We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Gamma-Aminobutyric acid (BMDB00112)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-07-05 13:30:42
Accession Number BMDB00112
Common Name Gamma-Aminobutyric acid
Description Gamma-aminobutyric acid (GABA) is an inhibitory neurotransmitter found in the nervous systems of widely divergent species. It is the chief inhibitory neurotransmitter in the vertebrate central nervous system. In vertebrates, GABA acts at inhibitory synapses in the brain. GABA acts by binding to specific transmembrane receptors in the plasma membrane of both pre- and postsynaptic neurons. This binding causes the opening of ion channels to allow either the flow of negatively-charged chloride ions into the cell or positively-charged potassium ions out of the cell. This will typically result in a negative change in the transmembrane potential, usually causing hyperpolarization. Three general classes of GABA receptor are known. These include GABAA and GABAC ionotropic receptors, which are ion channels themselves, and GABAB metabotropic receptors, which are G protein-coupled receptors that open ion channels via intermediaries (G proteins). Neurons that produce GABA as their output are called GABAergic neurons, and have chiefly inhibitory action at receptors in the vertebrate. Medium Spiny Cells are a typical example of inhibitory CNS GABAergic cells. GABA exhibits excitatory actions in insects, mediating muscle activation at synapses between nerves and muscle cells and also the stimulation of certain glands. GABA has also been shown to have excitatory roles in the vertebrate, most notably in the developing cortex. Organisms synthesize GABA from glutamate using the enzyme L-glutamic acid decarboxylase and pyridoxal phosphate as a cofactor. It is worth noting that this involves converting the principal excitatory neurotransmitter (glutamate) into the principal inhibitory one (GABA). Drugs that act as agonists of GABA receptors (known as GABA analogues or GABAergic drugs) or increase the available amount of GABA typically have relaxing, anti-anxiety and anti-convulsive effects. (http://en.wikipedia.org/wiki/GABA) Doses of GABA 1 to 3 g orally also have been used effectively to raise the IQ of mentally retarded persons. GABA is found to be deficient in cerebrospinal fluid and brain in many studies of experimental and human epilepsy. Benzodiazepines (such as Valium) are useful in status epilepticus because they act on GABA receptors. GABA increases in the brain after administration of many seizure medications. Hence, GABA is clearly an antiepileptic nutrient. Inhibitors of GAM metabolism can also produce convulsions. Spasticity and involuntary movement syndromes, e.g., Parkinson's, Friedreich's ataxia, tardive dyskinesia, and Huntington's chorea are all marked by low GABA when amino acid levels are studied. Trials of 2 to 3 g of GABA given orally have been effective in various epilepsy and spasticity syndromes. Agents that elevate GABA also are useful in lowering hypertension. Three grams orally have been effective in control of blood pressure. GABA is decreased in various encephalopathies. GABA can reduce appetite and is decreased in hypoglycemics. GABA reduces blood sugar in diabetics. Chronic brain syndromes can also be marked by deficiency of GABA; GABA has many promising uses in therapy. Cerebrospinal fluid levels of GABA may be useful in diagnosing very serious diseases. Vitamin B6, manganese, taurine and lysine can increase both GABA synthesis and effects, while aspartic acid and glutamic acid probably inhibit GABA effects. (http://www.dcnutrition.com/AminoAcids/Detail.CFM)The brain's principal inhibitory neurotransmitter, GABA, along with serotonin and norepinephrine, is one of several neurotransmitters that appear to be involved in the pathogenesis of anxiety and mood disorders. There are two principal subtypes of postsynaptic GABA receptor complexes, the GABA-A and GABA-B receptor complexes. Activation of the GABA-B receptor by GABA causes neuronal membrane hyperpolarization and a resultant inhibition of neurotransmitter release. In addition to binding sites for GABA, the GABA-A receptor has binding sites for benzodiazepines, barbiturates, and neurosteroids. GABA-A receptors are coupled to chloride ion channels; activation of the receptor induces increased inward chloride ion flux, resulting in membrane hyperpolarization and neuronal inhibition. After release into the synapse, free GABA that does not bind to either the GABA-A or GABA-B receptor complexes can be taken up by neurons and glial cells. Four different membrane transporter proteins, known as GAT-1, GAT-2, GAT-3, and BGT-1, which differ in their distribution in the CNS, are believed to mediate the uptake of synaptic GABA into neurons and glial cells. The GABA-A receptor subtype regulates neuronal excitability and rapid changes in fear arousal, such as anxiety, panic, and the acute stress response. Drugs that stimulate GABA-A receptors, such as the benzodiazepines and barbiturates, have anxiolytic and anti-seizure effects via GABA-A-mediated reduction of neuronal excitability, which effectively raises the seizure threshold. In support of the anticonvulsant and anxiolytic effects of the GABA-A receptor are findings that GABA-A antagonists produce convulsions in animals and the demonstration that there is decreased GABA-A receptor binding in a positron emission tomography (PET) study of patients with panic disorder. Low plasma GABA has been reported in some depressed patients and, in fact, may be a useful trait marker for mood disorders. (The Role Of GABA In The Pathogenesis And Treatment Of Anxiety And Other Neuropsychiatric Disorders: http://www.vcu-cme.org/gaba/overview.html)
Synonyms
  1. 3-Carboxypropylamine
  2. 4-Aminobutanoate
  3. 4-Aminobutanoic acid
  4. 4-Aminobutyrate
  5. 4-Aminobutyric acid
  6. Aminalon
  7. GABA
  8. Gaballon
  9. Gamarex
  10. Gamma aminobutyrate
  11. Gamma aminobutyric acid
  12. Gamma-aminobutyrate
  13. Gamma-aminobutyric acid
  14. Gammalon
  15. Gammalone
  16. Gammar
  17. Gammasol
  18. Mielogen
  19. Mielomade
  20. Piperidate
  21. Piperidic acid
  22. Piperidinate
  23. Piperidinic acid
  24. w-Aminobutyrate
  25. w-Aminobutyric acid
  26. omega-Aminobutyrate
  27. omega-Aminobutyric acid
Chemical IUPAC Name 4-amino-Butanoic acid
Chemical Formula C4H9NO2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Amino Acids
Sub Class
  • NA
Family
  • Mammalian_Metabolite
Species
  • primary amine; primary aliphatic amine (alkylamine); carboxylic acid
Biofunction
  • Component of Alanine and aspartate metabolism; Component of beta-Alanine metabolism; Component of Butanoate metabolism; Component of Glutamate metabolism; Component of Taurine and hypotaurine metabolism
Application
Source
  • Endogenous
Average Molecular Weight 103.120
Monoisotopic Molecular Weight 103.063332
Isomeric SMILES NCCCC(O)=O
Canonical SMILES NCCCC(O)=O
KEGG Compound ID C00334 Link Image
BioCyc ID 4-AMINO-BUTYRATE Link Image
BiGG ID 34652 Link Image
Wikipedia Link GABA Link Image
METLIN ID Not Available
PubChem Compound 119 Link Image
PubChem Substance 11335791 Link Image
ChEBI ID 16865 Link Image
CAS Registry Number 56-12-2
InChI Identifier InChI=1/C4H9NO2/c5-3-1-2-4(6)7/h1-3,5H2,(H,6,7)
Synthesis Reference Minoshima, Ryoichi. Preparation of gamma-aminobutyric acid with unripened beans. PCT Int. Appl. (2007), 25pp.
