We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Glyoxylic acid (BMDB00119)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-07-08 11:28:56
Accession Number BMDB00119
Common Name Glyoxylic acid
Description Glyoxylic acid or oxoacetic acid is an organic compound that is both an aldehyde and a carboxylic acid. Glyoxylic acid is a liquid with a melting Point of -93 degree centigrade and a boiling Point of 111 degree centigrade. It is an intermediate of the glyoxylate cycle, which enables certain organisms to convert fatty acids into carbohydrates. The conjugate base of gloxylic acid is known as glyoxylate. This compound is an intermediate of the glyoxylate cycle, which enables organisms, such as bacteria, fungi and plants to convert fatty acids into carbohydrates. Glyoxylate is the byproduct of the amidation process in biosynthesis of several amidated peptides. The glyoxylate cycle is a metabolic pathway occurring in plants, and several microorganisms, such as E. coli and yeast. Recent research shows that it is present in vertebrates (including humans) and insects. The glyoxylate cycle allows these organisms to use fats for the synthesis of carbohydrates. [PMID: 16396466]
Synonyms
  1. Formylformate
  2. Formylformic acid
  3. Glyoxalate
  4. Glyoxalic acid
  5. Glyoxylate
  6. Glyoxylic acid
  7. Oxalaldehydate
  8. Oxalaldehydic acid
  9. Oxoacetate
  10. Oxoacetic acid
  11. Oxoethanoate
  12. Oxoethanoic acid
  13. a-Ketoacetate
  14. a-Ketoacetic acid
  15. alpha-Ketoacetate
  16. alpha-Ketoacetic acid
Chemical IUPAC Name oxo-Acetic acid
Chemical Formula C2H2O3
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Organic acids
Class
  • Keto-Acids
Sub Class
  • Short chain fatty acids
Family
  • Mammalian_Metabolite
Species
  • aldehyde; carboxylic acid
Biofunction
Application
Source
  • Endogenous
Average Molecular Weight 74.035
Monoisotopic Molecular Weight 74.000397
Isomeric SMILES OC(=O)C=O
Canonical SMILES OC(=O)C=O
KEGG Compound ID C00048 Link Image
BioCyc ID GLYOX Link Image
BiGG ID 33659 Link Image
Wikipedia Link Glyoxylic acid Link Image
METLIN ID 3213 Link Image
PubChem Compound 760 Link Image
PubChem Substance 8027585 Link Image
ChEBI ID 16891 Link Image
CAS Registry Number 298-12-4
InChI Identifier InChI=1/C2H2O3/c3-1-2(4)5/h1H,(H,4,5)
Synthesis Reference Jie, Yuanping; Song, Zhen. Method for preparing glyoxylic acid. Faming Zhuanli Shenqing Gongkai Shuomingshu (2007), 5pp.
Melting Point (Experimental) -93 oC
