCCAGTCCATCACC
AGTTACTTGGGACCACCCATCGCAGCAGTCTTCCTGCTTGCTATTTTCTGCAAGAGAGTC
AATGAGCCGGGAGCCTTTTGGGGATTGATCATAGGATTTTTGATCGGGGTGTCCCGTATG
ATTACCGAGTTTGCCTATGGAACCGGGAGCTGCATGGAGCCCAGCAACTGTCCCACGATT
ATCTGTGGTGTGCACTACTTGTACTTTGCCATCATCCTCTTTGTCATTACTATCATCGTC
ATCCTGGCTGTCTCCCTCTTCACCAAGCCCATTGCAGATGTGCATCTCTACCGCCTGTGC
TGGAGCCTGCGTAACAGCAAAGAGGAGCGTATTGACCTGGATGCAGAAGACGAGGACGTT
CAAGATGCCCGGGAGGATGCCTTAGAAATAGACACAGAAGCTTCTGAGGAGAAAAAAGGA
TGCTTCAGGCGGGCCTATGACATGTTCTGTGGCCTGGACCAGCAGAAAGCCCCCAAAATG
ACGAAGGAAGAGGAGGCAGCCATGAAGCTGAAGATGACAGACACCTCGGAGAATCGTTTG
TGGCGGATGGTAGTGAACATCAATGGCATCATTCTGCTGGCCGTGGCTGTCTTCTGCCAT
GCCTACTTTGCCTGA
Enzyme 34 GenBank Gene ID AF508807 Link Image
Enzyme 34 GeneCard ID SGLT1 Link Image
Enzyme 34 GenAtlas ID Not Available
Enzyme 34 HGNC ID Not Available
Enzyme 34 Chromosome Location Chromosome:2
Enzyme 34 Locus 22q13.1|22q12.3
Enzyme 34 SNPs SNPJam Report Link Image
Enzyme 34 General References Not Available
Enzyme 34 Metabolite References Not Available
Enzyme 35 [top]
Enzyme 35 ID 2158
Enzyme 35 Name Sodium-dependent glucose transporter SGLT-I
Enzyme 35 Synonyms Not Available
Enzyme 35 Gene Name Not Available
Enzyme 35 Protein Sequence >Sodium-dependent glucose transporter SGLT-I
LTGFAFHEVGGYGAFVTKYINAIPTVTSYGNTTIKAECYTPRADSFHIFRDPLKGDLPWP
GLIFGLTIISLWYWCTDQVIVQRCLSAKNMSHVKAGCIMCGYLKLLPMFLMVMPGMISRI
LFTEKVACTVPSECENYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSI
FNSA
Enzyme 35 Number of Residues 184
Enzyme 35 Molecular Weight 20234.8
Enzyme 35 Theoretical pI 8.13
Enzyme 35 GO Classification
Function
Process
Component
Enzyme 35 General Function Involved in glucose:sodium symporter activity
Enzyme 35 Specific Function Not Available
Enzyme 35 Pathways Not Available
Enzyme 35 Reactions Not Available
Enzyme 35 Pfam Domain Function
Enzyme 35 Signals
  • None
Enzyme 35 Transmembrane Regions
  • None
Enzyme 35 Essentiality Not Available
Enzyme 35 GenBank ID Protein 14486596 Link Image
Enzyme 35 UniProtKB/Swiss-Prot ID Q95JG8 Link Image
Enzyme 35 UniProtKB/Swiss-Prot Entry Name Q95JG8_BOVIN Link Image
Enzyme 35 PDB ID Not Available
Enzyme 35 Cellular Location Not Available
Enzyme 35 Gene Sequence Not Available
Enzyme 35 GenBank Gene ID AF308831 Link Image
Enzyme 35 GeneCard ID Not Available
Enzyme 35 GenAtlas ID Not Available
Enzyme 35 HGNC ID Not Available
Enzyme 35 Chromosome Location Not Available
Enzyme 35 Locus Not Available
Enzyme 35 SNPs SNPJam Report Link Image
Enzyme 35 General References Not Available
Enzyme 35 Metabolite References Not Available
Enzyme 36 [top]
Enzyme 36 ID 2159
Enzyme 36 Name Kruppel-like factor 15
Enzyme 36 Synonyms Not Available
Enzyme 36 Gene Name Not Available
Enzyme 36 Protein Sequence >Kruppel-like factor 15
HEPAPVKGEHFSFPEFPVGNPDDVPRPFQPTLEEIEEFLEENMEPAVKQAPEGSGKDLDT
CGQLSTGPHRGHLHPGASGRERCTPPPGAGAAGSQGPAGAPAPDPPVPLLLQIQPVPVKQ
ESGAEPASPGQPPEAVRVAQLLVSIQGQTFTLVPQVLPSSSLSLPSKFVRXAPVPIAAKP
LGSGPLGPGSTGLLVGQKFPKNPAAELIKMHRCTFPGCSKMYTKSSHLKAHLRRHTGEKP
FACTWPGCGWRFSRSDELSRHRRSHSGVKPTVPRVREEVARSDHLSKHVKVHRFPRSSRL
PRP
Enzyme 36 Number of Residues 303
Enzyme 36 Molecular Weight 32494.8
Enzyme 36 Theoretical pI 10.09
Enzyme 36 GO Classification
Function
Process
Component
Enzyme 36 General Function Involved in protein binding
Enzyme 36 Specific Function Not Available
Enzyme 36 Pathways Not Available
Enzyme 36 Reactions Not Available
Enzyme 36 Pfam Domain Function
Enzyme 36 Signals
  • None
Enzyme 36 Transmembrane Regions
  • None
Enzyme 36 Essentiality Not Available
Enzyme 36 GenBank ID Protein 38154565 Link Image
Enzyme 36 UniProtKB/Swiss-Prot ID Q6UNK6 Link Image
Enzyme 36 UniProtKB/Swiss-Prot Entry Name Q6UNK6_BOVIN Link Image
Enzyme 36 PDB ID Not Available
Enzyme 36 Cellular Location Not Available
Enzyme 36 Gene Sequence Not Available
Enzyme 36 GenBank Gene ID AY366084 Link Image
Enzyme 36 GeneCard ID Not Available
Enzyme 36 GenAtlas ID Not Available
Enzyme 36 HGNC ID Not Available
Enzyme 36 Chromosome Location Not Available
Enzyme 36 Locus Not Available
Enzyme 36 SNPs SNPJam Report Link Image
Enzyme 36 General References
  1. [PubMed Link Image]
Enzyme 36 Metabolite References Not Available