Melting Point (Experimental) 203 oC
Experimental Water Solubility 1300.0 mg/mL [YALKOWSKY,SH & DANNENFELSER,RM (1992)] Source: PhysProp
Predicted Water Solubility 365.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity -3.17 [HANSCH,C ET AL. (1995)] Source: PhysProp
Predicted LogP/Hydrophobicity -2.99 [Predicted by ALOGPS]; -0.7 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
  • Extracellular
  • lysosome
  • mitochondria
Biofluid Location Not Available
Tissue Location
Tissue References
Adrenal Cortex
Brain
Epidermis
Fibroblasts
Hippocampus
Kidney
Muscle
Nerve Cells
Neuron
Spleen
Testes
Concentrations (Normal) Not Available
Concentrations (Abnormal) Not Available
Pathway Names
  • Beta Alanine Metabolism
  • Butyrate Metabolism
  • Glutamate Metabolism
  • Urea Cycle and Metabolism of Amino Groups
HMDB Pathways
Name Beta Alanine Metabolism
Image Show Link Image
Name Butyrate Metabolism
Image Show Link Image
Name Glutamate Metabolism
Image Show Link Image
Name Urea Cycle and Metabolism of Amino Groups
Image Show Link Image
KEGG Pathways
Name Beta Alanine Metabolism
Image Show Link Image
Name Butyrate Metabolism
Image Show Link Image
Name Glutamate Metabolism
Image Show Link Image
Name Urea Cycle and Metabolism of Amino Groups
Image Show Link Image
SimCell Pathways
Name Beta Alanine Metabolism
Image Show Link Image
Graph
SBML
Name Butyrate Metabolism
Image Show Link Image
Graph
SBML
Name Urea Cycle and Metabolism of Amino Groups
Image Show Link Image
Graph Show Link Image
SBML Download (XML) Link Image
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. 4-aminobutyrate aminotransferase, mitochondrial
  2. Glutamate decarboxylase 1
  3. Gamma-aminobutyric acid receptor-associated protein-like 2
  4. Gamma-aminobutyric acid (GABA) A receptor, beta 3
  5. Gamma-aminobutyric acid (GABA) A receptor, delta
  6. Gamma-aminobutyric acid receptor subunit beta-2
  7. Gamma-aminobutyric acid receptor subunit pi
  8. Gamma-aminobutyric acid receptor subunit alpha-5
  9. Gamma-aminobutyric acid receptor subunit beta-1
  10. Gamma-aminobutyric acid receptor subunit alpha-4
  11. Gamma-aminobutyric acid receptor subunit gamma-2
  12. Gamma-aminobutyric acid receptor subunit alpha-3
  13. Gamma-aminobutyric acid receptor subunit alpha-2
  14. Gamma-aminobutyric acid receptor subunit rho-2
  15. Gamma-aminobutyric acid receptor subunit alpha-1
  16. Lin-7 homolog C
  17. Lin-7 homolog B
  18. Lin-7 homolog A
  19. Gamma-aminobutyric acid receptor-associated protein
  20. Gamma-aminobutyric acid receptor-associated protein-like 1
  21. Acyl-CoA-binding protein
  22. Sodium- and chloride-dependent GABA transporter 2
Enzyme 1 [top]
Enzyme 1 ID 596
Enzyme 1 Name 4-aminobutyrate aminotransferase, mitochondrial
Enzyme 1 Synonyms
  1. Gamma-amino-N-butyrate transaminase
  2. GABA transaminase
  3. GABA-T
  4. GABA aminotransferase
  5. GABA-AT
  6. L-AIBAT
  7. (S)-3-amino-2-methylpropionate transaminase
Enzyme 1 Gene Name ABAT
Enzyme 1 Protein Sequence >4-aminobutyrate aminotransferase, mitochondrial
MASMLVAQRLACSFQHSYRLLVPGSRHISQAAAKVDVEFDYDGRLMKTEVPGLRCQELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYSHPGLLKLIQQPQ
NASMFVNRPALGILLPENFVEKLRQSLLSVAPKGMSQLITMACGSCSNENGLKTIFMWYR
SKERGQRGFPQEELETCMINQAPWCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKKTVAGIIVEPIQSEGG
DNHASDDFFRKLRDIPRKQCCAFLVDVVQTGGGCTGKFWAHEHWARDDPEDVMTSSKKMM
TGGFFHKEEFRPNAPYRIFNTWLGDPSKNLLLAEVINIIKREDLLNNAAHAGKALLTGLL
DLQARYPQFISRVRGRGTFCSFDTPDDSIRNKLILIARNKGVVLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
Enzyme 1 Number of Residues 500
Enzyme 1 Molecular Weight 56730.9
Enzyme 1 Theoretical pI 8.21
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Amino acid transport and metabolism
Enzyme 1 Specific Function Catalyzes the conversion of gamma-aminobutyrate and L- beta-aminoisobutyrate to succinate semialdehyde and methylmalonate semialdehyde, respectively. Can also convert delta-aminovalerate and beta-alanine
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 12584862 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q9BGI0 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name GABT_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1503 bp
ATGGCGTCCATGTTGGTCGCCCAGCGCCTGGCCTGCAGCTTCCAGCACAGCTACCGCCTG
CTGGTGCCTGGATCCAGACACATTAGTCAAGCTGCAGCCAAAGTCGACGTTGAATTTGAT
TATGATGGGCGTCTGATGAAGACGGAAGTCCCAGGGCTTAGATGTCAGGAGTTAATGAAA
CAGCTGAATATAATTCAGAATGCAGAGGCTGTGCATTTTTTCTGCAATTACGAAGAGAGC
CGAGGCAATTACCTGGTTGATGTGGACGGCAACCGAATGCTGGATCTTTATTCCCAGATC
TCCTCTGTCCCCATAGGTTACAGCCACCCCGGCCTGCTGAAACTCATCCAACAGCCTCAA
AATGCGAGCATGTTTGTCAACAGACCCGCCCTCGGAATCCTGCTTCCGGAGAACTTTGTG
GAGAAGCTCCGGCAGTCCTTGCTCTCGGTGGCTCCCAAAGGGATGTCCCAGCTCATCACC
ATGGCCTGCGGCTCCTGCTCCAATGAAAACGGCTTAAAGACCATCTTCATGTGGTACCGG
AGCAAGGAAAGAGGGCAGAGGGGCTTCCCCCAAGAGGAGCTGGAGACGTGCATGATTAAC
CAGGCCCCCTGGTGCCCCGACTACAGCATCCTCTCCTTCATGGGCGCGTTCCATGGGAGG
ACCATGGGTTGCTTAGCGACCACGCACTCTAAAGCCATTCACAAGATCGACATCCCTTCC
TTTGACTGGCCCATCGCACCGTTCCCACGGCTGAAATACCCTCTGGAAGAGTTTGTGAAA
GAGAACCAACAGGAGGAGGCCCGCTGTCTGGAAGAGGTGGAGGATCTGATTGTGAAATAT
CGGAAAAAGAAGAAGACGGTGGCCGGGATCATCGTGGAGCCCATCCAGTCCGAGGGTGGA
GACAACCACGCATCCGATGACTTCTTTCGGAAGCTGAGAGACATCCCCAGGAAGCAATGC
TGCGCCTTCTTGGTGGACGTGGTCCAGACCGGAGGAGGCTGCACGGGCAAGTTCTGGGCC
CACGAGCACTGGGCCCGGGATGACCCAGAAGACGTGATGACCTCCAGCAAGAAGATGATG
ACTGGGGGCTTCTTCCACAAGGAGGAGTTCAGGCCTAATGCTCCCTACCGGATCTTCAAC
ACCTGGCTGGGGGACCCGTCCAAGAACCTGTTGCTGGCTGAGGTCATCAACATCATCAAG
CGGGAGGACCTGCTAAATAATGCAGCCCATGCCGGGAAGGCCCTGCTCACAGGACTGCTG
GACCTCCAGGCCCGGTACCCCCAGTTCATCAGCAGGGTGAGAGGACGAGGCACCTTTTGC
TCCTTCGATACTCCCGATGATTCCATACGGAATAAGCTCATTTTAATTGCCAGAAACAAA
GGTGTGGTGTTGGGTGGCTGTGGTGACAAATCCATTCGTTTCCGTCCCACGCTGGTGTTC
AGGGATCACCACGCACACCTGTTCCTCAATATTTTCAGTGACATCTTAGCAGACTTCAAG
TAA
Enzyme 1 GenBank Gene ID AF305692 Link Image
Enzyme 1 GeneCard ID ABAT Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 16p13.2
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 862
Enzyme 2 Name Glutamate decarboxylase 1
Enzyme 2 Synonyms Not Available
Enzyme 2 Gene Name GAD1
Enzyme 2 Protein Sequence >Glutamate decarboxylase 1
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDKDGRFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARFKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLETKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSQKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