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 1000.0 mg/mL [MEYLAN,WM et al. (1996)]; 224.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -1
State Liquid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -0.59 [Predicted by ALOGPS]; -0.6 [Predicted by PubChem via XLOGP]; -1.40 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID 1D8C Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from Solubility)
  • mitochondria
  • peroxisome
Biofluid Location Not Available
Tissue Location
Tissue References
All Tissues
Concentrations (Normal) Not Available
Concentrations (Abnormal) Not Available
Pathway Names
  • Glycine, Serine and Threonine Metabolism
  • Glyoxylate and Dicarboxylate Metabolism
HMDB Pathways
Name Glycine, Serine and Threonine Metabolism
Image Show Link Image
Name Glyoxylate and Dicarboxylate Metabolism
Image Show Link Image
KEGG Pathways
Name Glycine, Serine and Threonine Metabolism
Image Show Link Image
Name Glyoxylate and Dicarboxylate Metabolism
Image Show Link Image
SimCell Pathways
Name Glycine, Serine and Threonine Metabolism
Image Show Link Image
Graph Show Link Image
SBML Download (XML) Link Image
Name Glyoxylate and Dicarboxylate Metabolism
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Peptidyl-glycine alpha-amidating monooxygenase
  2. Alanine--glyoxylate aminotransferase 2, mitochondrial
Enzyme 1 [top]
Enzyme 1 ID 665
Enzyme 1 Name Peptidyl-glycine alpha-amidating monooxygenase
Enzyme 1 Synonyms
  1. PAM
  2. Peptidylglycine alpha-hydroxylating monooxygenase
  3. PHM
  4. Peptidyl-alpha-hydroxyglycine alpha-amidating lyase
  5. Peptidylamidoglycolate lyase
  6. PAL
Enzyme 1 Gene Name PAM
Enzyme 1 Protein Sequence >Peptidyl-glycine alpha-amidating monooxygenase
MAGFRSLLVLLLVFPSGCVGFRSPLSVFKRFKETTRSFSNECLGTTRPVIPIDSSDFALD
IRMPGVTPKQSDTYFCMSVRLPMDEEAFVIDFKPRASMDTVHHMLLFGCNMPASTGNYWF
CDEGTCTDKANILYAWARNAPPTRLPKGVGFRVGGETGSKYFVLQVHYGDISAFRDNHKD
CSGVSLHLTRLPQPLIAGMYLMMSVDTVIPPGGKVVNSDISCHYKKYPMHVFAYRVHTHH
LGKVVSGYRVRNGQWTLIGRQSPQLPQAFYPVEHPVDVSFGDILAARCVFTGEGRTEVTH
IGGTSSDEMCNLYIMYYMEAKHAVSFMTCTQNVAPDIFRTIPPEANIPIPVKSDMVMMHG
HHKETENKDKTSLLQQPKREEEGVLEQGDFYSLLSKLLGEREDVVHVHKYNPTEKAESES
DLVAEIANVVQKKDLGRSDTRESAEQERGNAILVRDRIHKFHRLVSTLRPAESRVLSLQQ
PLPGEGTWEPEHTGDFHVEEALDWPGVYLLPGQVSGVALDPQNNLVIFHRGDHVWDGNSF
DSKFVYQQRGLGPIEEDTILVIDPNNAAVLQSSGKNLFYLPHGLSIDKDGNYWVTDVALH
QVFKLDPKSKEGPLLTLGRSMQPGSDQNHFCQPTDVAVDPDTGTIYVSDGYCNSRLVQFS
PSGKFITQWGEASLESSPKPGQFRVPHSLALVPPLGQLCVADRENGRIQCFKTDTKEFVR
EIKHPSFGRNVFAISYIPGLLFAVNGKPYFEDQEPVQGFVMNFSSGEIIDVFKPVRKHFD