Enzyme 2 Number of Residues 594
Enzyme 2 Molecular Weight 66783.9
Enzyme 2 Theoretical pI 7.18
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Amino acid transport and metabolism
Enzyme 2 Specific Function Catalyzes the production of GABA
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 111305189 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q0VCA1 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name DCE1_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1785 bp
ATGGCGTCTTCGACCCCTTCTTCGTCCGCAACCTCCTCGAACGCGGGAGCGGACCCCAAT
ACTACCAACCTGCGCCCCACAACGTATGACACCTGGTGCGGCGTGGCCCATGGATGCACC
AGAAAACTGGGGCTGAAGATCTGCGGCTTCTTGCAGAGGACCAACAGCCTGGAAGAGAAG
AGCAGGCTTGTGAGCGCCTTCAAGGAGAGGCAGTCCTCCAAGAACCTGCTTTCCTGTGAA
AACAGTGACAAGGATGGCCGCTTCCGCCGCACAGAGACAGACTTCTCCAACCTGTTCGCC
CGAGATCTGCTTCCGGCTAAGAACGGGGAGGAGCAAACTGTGCAATTCCTGTTGGAGGTG
GTAGACATACTCCTCAACTATGTCCGGAAGACGTTCGATCGCTCCACCAAAGTGCTGGAC
TTCCACCACCCCCACCAGCTGCTGGAAGGCATGGAGGGCTTCAACTTGGAACTCTCTGAC
CACCCCGAGTCCCTGGAGCAGATCCTGGTTGACTGCAGAGACACCCTGAAATATGGGGTC
CGCACAGGTCATCCACGATTTTTCAACCAGCTCTCCACAGGATTGGATATCATTGGTTTA
GCTGGCGAGTGGCTGACATCAACTGCCAATACCAATATGTTTACATATGAAATTGCACCA
GTGTTTGTCCTCATGGAGCAAATAACACTTAAGAAGATGAGAGAGATAGTTGGATGGTCA
AGTAAAGATGGTGATGGGATATTTTCTCCTGGGGGAGCCATATCCAACATGTACAGCATC
ATGGCTGCTCGCTTCAAGTACTTCCCGGAAGTTAAGACCAAGGGTATGGCGGCTGTGCCC
AAGCTTGTCCTCTTCACCTCAGAACACAGTCACTATTCCATAAAGAAAGCTGGGGCTGCA
CTTGGCTTTGGAACCGACAACGTGATTTTGATAAAGTGCAATGAAAGGGGGAAGATAATT
CCAGCTGATTTAGAGACAAAAATTCTTGAAGCCAAGCAAAAGGGTTACGTCCCTCTCTAC
GTCAATGCAACTGCTGGCACCACTGTTTATGGCGCTTTTGATCCGATACAGGAGATTGCA
GATATATGTGAGAAATACAACCTTTGGCTGCATGTCGATGCTGCCTGGGGTGGCGGGCTG
CTCATGTCCCAGAAGCACCGCCATAAGCTCAGTGGCATCGAGAGGGCCAACTCTGTCACC
TGGAACCCTCACAAGATGATGGGTGTGCTGCTGCAGTGCTCTGCCATTCTTGTAAAAGAA
AAGGGTATCCTCCAAGGATGCAACCAGATGTGTGCGGGATACCTCTTCCAGCCGGACAAG
CAGTATGATGTCTCCTATGACACTGGGGACAAGGCCATTCAGTGTGGCCGCCACGTAGAC
ATCTTCAAGTTCTGGCTGATGTGGAAAGCAAAGGGTACAGTGGGCTTTGAAAATCAGATC
AACAAATGCTTGGAACTGGCTGAATACCTCTATGCCAAGATTAAAAACAGAGAAGAATTT
GAGATGGTTTTTGATGGTGAGCCTGAGCATACGAACGTCTGTTTCTGGTATATTCCACAA
AGCCTCAGGGGTGTTCCAGATAGCCCCGAACGACGGGAAAAGCTACACAGGGTGGCCCCA
AAGATCAAAGCCCTGATGATGGAATCTGGCACAACCATGGTTGGCTACCAGCCTCAGGGG
GACAAGGCCAACTTCTTCCGGATGGTCATCTCCAACCCAGCCGCTACCCAATCTGATATT
GACTTCCTCATTGAGGAGATAGAGAGGCTGGGCCAGGATCTGTAA
Enzyme 2 GenBank Gene ID BC120278 Link Image
Enzyme 2 GeneCard ID GAD1 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:2
Enzyme 2 Locus 2q31
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 950
Enzyme 3 Name Gamma-aminobutyric acid receptor-associated protein-like 2
Enzyme 3 Synonyms
  1. GABA(A) receptor-associated protein-like 2
  2. Golgi-associated ATPase enhancer of 16 kDa
  3. GATE-16
  4. General protein transport factor p16
  5. Ganglioside expression factor 2
  6. GEF-2
  7. MAP1 light chain 3-related protein
Enzyme 3 Gene Name GABARAPL2
Enzyme 3 Protein Sequence >Gamma-aminobutyric acid receptor-associated protein-like 2
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Enzyme 3 Number of Residues 117
Enzyme 3 Molecular Weight 13666.7
Enzyme 3 Theoretical pI 8.43
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Involved in ATPase binding
Enzyme 3 Specific Function Involved in intra-Golgi traffic. Modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. It first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 4433387 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID P60519 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name GBRL2_BOVIN Link Image
Enzyme 3 PDB ID 1EO6 Link Image
Enzyme 3 PDB File Show
Enzyme 3 3D Structure
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >354 bp
ATGAAGTGGATGTTCAAGGAGGACCACTCGCTGGAACACAGATGCGTGGAATCTGCGAAG
ATCAGAGCGAAATACCCCGACCGGGTTCCGGTGATTGTGGAAAAGGTCTCAGGCTCTCAG
ATTGTTGACATTGACAAACGGAAGTATCTGGTTCCATCCGACATCACTGTGGCTCAGTTC
ATGTGGATCATCAGGAAAAGGATCCAGCTTCCTTCTGAAAAGGCGATCTTCCTGTTTGTG
GATAAGACAGTCCCTCAGTCCAGCCTAACTATGGGACAGCTTTACGAGAAGGAAAAAGAT
GAAGATGGATTCTTGTACGTGGCCTACAGTGGCGAGAACACTTTCGGCTTCTGA
Enzyme 3 GenBank Gene ID AF020262 Link Image
Enzyme 3 GeneCard ID GABARAPL2 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 16q22.3-q24.1
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 1671
Enzyme 4 Name Gamma-aminobutyric acid (GABA) A receptor, beta 3
Enzyme 4 Synonyms Not Available
Enzyme 4 Gene Name GABRB3
Enzyme 4 Protein Sequence >Gamma-aminobutyric acid (GABA) A receptor, beta 3
FVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDI
EFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQ
TYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMY
LMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKNAKAKNDRSKGDSNRVDAHGNILL
TSLEVHNEMNEVAGGVGDTRNSARSFDNSGIQYRKQSMPREGHGRHMDRSVPHKKTHLRR
RSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN
Enzyme 4 Number of Residues 343
Enzyme 4 Molecular Weight 39558.3
Enzyme 4 Theoretical pI 10.02
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in extracellular ligand-gated ion channel acti
Enzyme 4 Specific Function Not Available
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 120419440 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID A1L501 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name A1L501_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence Not Available
Enzyme 4 GenBank Gene ID BT029788 Link Image
Enzyme 4 GeneCard ID GABRB3 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 15q11.2-q12
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 1723
Enzyme 5 Name Gamma-aminobutyric acid (GABA) A receptor, delta
Enzyme 5 Synonyms Not Available
Enzyme 5 Gene Name GABRD
Enzyme 5 Protein Sequence >Gamma-aminobutyric acid (GABA) A receptor, delta
MDELAWLLPPLLLLCAQHRGARAMNDIGDYVGSNLEISWLPNLDGLIEGYARNFRPGIGG
PAVNVALAIEVASIDHISEVNMEYTMTVFLHQSWRDSRLSYNHTNETLGLDSRFVDKLWL
PDTFIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITSTVACDMDLAKYPMDEQECMLH
LESYGYSSEDIVYYWSENQEQIHGLDKLQLAQFTITSYRFTTELMNFKSAGQFPRLSLHF
HLRRNRGVYIIQSYMPSVLLVAMSWVSFWISQAAVPARVSLGITTVLTMTTLMVSARSSL
PRASAIKALDVYFWICYVFVFAALVEYAFAHFNADYRKKQKAKAKAKVKVKEQRAEMDVK