MPHDIAASEDGTVYVGDAHTNTVWKFTSTEKMEHRSVKKAGIEVQEIKESEAVVETKMEN
KPASSELQKIQEKQKLVKEPGSGVPAVLITTLLVIPVVVLLAIALFIRWKKSRAFGDSER
KLEASSGRVLGRLRGKGGGGLNLGNFFASRKGYSRKGFDRLSTEGSDQEKDEDASESEEE
YSAPPPAPAPSS
Enzyme 1 Number of Residues 972
Enzyme 1 Molecular Weight 108176.1
Enzyme 1 Theoretical pI 6.59
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Involved in copper ion binding
Enzyme 1 Specific Function Bifunctional enzyme that catalyzes 2 sequential steps in C-terminal alpha-amidation of peptides. The monooxygenase part produces an unstable peptidyl(2-hydroxyglycine) intermediate that is dismutated to glyoxylate and the corresponding desglycine peptide amide by the lyase part. C-terminal amidation of peptides such as neuropeptides is essential for full biological activity
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • 1-20
Enzyme 1 Transmembrane Regions
  • 874-897
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 163482 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID P10731 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name AMD_BOVIN Link Image
Enzyme 1 PDB ID 1SDW Link Image
Enzyme 1 PDB File Show
Enzyme 1 3D Structure
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >2919 bp
ATGGCTGGCTTTCGGAGCCTGCTAGTTCTTCTCCTCGTGTTTCCCAGTGGCTGTGTGGGC
TTCCGAAGCCCACTTTCTGTCTTTAAGAGGTTTAAAGAAACTACCAGATCATTTTCCAAT
GAATGTCTTGGTACCACCAGACCAGTAATTCCTATCGATTCATCAGATTTTGCGTTGGAT
ATTCGCATGCCTGGGGTCACACCCAAACAGTCTGATACGTACTTCTGCATGTCAGTGCGT
TTGCCAATGGATGAGGAAGCCTTCGTGATTGACTTCAAACCCCGTGCCAGCATGGATACT
GTCCATCATATGTTACTGTTTGGATGCAATATGCCAGCGTCCACTGGAAATTACTGGTTT
TGTGATGAAGGCACCTGTACAGATAAAGCCAATATTCTCTATGCCTGGGCAAGAAATGCT
CCCCCAACGAGACTCCCCAAAGGTGTTGGATTCAGAGTTGGAGGAGAGACTGGAAGCAAA
TACTTTGTACTCCAAGTACACTATGGGGATATTAGTGCTTTTAGAGATAATCACAAGGAC
TGCTCTGGTGTTTCCTTACACCTCACACGCCTGCCACAGCCTTTAATTGCTGGCATGTAC
CTTATGATGTCTGTTGACACTGTTATACCACCAGGAGGGAAAGTGGTGAATTCTGATATT
TCATGCCATTATAAAAAGTATCCAATGCATGTCTTTGCCTACAGAGTTCACACTCACCAT
TTAGGCAAGGTAGTCAGTGGATACAGAGTAAGAAATGGACAGTGGACCCTGATTGGACGC
CAAAGCCCCCAACTGCCACAGGCCTTCTACCCAGTAGAGCACCCAGTGGATGTGAGTTTT
GGTGACATCCTGGCAGCAAGATGTGTGTTCACTGGGGAAGGGAGGACAGAAGTCACACAC
ATTGGTGGCACGTCTAGTGATGAAATGTGCAACTTATACATTATGTATTACATGGAAGCC
AAGCATGCAGTTTCTTTCATGACCTGTACACAGAATGTAGCTCCAGATATATTCAGAACC
ATACCACCAGAGGCCAATATTCCAATTCCTGTGAAATCCGATATGGTTATGATGCATGGA
CATCACAAAGAAACAGAGAACAAAGACAAGACTTCTTTACTACAGCAGCCCAAACGAGAA
GAAGAAGGAGTGTTAGAACAGGGTGATTTCTATTCACTACTTTCCAAGCTGCTAGGAGAA
AGGGAAGATGTTGTTCATGTGCATAAATATAATCCTACAGAAAAGGCAGAATCAGAGTCT
GACCTGGTAGCTGAGATTGCAAACGTAGTCCAAAAGAAGGATCTTGGTCGGTCCGATACC
AGAGAGAGTGCAGAACAGGAGAGGGGCAATGCTATTCTTGTCAGAGACAGAATTCACAAA
TTCCACAGACTAGTGTCTACCTTGAGGCCTGCAGAGAGCAGAGTTCTGTCGTTACAGCAG
CCCCTACCTGGTGAAGGCACCTGGGAACCAGAACACACAGGAGATTTCCATGTAGAAGAG
GCACTGGATTGGCCTGGAGTATACTTGTTACCAGGCCAGGTTTCTGGGGTGGCTCTGGAC
CCTCAGAATAATCTCGTGATTTTCCACCGAGGTGACCACGTCTGGGATGGAAACTCTTTT
GATAGCAAGTTTGTTTACCAGCAAAGAGGTCTTGGACCAATTGAAGAAGACACTATTCTT
GTCATAGATCCAAATAATGCTGCAGTACTCCAGTCCAGTGGAAAAAATCTGTTTTACTTG
CCACATGGCTTGAGTATAGATAAAGATGGAAATTATTGGGTCACAGACGTGGCGCTTCAT
CAGGTGTTCAAACTAGATCCAAAGAGTAAAGAAGGCCCTCTGCTAACCCTGGGAAGGAGC
ATGCAACCAGGCAGTGACCAGAATCACTTCTGTCAGCCCACCGATGTGGCTGTGGATCCA
GACACCGGAACCATCTATGTGTCAGATGGCTACTGCAACAGTCGCCTTGTGCAGTTTTCA
CCAAGTGGAAAATTCATCACACAGTGGGGAGAAGCGTCTCTAGAGAGCAGTCCTAAACCA
GGCCAGTTCAGAGTTCCTCACAGCTTGGCCCTGGTGCCTCCCCTGGGCCAGCTGTGTGTG
GCAGACCGGGAAAACGGTCGGATCCAGTGTTTCAAAACCGACACCAAAGAATTTGTGCGC
GAGATTAAGCACCCATCGTTTGGAAGAAATGTGTTTGCAATTTCATACATACCAGGTTTG
CTCTTTGCGGTGAATGGAAAGCCTTACTTTGAGGACCAAGAACCCGTGCAAGGATTTGTG
ATGAACTTTTCCAGCGGGGAAATTATCGATGTCTTCAAGCCAGTGCGCAAGCACTTCGAC
ATGCCCCACGACATTGCTGCGTCCGAGGACGGGACCGTGTATGTCGGAGACGCTCACACC
AACACCGTGTGGAAGTTCACCTCGACCGAAAAAATGGAACATCGATCAGTTAAGAAGGCT
GGCATTGAGGTTCAGGAAATCAAAGAATCCGAGGCAGTTGTTGAAACCAAAATGGAGAAC
AAGCCCGCCTCCTCAGAATTGCAGAAGATACAAGAGAAACAGAAGCTGGTCAAAGAGCCG
GGCTCCGGAGTGCCGGCTGTTCTCATTACAACCCTTCTGGTTATTCCTGTGGTTGTCCTG
CTGGCCATTGCCTTATTTATTCGGTGGAAAAAATCAAGGGCCTTTGGAGATTCTGAACGT
AAACTTGAGGCCAGTTCGGGAAGAGTTCTGGGAAGACTTAGAGGAAAGGGAGGCGGAGGC
CTAAACCTGGGCAACTTCTTCGCCAGCCGGAAGGGCTACAGCCGGAAGGGGTTCGACCGC
CTCAGCACGGAAGGAAGCGACCAGGAGAAAGATGAGGACGCAAGCGAGTCCGAAGAAGAG
TACTCGGCCCCGCCGCCCGCCCCTGCCCCTTCCTCCTGA
Enzyme 1 GenBank Gene ID M18683 Link Image
Enzyme 1 GeneCard ID PAM Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:5
Enzyme 1 Locus 5q14-q21
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 793
Enzyme 2 Name Alanine--glyoxylate aminotransferase 2, mitochondrial
Enzyme 2 Synonyms
  1. AGT 2
  2. (R)-3-amino-2-methylpropionate--pyruvate transaminase
  3. Beta-alanine-pyruvate aminotransferase
  4. Beta-ALAAT II
  5. D-AIBAT
Enzyme 2 Gene Name AGXT2
Enzyme 2 Protein Sequence >Alanine--glyoxylate aminotransferase 2, mitochondrial
MTGAWGHLLRSLHLKTLSLWIPKTCFSLKARAFWTSVTRCGLHTKPSMPPCDFTPERYQS
LAYSRVLEIHKQHLSPVHTAYFPEPLLLHQGHVEWLFDHEGNRYLDFFSGIVTVSVGHCH
PKVNAAAQRQLGRLWHTSSVFFHPLIHEYAEKLSALLPEPLKVVFLVNSGSEANDLAMLM
ARAHSNSTDIISFRGAYHGCSPYTLGLTNVGIYKMDLPHGMGCQPTMCPDIFHGPWGGSH
CRDSPVQTIRKCSCAPDCCQAKDQYIEQFKDTLSTSVAKSIAGFFAEPIQGVNGVVQYPK