NAIVLFSLSAAGVTQELAVSRRPCRLPGNLMGSYRSVEVETGETKKQGSQGGLRGLLKPI
DADTIDIYARAVFPAAFAAVNVIYWAAYTM
Enzyme 5 Number of Residues 450
Enzyme 5 Molecular Weight 50739.0
Enzyme 5 Theoretical pI 7.61
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Involved in extracellular ligand-gated ion channel acti
Enzyme 5 Specific Function Not Available
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 126010643 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID A2VE38 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name A2VE38_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >1353 bp
ATGGACGAGCTGGCCTGGCTGCTGCCCCCGCTCCTGCTGCTCTGCGCGCAGCACCGCGGC
GCCAGGGCAATGAATGACATTGGCGACTATGTTGGCTCCAACCTGGAGATATCCTGGCTC
CCCAACCTGGACGGCCTGATAGAAGGCTACGCTCGCAACTTTCGGCCCGGCATTGGAGGC
CCCGCTGTGAACGTGGCGCTCGCCATCGAGGTGGCCAGCATTGACCACATCTCGGAGGTG
AACATGGAGTACACCATGACAGTGTTCCTGCACCAGAGCTGGCGCGACAGCAGGCTGTCC
TACAACCACACCAATGAGACCCTGGGCTTGGACAGCCGCTTCGTGGACAAGCTGTGGCTC
CCGGACACCTTCATCGTGAACGCCAAGTCTGCCTGGTTCCACGATGTGACAGTGGAGAAC
AAGCTCATCCGGCTGCAGCCTGACGGGGTGATTCTCTACAGCATCCGAATCACGTCCACG
GTGGCCTGCGACATGGACCTGGCCAAGTATCCCATGGATGAACAGGAGTGCATGCTGCAC
CTGGAGAGTTACGGCTACTCATCCGAGGACATCGTCTACTACTGGTCCGAGAACCAGGAG
CAGATCCACGGGCTGGACAAGCTGCAGCTGGCCCAGTTCACCATCACCAGCTACCGCTTC
ACCACAGAGCTGATGAACTTCAAGTCGGCCGGCCAGTTCCCCCGACTCAGCTTGCACTTC
CACCTGCGGAGGAACCGCGGCGTCTACATCATCCAGTCCTACATGCCCTCCGTCCTCCTA
GTCGCCATGTCCTGGGTCTCCTTCTGGATCAGCCAGGCAGCAGTGCCCGCCAGGGTGTCT
CTAGGCATCACCACAGTGCTGACCATGACCACGCTGATGGTCAGTGCCCGCTCCTCCCTC
CCACGGGCATCGGCCATCAAGGCATTGGATGTGTACTTCTGGATCTGCTATGTCTTTGTG
TTCGCCGCCCTGGTGGAGTATGCCTTTGCCCACTTCAATGCTGACTACCGGAAGAAACAG
AAGGCCAAGGCCAAGGCCAAGGTCAAGGTTAAGGAGCAGAGGGCTGAGATGGACGTGAAG
AATGCCATTGTGCTCTTCTCTCTCTCCGCTGCGGGCGTTACTCAGGAGCTAGCTGTGTCC
CGCCGGCCATGCCGCTTGCCCGGGAACCTCATGGGCTCCTACAGGTCTGTGGAGGTGGAG
ACAGGGGAGACAAAGAAGCAGGGGAGCCAGGGGGGCCTCCGTGGGCTTCTCAAGCCCATC
GACGCGGACACCATTGACATCTATGCCCGTGCTGTGTTCCCCGCGGCCTTTGCCGCCGTC
AACGTCATCTACTGGGCCGCATACACCATGTGA
Enzyme 5 GenBank Gene ID BC133557 Link Image
Enzyme 5 GeneCard ID GABRD Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:1
Enzyme 5 Locus 1p|1p36.3
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References Not Available
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 1836
Enzyme 6 Name Gamma-aminobutyric acid receptor subunit beta-2
Enzyme 6 Synonyms
  1. GABA(A) receptor subunit beta-2
  2. Fragment
Enzyme 6 Gene Name GABRB2
Enzyme 6 Protein Sequence >Gamma-aminobutyric acid receptor subunit beta-2
RVRKKDYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPVAV
GMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDTYF
LNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTTACMMDLRRYPLDEQNCTLEIESYG
YTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKRNI
GYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIPYV
KAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAASANNEKMRLDVNKMDP
HENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFWRNALERHV
AQKKSRLRERASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN
Enzyme 6 Number of Residues 472
Enzyme 6 Molecular Weight 54450.6
Enzyme 6 Theoretical pI 9.44
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Involved in chloride channel activity
Enzyme 6 Specific Function GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • 1-23
Enzyme 6 Transmembrane Regions
  • 240-260 271-290 309-329 451-471
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein Not Available
Enzyme 6 UniProtKB/Swiss-Prot ID P0C2W5 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name GBRB2_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence Not Available
Enzyme 6 GenBank Gene ID Not Available
Enzyme 6 GeneCard ID GABRB2 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:5
Enzyme 6 Locus 5q34
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References
  1. [PubMed Link Image]
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 1837
Enzyme 7 Name Gamma-aminobutyric acid receptor subunit pi
Enzyme 7 Synonyms
  1. GABA(A) receptor subunit pi
Enzyme 7 Gene Name GABRP
Enzyme 7 Protein Sequence >Gamma-aminobutyric acid receptor subunit pi
MKRSLHLTFVCLSLFSARMCVQGNQFNIEVSRSNKLSLPGFENLTAGYNKFLRPNFGGEP
VQIALTLDVASISSISESNMDYTATIYLRQRWTDQRLVFEGNKSFTLDARLVEFLWVPDT
YIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVACNMDLSKYPMDTQTCKLQLES
WGYDGNDVEFSWLRGNDSVRGLENLRLAQYTIQQYFTSVTRSQQETGNYTRLVLQFELQR
NVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVTTVLSMTTLMIGSRTSLPNTN
CFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAAKDRGKAKEVEEVNITNIINSSIS
SFKRKISFASIEISGDNVDYSDLTMKTSDKVKFVFRDKLGRIVDYFTIQNPSNVDRYSKL
LFPLIFMLANVFYWAYYMYF
Enzyme 7 Number of Residues 440
Enzyme 7 Molecular Weight 50429.5
Enzyme 7 Theoretical pI 8.41
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Involved in chloride channel activity
Enzyme 7 Specific Function GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel. In the uterus, the function of the receptor appears to be related to tissue contractility. The binding of this pI subunit with other GABA(A) receptor subunits alters the sensitivity of recombinant receptors to modulatory agents such as pregnanolone
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • 1-16
Enzyme 7 Transmembrane Regions
  • 243-266 270-292 305-327 417-438
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 59857891 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q5EA06 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name GBRP_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >1323 bp
ATGAAGCGCAGTCTCCACCTGACCTTCGTGTGTCTGAGTCTCTTCTCTGCACGGATGTGC
GTCCAGGGGAATCAGTTTAACATCGAGGTCAGCAGAAGCAACAAGCTGTCCCTGCCTGGC
TTTGAGAATCTCACAGCAGGATATAACAAGTTTCTCAGGCCCAATTTTGGCGGAGAACCT
GTTCAGATAGCACTGACTCTGGACGTTGCAAGTATTTCCAGTATTTCAGAGAGTAATATG
GACTACACAGCCACCATATACCTCAGACAGCGCTGGACGGACCAGCGGCTGGTGTTTGAA
GGCAACAAGAGCTTCACTCTGGATGCACGCCTAGTGGAATTCCTCTGGGTGCCAGACACC
TACATCGTGGAGTCCAAGAAGTCCTTCCTCCATGAAGTCACTGTGGGGAACAGACTTATC
CGCCTCTTCTCCAATGGCACAGTCCTGTATGCCCTCAGAATCACAACAACTGTTGCATGT
AACATGGACCTGTCTAAATACCCCATGGACACACAGACATGCAAGTTGCAACTAGAGAGC
TGGGGCTACGATGGGAATGACGTAGAGTTCAGCTGGCTGAGAGGGAACGACTCTGTGCGG
GGACTGGAGAACCTGCGGCTTGCTCAGTACACCATACAACAATATTTCACCTCAGTTACC
AGATCACAGCAGGAAACAGGAAATTACACACGACTGGTCTTGCAATTTGAGCTTCAGAGG
AACGTCCTGTATTTCATTTTGGAAACCTATGTTCCTTCCACTTTCCTGGTGGTGTTATCC
TGGGTCTCGTTTTGGATCTCCCTTGACTCAGTTCCTGCAAGAACCTGCATTGGAGTGACC
ACCGTATTGTCAATGACCACACTGATGATTGGGTCCCGTACTTCTCTCCCGAACACCAAC
TGCTTCATAAAGGCCATCGATGTGTACCTGGGAATATGCTTTAGCTTCGTGTTTGGGGCC
CTCCTGGAATATGCAGTTGCCCACTACAGCTCCTTACAGCAGATGGCAGCCAAAGATCGG
GGGAAAGCAAAGGAAGTGGAAGAAGTCAACATTACTAACATCATCAACAGCTCCATCTCC
AGCTTTAAACGGAAGATCAGTTTTGCCAGCATTGAAATTTCCGGAGATAACGTTGACTAC
AGCGACCTGACAATGAAAACCAGTGACAAGGTCAAGTTTGTCTTCCGAGATAAGTTGGGC
AGGATTGTTGATTATTTCACAATTCAAAACCCGAGTAATGTTGATCGATATTCCAAACTA
CTATTTCCTTTGATTTTTATGCTAGCCAATGTATTTTACTGGGCATACTATATGTATTTC
TGA
Enzyme 7 GenBank Gene ID BT020763 Link Image
Enzyme 7 GeneCard ID GABRP Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:5
Enzyme 7 Locus 5q33-q34
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References
  1. [PubMed Link Image]
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 1852
Enzyme 8 Name Gamma-aminobutyric acid receptor subunit alpha-5
Enzyme 8 Synonyms
  1. GABA(A) receptor subunit alpha-5
Enzyme 8 Gene Name GABRA5
Enzyme 8 Protein Sequence >Gamma-aminobutyric acid receptor subunit alpha-5
MDNGMFSSFIMIKNLLLFCISMNLASHFGFSQMPTSSVKAETDDNITIFTRILDGLLDGY
DNRLRPGLGERITQVRTDIYVTSFGPVSDTEMEYTIDVFFRQSWKDERLRFKGPMQRLPL
NNLLASKIWTPDTFFHNGKKSIAHNMTTPNKLLRLEDDGTLLYTMRLTISAECPMQLEDF
PMDAHACPLKFGSYAYPNSEVIYVWTNGTAKSVVVAEDGSRLNQYHLMGQTVGTENISTS
TGEYTIMTAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTM
TTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKKALEAA
KIKKKERELTINKSTNAYTTGKMTHPPNIPKEQTPAGTTNASSASVKPEDKASENKKTYN
SISKIDKMSRIIFPLLFGTFNLVYWATYLNREPVIKGATSPK
Enzyme 8 Number of Residues 462
Enzyme 8 Molecular Weight 52171.6
Enzyme 8 Theoretical pI 9.45
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Involved in chloride channel activity
Enzyme 8 Specific Function GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel
Enzyme 8 Pathways Not Available
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • 1-31
Enzyme 8 Transmembrane Regions
  • 260-281 286-307 319-341 428-449
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 115304763 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID Q08E50 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name GBRA5_BOVIN Link Image
Enzyme 8 PDB ID Not Available
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence >1389 bp
ATGGACAATGGAATGTTCTCTAGCTTTATCATGATCAAAAACCTCCTTCTCTTTTGTATT
TCCATGAACTTAGCCAGTCACTTTGGCTTTTCACAAATGCCAACCAGCTCTGTAAAAGCT
GAGACCGATGACAACATCACGATATTCACCAGGATCCTGGATGGGCTGCTGGACGGTTAC
GACAACAGACTGAGGCCCGGGCTCGGAGAGCGTATCACTCAGGTGAGAACGGACATCTAC
GTCACCAGCTTCGGCCCCGTGTCCGACACGGAGATGGAATATACCATCGACGTATTTTTC
CGACAAAGCTGGAAAGACGAAAGGCTTCGGTTTAAAGGGCCCATGCAGCGCCTTCCACTC
AACAATCTCCTCGCCAGCAAAATTTGGACTCCAGACACGTTCTTCCACAACGGGAAGAAG
TCCATCGCCCACAACATGACCACGCCCAACAAGCTGCTGCGTCTGGAGGACGACGGCACG
CTGCTGTACACCATGCGCTTGACCATCTCTGCAGAGTGCCCAATGCAACTTGAAGACTTT
CCAATGGATGCCCATGCCTGCCCTCTGAAATTTGGCAGCTACGCATATCCTAATTCCGAA
GTCATCTATGTCTGGACCAACGGCACCGCCAAGTCAGTGGTGGTGGCAGAAGATGGCTCC
AGGCTGAACCAGTACCACCTCATGGGGCAGACCGTGGGCACGGAGAACATCAGCACCAGC
ACAGGTGAATACACAATCATGACAGCTCATTTCCATCTGAAGAGGAAGATTGGCTACTTT
GTCATCCAGACCTACCTCCCCTGCATCATGACCGTGATCTTGTCACAAGTGTCCTTTTGG
CTGAACCGAGAATCAGTTCCTGCCAGGACAGTGTTTGGGGTGACCACGGTGCTGACCATG
ACCACCCTCAGCATCAGCGCCCGGAACTCTCTGCCCAAAGTGGCTTATGCAACAGCCATG
GACTGGTTCATAGCCGTGTGTTACGCTTTTGTGTTCTCTGCGCTGATCGAGTTTGCTACC
GTCAACTATTTCACAAAGAGAGGCTGGGCCTGGGATGGGAAAAAAGCCTTGGAAGCAGCC
AAGATCAAGAAAAAGGAGCGTGAGCTTACAATAAATAAGTCAACAAACGCTTATACTACT
GGGAAGATGACCCACCCCCCGAACATCCCAAAGGAGCAGACCCCTGCAGGGACCACAAAT
GCCTCTTCAGCCTCAGTAAAACCTGAAGACAAGGCTTCTGAAAACAAAAAGACTTACAAC
AGCATCAGCAAGATTGACAAAATGTCCCGAATTATATTCCCACTTCTGTTTGGCACTTTC
AACCTAGTCTACTGGGCAACGTATTTGAATAGGGAGCCAGTGATTAAAGGGGCTACCTCT
CCAAAATGA
Enzyme 8 GenBank Gene ID BC123418 Link Image
Enzyme 8 GeneCard ID GABRA5 Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:1
Enzyme 8 Locus 15q11.2-q12
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References Not Available
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 1853
Enzyme 9 Name Gamma-aminobutyric acid receptor subunit beta-1
Enzyme 9 Synonyms
  1. GABA(A) receptor subunit beta-1
Enzyme 9 Gene Name GABRB1
Enzyme 9 Protein Sequence >Gamma-aminobutyric acid receptor subunit beta-1
MWTVQNRESLGLLSFPVMIAMVCCAHSANEPSNMSYVKETVDRLLKGYDIRLRPDFGGPP
VDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLK
RNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKI
PYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGAGKQDQSANEKNKLEMNKVQ
VDAHGNILLSTLEIRNETSGSEVLTGVGDPKTTMYSYDSASIQYRKPMSSREGYGRALDR
HGAHSKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH
Enzyme 9 Number of Residues 474
Enzyme 9 Molecular Weight 54130.0
Enzyme 9 Theoretical pI 9.01
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Involved in chloride channel activity
Enzyme 9 Specific Function GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel
Enzyme 9 Pathways Not Available
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • 1-25
Enzyme 9 Transmembrane Regions
  • 246-267 271-293 305-327 452-473
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 757756 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID P08220 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name GBRB1_BOVIN Link Image
Enzyme 9 PDB ID Not Available
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence >1425 bp
ATGTGGACAGTACAAAATCGAGAGAGTTTGGGGCTTCTCTCTTTCCCTGTGATGATTGCC
ATGGTCTGTTGTGCACACAGCGCCAACGAGCCCAGCAACATGTCATACGTGAAAGAGACA
GTGGACAGATTGCTCAAAGGATATGACATTCGCTTGCGGCCGGACTTTGGAGGGCCCCCC
GTGGACGTCGGGATGAGGATCGATGTCGCCAGCATAGACATGGTCTCCGAAGTGAACATG
GATTATACTCTCACCATGTATTTCCAGCAGTCTTGGAAAGACAAAAGGCTTTCTTATTCT
GGAATCCCACTAAACCTCACACTAGACAACAGGGTGGCTGATCAACTCTGGGTACCAGAC
ACCTACTTTCTGAATGACAAGAAATCCTTTGTGCATGGGGTTACAGTGAAAAATCGCATG
ATCCGCCTGCATCCTGATGGAACAGTTCTCTACGGACTCCGGATCACAACCACAGCTGCG
TGCATGATGGATCTACGAAGATATCCTCTGGATGAACAAAACTGCACCCTGGAGATTGAA
AGTTATGGCTACACCACTGATGACATTGAGTTTTACTGGAATGGAGGAGAGGGCGCAGTA
ACAGGAGTGAATAAAATTGAGCTCCCTCAGTTTTCAATTGTTGATTACAAGATGGTGTCC
AAAAAGGTGGAATTCACAACAGGGGCATACCCACGACTGTCACTAAGTTTTCGTCTAAAA
AGAAACATCGGTTACTTCATTTTGCAAACCTACATGCCTTCCACACTGATTACAATTCTG
TCGTGGGTGTCGTTTTGGATCAATTATGACGCATCTGCAGCCAGAGTTGCACTAGGAATC