GFLKEAFELVRERGGVCIADEVQTGFGRLGSHFWGFQTHDVLPDIVTMAKGIGNGFPMAA
VVTTPDIAKSLTKRMLHFNTFGGNPMACAVGSAVLEVIKEENLQENSQEVGTYMLLKLAK
LRDEFEIVGDVRGKGLMIGIEMVKDKESRQPLPREEVNQIHHDCKCMGLLIGRGGLFSQT
FRIAPSMCITKPEVDFAVEVFRSALIQHMERRAK
Enzyme 2 Number of Residues 514
Enzyme 2 Molecular Weight 57225.8
Enzyme 2 Theoretical pI 7.93
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Amino acid transport and metabolism
Enzyme 2 Specific Function L-alanine + glyoxylate = pyruvate + glycine
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 109659373 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q17QF0 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name AGT2_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1545 bp
ATGACAGGAGCCTGGGGACATTTGCTGAGATCTTTGCACCTGAAAACCTTATCTCTCTGG
ATCCCCAAGACGTGCTTTTCCCTTAAGGCCCGTGCTTTCTGGACATCTGTGACCAGGTGC
GGTCTTCATACAAAGCCCAGCATGCCGCCATGTGACTTCACACCCGAAAGATACCAGTCC
CTGGCCTATAGCCGAGTCCTGGAGATCCATAAGCAACATCTCTCTCCTGTGCACACCGCC
TATTTCCCGGAGCCCCTGTTGCTCCACCAGGGACACGTGGAGTGGCTCTTTGATCATGAG
GGAAACAGATACCTGGATTTCTTTTCTGGGATTGTCACTGTCAGTGTTGGTCACTGCCAC
CCAAAAGTAAACGCAGCGGCGCAAAGGCAGCTGGGCCGCCTGTGGCATACAAGTTCTGTC
TTCTTCCACCCTCTGATCCACGAATATGCAGAGAAGCTTTCAGCACTTCTTCCTGAGCCT
TTGAAGGTCGTTTTCTTGGTGAACAGTGGTTCAGAAGCCAATGACCTAGCCATGCTGATG
GCCAGAGCACACTCAAACAGCACAGACATCATTTCTTTCAGAGGAGCCTACCATGGATGC
AGTCCTTACACACTTGGCTTGACAAATGTAGGCATCTATAAGATGGACCTCCCTCATGGG
ATGGGCTGCCAACCAACAATGTGCCCAGACATTTTCCATGGCCCTTGGGGAGGAAGCCAC
TGCCGAGATTCTCCAGTGCAAACAATTAGGAAGTGCAGCTGTGCGCCAGACTGCTGTCAA
GCTAAAGACCAGTATATTGAACAATTCAAAGATACTCTGAGCACTTCTGTGGCCAAATCA
ATTGCTGGATTTTTTGCAGAGCCAATTCAAGGGGTGAATGGCGTTGTTCAGTACCCGAAG
GGGTTTCTAAAGGAAGCCTTCGAGCTGGTGCGCGAGCGGGGAGGCGTGTGCATTGCAGAT
GAAGTGCAGACAGGATTTGGAAGGCTGGGCTCTCACTTCTGGGGCTTCCAAACACACGAT
GTCCTGCCAGATATTGTTACCATGGCTAAAGGGATTGGGAATGGCTTTCCCATGGCAGCA
GTCGTGACAACTCCAGATATTGCCAAGTCCTTAACCAAGCGCATGCTTCACTTCAATACC
TTTGGAGGGAACCCCATGGCCTGCGCCGTTGGTTCAGCAGTGCTTGAGGTGATTAAAGAA
GAAAATCTACAAGAAAATAGCCAAGAAGTTGGCACCTATATGTTGCTGAAGTTGGCTAAG
CTGCGGGATGAATTTGAAATTGTAGGAGATGTCCGAGGCAAAGGTCTCATGATAGGAATA
GAAATGGTGAAGGATAAGGAGAGCCGCCAGCCTCTTCCCCGTGAAGAAGTAAATCAAATC
CACCACGACTGCAAATGCATGGGGCTTCTGATTGGCAGAGGCGGCCTTTTCTCTCAGACT
TTCCGCATTGCGCCCTCAATGTGCATCACTAAACCAGAAGTTGATTTTGCAGTGGAAGTG
TTTCGCTCTGCCTTAATTCAACACATGGAGAGAAGAGCTAAATAA
Enzyme 2 GenBank Gene ID BC118402 Link Image
Enzyme 2 GeneCard ID AGXT2 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:5
Enzyme 2 Locus 5p13
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available