ACCACAGTGCTGACAATGACCACCATCAGCACTCACCTCAGGGAGACCCTGCCAAAGATT
CCTTATGTCAAAGCGATTGACATTTACCTGATGGGTTGCTTCGTGTTTGTGTTCCTGGCT
CTGCTGGAATATGCCTTTGTAAATTACATCTTTTTTGGAAAGGGCCCTCAGAAGAAAGGA
GCTGGCAAACAAGACCAGAGCGCTAATGAGAAGAACAAACTGGAGATGAATAAAGTCCAG
GTCGACGCCCACGGCAACATTCTCCTCAGTACCCTGGAGATCAGGAACGAGACGAGCGGC
TCTGAAGTGCTCACGGGCGTGGGAGACCCCAAGACCACCATGTACTCCTACGACAGCGCC
AGCATCCAGTACCGCAAGCCAATGAGCAGCCGCGAGGGGTACGGGCGCGCGCTGGACCGG
CACGGCGCGCACAGCAAGGGGCGCATCCGCAGACGCGCCTCGCAGCTCAAAGTCAAAATC
CCCGACTTGACTGACGTGAATTCCATAGACAAGTGGTCCCGAATGTTCTTCCCCATCACC
TTTTCTCTTTTTAACGTCGTTTATTGGCTTTACTATGTACACTAA
Enzyme 9 GenBank Gene ID X05718 Link Image
Enzyme 9 GeneCard ID GABRB1 Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Chromosome:4
Enzyme 9 Locus 4p12
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References
  1. [PubMed Link Image]
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 1857
Enzyme 10 Name Gamma-aminobutyric acid receptor subunit alpha-4
Enzyme 10 Synonyms
  1. GABA(A) receptor subunit alpha-4
Enzyme 10 Gene Name GABRA4
Enzyme 10 Protein Sequence >Gamma-aminobutyric acid receptor subunit alpha-4
MVSAKKVPAIAMSFGVSFALLHFLCLAACLNESPGQNQKEEKLCPENFTRILDSLLDGYD
NRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLN
NMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFP
MDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSIT
GEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMT
TLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNVQMEKAKRKTSKAPQ
EISAAPVLREKHPETPLQNTNANLSMRKRANALVHSESDVGSRTDVGNHSSKSSTVVQGS
SEATPQSYLASSPNPFSRANAAETISAARAIPSALPSTPSRTGYVPRQVPVGSASTQHVF
GSRLQRIKTTVNSIGTSGKLSATTTPSAPPPSGSGTSKIDKYARILFPVTFGAFNMVYWV
VYLSKDTMEKSESLM
Enzyme 10 Number of Residues 555
Enzyme 10 Molecular Weight 61546.4
Enzyme 10 Theoretical pI 9.78
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Involved in chloride channel activity
Enzyme 10 Specific Function GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel
Enzyme 10 Pathways Not Available
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • 1-35
Enzyme 10 Transmembrane Regions
  • 259-280 285-306 318-340 525-544
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 361 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID P20237 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name GBRA4_BOVIN Link Image
Enzyme 10 PDB ID Not Available
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >1671 bp
ATGGTTTCTGCCAAGAAGGTACCCGCGATCGCGATGTCCTTCGGGGTCAGTTTCGCCCTC
CTGCACTTCCTGTGCCTGGCGGCTTGTTTAAACGAATCCCCAGGACAGAACCAAAAGGAG
GAGAAATTATGCCCAGAAAATTTTACCCGCATCCTGGACAGTTTACTCGATGGTTATGAC
AACAGGCTGCGTCCTGGATTTGGGGGTCCTGTTACAGAAGTGAAAACTGACATATATGTC
ACTAGCTTTGGACCTGTTTCCGATGTTGAAATGGAATACACAATGGATGTGTTCTTCAGA
CAGACATGGATTGACAAAAGACTAAAATATGATGGCCCCATTGAAATTTTGAGATTGAAC
AATATGATGGTAACAAAAGTGTGGACTCCTGATACTTTCTTCAGGAATGGAAAGAAATCT
GTCTCACATAATATGACAGCTCCAAATAAACTTTTTAGAATTATGAGAAATGGCACAATT
TTATACACAATGAGACTCACCATAAGTGCAGAATGTCCCATGAGATTGGTGGACTTCCCC
ATGGATGGCCATGCCTGCCCTTTGAAATTTGGGAGTTATGCCTATCCGAAGAGTGAGATG
ATTTATACCTGGACAAAAGGTCCTGAGAAATCAGTAGAAGTTCCAAAGGAGTCTTCCAGC
TTAGTTCAGTATGACTTGATTGGGCAAACTGTATCGAGTGAAACTATCAAATCCATCACA
GGTGAATATATTGTTATGACGGTTTATTTTCACCTCAGACGGAAGATGGGTTATTTTATG
ATTCAAACATACATTCCATGTATTATGACAGTAATTCTTTCTCAAGTTTCATTCTGGATA
AATAAGGAATCAGTTCCAGCTAGGACTGTATTTGGAATAACCACAGTCCTGACCATGACC
ACACTGAGCATCAGTGCACGGCCAATTTCTTTACCCAAAGTGTCCTATGCAACTGCCATG
GATTGGTTCATAGCTGTCTGCTTTGCTTTTGTATTTTCGGCCCTTATTGAGTTTGCTGCC
GTCAACTACTTTACCAATGTTCAAATGGAAAAAGCCAAAAGGAAGACATCAAAAGCCCCC
CAGGAAATTTCAGCTGCTCCAGTGCTGAGAGAAAAGCATCCTGAAACACCTCTGCAGAAC
ACAAATGCCAATTTGAGCATGAGAAAAAGAGCCAACGCCTTGGTTCACTCTGAATCTGAT
GTTGGCAGCAGAACTGATGTGGGAAACCATTCTAGCAAGTCTTCCACGGTTGTTCAAGGA
TCTTCTGAAGCCACACCACAGTCTTACTTAGCTTCCAGTCCAAACCCATTTAGCCGTGCA
AATGCAGCTGAAACTATATCTGCCGCAAGAGCAATTCCATCTGCTCTTCCTTCTACTCCT
AGTAGAACTGGGTATGTGCCCCGACAAGTCCCAGTTGGATCTGCTTCTACCCAGCATGTG
TTTGGATCAAGACTGCAGCGAATTAAGACCACAGTTAATAGCATAGGGACTTCGGGGAAG
TTATCAGCCACTACTACTCCCTCTGCTCCACCACCTTCTGGATCTGGCACAAGTAAAATA
GACAAATATGCCCGCATTCTCTTTCCAGTAACATTTGGGGCATTTAATATGGTCTATTGG
GTTGTTTACTTATCTAAGGACACTATGGAGAAATCAGAAAGTCTAATGTAA
Enzyme 10 GenBank Gene ID X61456 Link Image
Enzyme 10 GeneCard ID GABRA4 Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:4
Enzyme 10 Locus 4p12
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References
  1. [PubMed Link Image]
Enzyme 10 Metabolite References Not Available
Enzyme 11 [top]
Enzyme 11 ID 1858
Enzyme 11 Name Gamma-aminobutyric acid receptor subunit gamma-2
Enzyme 11 Synonyms
  1. GABA(A) receptor subunit gamma-2
Enzyme 11 Gene Name GABRG2
Enzyme 11 Protein Sequence >Gamma-aminobutyric acid receptor subunit gamma-2
MSSPNIWSTGSSVYSTPVFSQKMTLWILLLLSLYPGLTRQKSDDDYEDYASNKTWVLTPK
VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFGQT
WYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLY
TLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVSDTRSWRLYQF
SFVGLRNTTEVVKTTSGDYVVMTVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDA
VPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFV
SNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGK
DCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL
Enzyme 11 Number of Residues 475
Enzyme 11 Molecular Weight 55264.2
Enzyme 11 Theoretical pI 8.94
Enzyme 11 GO Classification
Function
Process
Component
Enzyme 11 General Function Involved in chloride channel activity
Enzyme 11 Specific Function GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel
Enzyme 11 Pathways Not Available
Enzyme 11 Reactions Not Available
Enzyme 11 Pfam Domain Function
Enzyme 11 Signals
  • 1-39
Enzyme 11 Transmembrane Regions
  • 274-296 300-322 334-356 452-475
Enzyme 11 Essentiality Not Available
Enzyme 11 GenBank ID Protein 163070 Link Image
Enzyme 11 UniProtKB/Swiss-Prot ID P22300 Link Image
Enzyme 11 UniProtKB/Swiss-Prot Entry Name GBRG2_BOVIN Link Image
Enzyme 11 PDB ID Not Available
Enzyme 11 Cellular Location Not Available
Enzyme 11 Gene Sequence Not Available
Enzyme 11 GenBank Gene ID M55563 Link Image
Enzyme 11 GeneCard ID GABRG2 Link Image
Enzyme 11 GenAtlas ID Not Available
Enzyme 11 HGNC ID Not Available
Enzyme 11 Chromosome Location Chromosome:5
Enzyme 11 Locus 5q31.1-q33.1
Enzyme 11 SNPs SNPJam Report Link Image
Enzyme 11 General References
  1. [PubMed Link Image]
Enzyme 11 Metabolite References Not Available
Enzyme 12 [top]
Enzyme 12 ID 1864
Enzyme 12 Name Gamma-aminobutyric acid receptor subunit alpha-3
Enzyme 12 Synonyms
  1. GABA(A) receptor subunit alpha-3
Enzyme 12 Gene Name GABRA3
Enzyme 12 Protein Sequence >Gamma-aminobutyric acid receptor subunit alpha-3
MIITQMSQFYMAGLGLLFLINILPGTTGQVESRRQEPGDFVKQDIGGLSPKHAPDIPDDS
TDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQ
TWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLL
YTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTTAEVVYSWTLGKNKSVEVAQDGSRL
NQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN
RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFMAVCYAFVFSALIEFATVN
YFTKRSWAWEGKKVPEALEMKKKTPAVPTKKTSTTFNIVGTTYPINLAKDTEFSAISKGA
APSTSSTPTIIASPKTTCVQDIPTETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVN
RESAIKGMIRKQ
Enzyme 12 Number of Residues 492
Enzyme 12 Molecular Weight 55283.4
Enzyme 12 Theoretical pI 8.94
Enzyme 12 GO Classification
Function
Process
Component
Enzyme 12 General Function Involved in chloride channel activity
Enzyme 12 Specific Function GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel
Enzyme 12 Pathways Not Available
Enzyme 12 Reactions Not Available
Enzyme 12 Pfam Domain Function
Enzyme 12 Signals
  • 1-28
Enzyme 12 Transmembrane Regions
  • 277-298 304-325 338-359 458-479
Enzyme 12 Essentiality Not Available
Enzyme 12 GenBank ID Protein 373 Link Image
Enzyme 12 UniProtKB/Swiss-Prot ID P10064 Link Image
Enzyme 12 UniProtKB/Swiss-Prot Entry Name GBRA3_BOVIN Link Image
Enzyme 12 PDB ID Not Available
Enzyme 12 Cellular Location Not Available
Enzyme 12 Gene Sequence >1479 bp
ATGATAATAACACAGATGAGTCAGTTCTACATGGCTGGCCTTGGGCTTCTCTTCCTGATT
AATATTCTCCCTGGAACAACTGGCCAAGTGGAATCAAGACGACAAGAACCTGGGGACTTT
GTGAAGCAGGATATTGGCGGACTCTCTCCAAAGCATGCTCCAGATATTCCTGATGACAGC
ACCGACAACATCACTATCTTCACCAGAATCTTGGATCGTCTTCTGGATGGCTATGACAAT
CGGCTGCGACCTGGGCTTGGAGATGCAGTGACTGAAGTGAAGACTGACATCTATGTGACC
AGTTTTGGCCCTGTGTCAGACACTGACATGGAGTACACCATTGATGTATTTTTTCGACAG
ACATGGCATGATGAAAGACTGAAATTTGATGGACCCATGAAGATCCTTCCACTGAATAAT
CTCCTGGCTAGTAAGATCTGGACCCCTGACACCTTCTTCCACAATGGCAAGAAATCAGTG
GCCCATAACATGACCACACCTAACAAGCTGCTCAGACTGGTGGACAATGGAACCCTCCTC
TACACAATGAGGTTAACAATTCATGCTGAGTGTCCCATGCATTTGGAAGATTTTCCTATG
GATGTGCATGCCTGCCCACTGAAGTTTGGAAGCTATGCCTATACAACAGCTGAAGTCGTT
TATTCTTGGACTCTTGGGAAGAACAAATCTGTGGAAGTGGCGCAAGATGGCTCTCGACTG
AATCAGTATGACCTGCTGGGCCATGTTGTTGGGACAGAAATAATCCGGTCTAGTACAGGA
GAATATGTCGTCATGACAACCCACTTCCACCTCAAGCGAAAAATTGGCTACTTTGTGATC
CAGACCTACTTGCCATGTATCATGACTGTCATCCTGTCACAAGTGTCTTTCTGGCTCAAC
AGAGAGTCTGTCCCTGCCCGCACGGTCTTTGGTGTCACCACTGTTCTCACCATGACCACC
TTGAGTATCAGTGCCAGGAACTCCTTACCTAAAGTGGCATATGCGACGGCCATGGATTGG
TTCATGGCCGTGTGTTATGCCTTTGTATTTTCTGCGCTGATTGAGTTTGCGACCGTGAAC
TACTTCACAAAGCGGAGTTGGGCTTGGGAAGGCAAGAAGGTGCCAGAGGCCCTGGAGATG
AAGAAGAAAACACCAGCAGTCCCGACCAAGAAAACCAGCACCACTTTCAACATCGTGGGA
ACCACCTATCCCATCAACCTGGCCAAGGACACTGAATTCTCTGCCATCTCCAAGGGCGCT
GCTCCAAGCACCTCCTCCACCCCGACAATCATTGCTTCACCCAAGACCACCTGTGTGCAG
GATATCCCGACTGAGACCAAGACCTACAACAGTGTCAGCAAGGTTGACAAGATTTCCCGC
ATCATCTTTCCTGTGCTCTTTGCCATTTTCAATCTGGTCTATTGGGCTACATATGTCAAC
CGGGAGTCAGCTATCAAGGGCATGATCCGCAAACAGTAG
Enzyme 12 GenBank Gene ID X12362 Link Image
Enzyme 12 GeneCard ID GABRA3 Link Image
Enzyme 12 GenAtlas ID Not Available
Enzyme 12 HGNC ID Not Available
Enzyme 12 Chromosome Location Not Available
Enzyme 12 Locus Xq28
Enzyme 12 SNPs SNPJam Report Link Image
Enzyme 12 General References
  1. [PubMed Link Image]
Enzyme 12 Metabolite References Not Available
Enzyme 13 [top]
Enzyme 13 ID 1865
Enzyme 13 Name Gamma-aminobutyric acid receptor subunit alpha-2
Enzyme 13 Synonyms
  1. GABA(A) receptor subunit alpha-2
Enzyme 13 Gene Name GABRA2
Enzyme 13 Protein Sequence >Gamma-aminobutyric acid receptor subunit alpha-2
MKTKLNSSNMQLLLFVFLAWDPARLVLANIQEDEAKNNITIFTRILDRLLDGYDNRLRPG
LGDSITEVFTNIYVTSFGPVSDTDMEYTIDVFFRQKWKDERLKFKGPMNILRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRIQDDGTLLYTMRLTVQAECPMHLEDFPMDAHSC
PLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLPGQSIGKETIKSSTGEYTVM
TAHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASV
MIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKPENKPAEAKKTFNSVSKIDRM
SRIVFPVLFGTFNLVYWATYLNREPVLGVSP
Enzyme 13 Number of Residues 451
Enzyme 13 Molecular Weight 51145.6
Enzyme 13 Theoretical pI 9.51
Enzyme 13 GO Classification
Function
Process
Component
Enzyme 13 General Function Involved in chloride channel activity
Enzyme 13 Specific Function GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel
Enzyme 13 Pathways Not Available
Enzyme 13 Reactions Not Available
Enzyme 13 Pfam Domain Function
Enzyme 13 Signals
  • 1-28
Enzyme 13 Transmembrane Regions
  • 252-273 279-300 313-334 420-441
Enzyme 13 Essentiality Not Available
Enzyme 13 GenBank ID Protein 369 Link Image
Enzyme 13 UniProtKB/Swiss-Prot ID P10063 Link Image
Enzyme 13 UniProtKB/Swiss-Prot Entry Name GBRA2_BOVIN Link Image
Enzyme 13 PDB ID Not Available
Enzyme 13 Cellular Location Not Available
Enzyme 13 Gene Sequence >1356 bp
ATGAAGACGAAACTGAACAGCTCCAATATGCAGTTGCTGCTTTTTGTTTTCTTGGCGTGG
GATCCAGCCAGGTTGGTGCTGGCTAACATCCAAGAAGATGAGGCTAAAAATAACATTACC
ATCTTTACAAGAATTCTAGACAGACTTCTGGATGGTTACGATAATCGGCTTAGACCAGGA
CTGGGAGACAGTATTACTGAAGTCTTCACTAACATCTATGTGACCAGTTTTGGCCCTGTC
TCAGATACAGACATGGAATATACAATCGATGTTTTCTTTCGACAAAAATGGAAAGATGAA
CGATTAAAATTTAAAGGTCCTATGAACATCCTTCGACTCAACAATTTAATGGCCAGCAAA
ATCTGGACTCCAGATACCTTTTTCCACAATGGGAAGAAATCGGTGGCACACAATATGACA
ATGCCAAATAAGCTTCTCCGAATCCAGGATGATGGGACCCTGCTGTACACAATGAGGCTT
ACAGTTCAAGCTGAATGTCCAATGCACTTGGAGGATTTTCCAATGGATGCCCACTCATGT
CCTCTGAAATTTGGCAGCTATGCATATACAACCTCAGAGGTTACTTACATTTGGACATAC
AATGCGTCTGATTCTGTACAGGTTGCTCCTGATGGCTCTAGGTTAAATCAATATGATCTG
CCGGGCCAATCAATTGGGAAGGAGACAATTAAATCTAGTACAGGTGAATATACCGTAATG
ACAGCTCATTTCCACTTGAAAAGAAAAATTGGATATTTTGTGATTCAGACATATCTGCCT
TGCATCATGACTGTCATTCTCTCCCAAGTGTCATTCTGGCTTAACAGAGAATCTGTGCCT
GCAAGAACAGTGTTTGGAGTAACAACTGTTCTAACAATGACAACTCTAAGCATCAGTGCT
CGGAATTCTCTCCCCAAAGTGGCTTATGCAACTGCCATGGACTGGTTTATTGCTGTTTGC
TATGCATTTGTGTTCTCTGCCCTAATTGAATTTGCAACTGTTAATTACTTCACCAAAAGA
GGATGGGCTTGGGATGGAAAGAGTGTAGTAAATGACAAGAAAAAAGAAAAAGCCTCTGTG
ATGATACAGAACAACGCTTATGCAGTGGCTGTTGCCAATTATGCCCCGAATCTTTCAAAA
GACCCAGTTCTCTCCACCATCTCCAAGAGCGCAACCACTCCAGAACCCAACAAGAAACCG
GAAAACAAGCCAGCCGAAGCCAAGAAGACCTTCAATAGCGTTAGCAAAATTGACAGAATG
TCTAGAATAGTTTTCCCAGTTTTGTTTGGTACATTTAATTTAGTTTACTGGGCCACATAT
TTAAACAGAGAACCTGTATTAGGGGTCAGTCCTTGA
Enzyme 13 GenBank Gene ID X12361 Link Image
Enzyme 13 GeneCard ID GABRA2 Link Image
Enzyme 13 GenAtlas ID Not Available
Enzyme 13 HGNC ID Not Available
Enzyme 13 Chromosome Location Chromosome:4
Enzyme 13 Locus 4p12
Enzyme 13 SNPs SNPJam Report Link Image
Enzyme 13 General References
  1. [PubMed Link Image]
Enzyme 13 Metabolite References Not Available
Enzyme 14 [top]
Enzyme 14 ID 1869
Enzyme 14 Name Gamma-aminobutyric acid receptor subunit rho-2
Enzyme 14 Synonyms
  1. GABA(A) receptor subunit rho-2
Enzyme 14 Gene Name GABRR2
Enzyme 14 Protein Sequence >Gamma-aminobutyric acid receptor subunit rho-2
MPYFSRLILFLFCLVVLVESRKPKKRRWTGQLETSKPSHLYKKNPDMTKIRHGKPQPLLR
VDDHDFTMRPAFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLAFPSASN
KSMTFDGRLVKKIWVPDVFFVHSKRSFIHDTTTDNIMLRVFPDGQVLYSMRITVTAMCNM
DFSHFPLDSQTCSLELESYAYTDEDLMLYWKNGDESLKTDEKISLSQFLIQKFHTTSRLA
FYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVSLGITT
VLTMSTIITGVNASMPRVSYIKAVDIYLWVSFVFVFLSVLEYAAVNYLTTVQERKERKLQ
EKFPCMCGMLHSRTMMLDGSYSESEANSLAGYPRSHILPEEERQDKIVVHLALSNESSSS
RKKGLLKGQVGLRIFQNTHAIDKYSRLIFPASYIFFNLIYWSVFA
Enzyme 14 Number of Residues 465
Enzyme 14 Molecular Weight 54121.3
Enzyme 14 Theoretical pI 9.42
Enzyme 14 GO Classification
Function
Process
Component
Enzyme 14 General Function Involved in extracellular ligand-gated ion channel acti
Enzyme 14 Specific Function GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel. Rho-2 GABA receptor could play a role in retinal neurotransmission
Enzyme 14 Pathways Not Available
Enzyme 14 Reactions Not Available
Enzyme 14 Pfam Domain Function
Enzyme 14 Signals
  • 1-20
Enzyme 14 Transmembrane Regions
  • 262-285 289-311 323-345 444-465
Enzyme 14 Essentiality Not Available
Enzyme 14 GenBank ID Protein 113912067 Link Image
Enzyme 14 UniProtKB/Swiss-Prot ID Q0II76 Link Image
Enzyme 14 UniProtKB/Swiss-Prot Entry Name GBRR2_BOVIN Link Image
Enzyme 14 PDB ID Not Available
Enzyme 14 Cellular Location Not Available
Enzyme 14 Gene Sequence >1473 bp
ATGGTTAAGCCTGGGGGTATCTGCCCTGCTGCAGGTCCCTGGAAGGCAGCTTGCAGCATA
GCAGACATTCACAGGATGCCTTATTTTTCAAGACTCATTTTGTTTTTGTTTTGCTTGGTG
GTTCTTGTGGAGAGCAGAAAGCCCAAGAAGAGGAGATGGACAGGGCAGCTGGAAACGTCC
AAGCCAAGTCACCTGTATAAGAAGAACCCTGATATGACCAAAATCCGACATGGAAAACCT
CAGCCACTTCTCAGAGTGGATGATCATGATTTCACCATGAGGCCCGCTTTTGGAGGCCCT
GCCATCCCGGTGGGCGTGGACGTGCAGGTGGAGAGCCTGGACAGCATCTCCGAGGTGGAC
ATGGACTTCACCATGACCTTGTACCTGCGGCATTACTGGAAGGATGAGCGGCTGGCTTTC
CCCAGTGCCAGCAACAAGAGTATGACCTTCGACGGCCGGCTGGTGAAGAAGATCTGGGTC
CCCGATGTGTTCTTTGTTCACTCCAAAAGGTCGTTCATCCATGACACCACCACAGACAAC
ATCATGCTGAGAGTGTTCCCAGATGGGCAGGTGCTGTATAGCATGAGGATTACGGTCACT
GCCATGTGCAACATGGATTTCAGCCACTTTCCCCTGGATTCTCAGACCTGTTCTTTGGAG
CTGGAAAGCTATGCATATACAGATGAAGATCTGATGCTATATTGGAAGAATGGGGACGAA
TCCCTGAAAACGGACGAAAAGATCTCCCTATCTCAGTTTCTGATTCAGAAATTCCACACC
ACTTCCAGACTGGCCTTCTACAGCAGCACAGGCTGGTACAACCGTCTGTACATCAACTTC
ACGCTGCGTCGCCACATCTTCTTCTTCTTGCTCCAAACCTACTTTCCCGCCACCCTGATG
GTCATGCTGTCCTGGGTGTCCTTCTGGATCGACCGCAGAGCCGTGCCCGCCAGAGTCTCA
CTGGGGATCACCACGGTGCTGACCATGTCCACCATCATCACGGGCGTGAACGCCTCCATG
CCCCGCGTGTCCTACATCAAGGCCGTGGATATCTACCTCTGGGTCAGCTTCGTGTTCGTG
TTCCTCTCGGTGCTGGAGTACGCGGCCGTCAACTACCTGACCACCGTGCAGGAGCGGAAG
GAGCGGAAACTGCAGGAGAAGTTCCCATGCATGTGTGGGATGCTTCACTCGAGAACCATG
ATGCTAGATGGAAGCTACAGTGAGTCCGAGGCCAACAGCCTAGCTGGGTACCCGAGAAGC
CATATTCTGCCAGAAGAAGAAAGACAAGACAAAATAGTGGTCCACCTGGCCCTGAGCAAC
GAATCCAGCTCCTCCAGGAAGAAGGGGCTTCTGAAGGGCCAGGTGGGTCTTCGCATCTTC
CAGAACACCCACGCCATCGACAAATACTCCCGGTTGATATTCCCAGCTTCCTACATATTT
TTCAACTTGATTTATTGGTCAGTGTTTGCCTAG
Enzyme 14 GenBank Gene ID BC122770 Link Image
Enzyme 14 GeneCard ID GABRR2 Link Image
Enzyme 14 GenAtlas ID Not Available
Enzyme 14 HGNC ID Not Available
Enzyme 14 Chromosome Location Chromosome:6
Enzyme 14 Locus 6q14-q21|6q13-q16.3
Enzyme 14 SNPs SNPJam Report Link Image
Enzyme 14 General References Not Available
Enzyme 14 Metabolite References Not Available
Enzyme 15 [top]
Enzyme 15 ID 1871
Enzyme 15 Name Gamma-aminobutyric acid receptor subunit alpha-1
Enzyme 15 Synonyms
  1. GABA(A) receptor subunit alpha-1
Enzyme 15 Gene Name GABRA1
Enzyme 15 Protein Sequence >Gamma-aminobutyric acid receptor subunit alpha-1
MKKSPGLSDYLWAWTLFLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPG
LGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASK
IWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHAC
PLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVM
TTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISA
RNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDP
LIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKID
RLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
Enzyme 15 Number of Residues 456
Enzyme 15 Molecular Weight 51855.4
Enzyme 15 Theoretical pI 9.65
Enzyme 15 GO Classification
Function
Process
Component
Enzyme 15 General Function Involved in chloride channel activity
Enzyme 15 Specific Function GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel
Enzyme 15 Pathways Not Available
Enzyme 15 Reactions Not Available
Enzyme 15 Pfam Domain Function
Enzyme 15 Signals
  • 1-27
Enzyme 15 Transmembrane Regions
  • 252-273 279-300 313-334 422-443
Enzyme 15 Essentiality Not Available
Enzyme 15 GenBank ID Protein 757755 Link Image
Enzyme 15 UniProtKB/Swiss-Prot ID P08219 Link Image
Enzyme 15 UniProtKB/Swiss-Prot Entry Name GBRA1_BOVIN Link Image
Enzyme 15 PDB ID Not Available
Enzyme 15 Cellular Location Not Available
Enzyme 15 Gene Sequence >1371 bp
ATGAAGAAAAGTCCGGGTCTCTCTGACTACCTTTGGGCCTGGACCCTCTTTCTGAGCACA
TTGACTGGAAGAAGCTATGGACAACCCTCATTACAAGATGAACTTAAAGACAACACCACT
GTCTTCACCAGGATTTTGGACCGACTCCTAGATGGTTATGACAATCGCCTGAGACCGGGA
TTAGGAGAGCGTGTAACTGAAGTGAAGACTGACATCTTCGTCACCAGTTTCGGACCCGTT
TCAGACCATGATATGGAATATACAATAGATGTATTTTTCCGTCAAAGCTGGAAGGATGAA
AGGTTAAAATTTAAAGGACCTATGACAGTACTCCGATTAAATAACCTAATGGCAAGTAAA
ATCTGGACTCCGGATACCTTTTTCCACAATGGAAAGAAGTCAGTGGCACACAACATGACC
ATGCCGAACAAGCTCCTGCGCATCACAGAGGACGGCACTTTGCTGTACACCATGAGACTG
ACGGTGAGAGCCGAATGTCCAATGCATTTGGAGGATTTCCCTATGGATGCCCATGCCTGC
CCTCTAAAATTTGGAAGCTATGCTTATACAAGAGCAGAAGTTGTTTATGAGTGGACCAGA
GAGCCAGCACGCTCAGTGGTTGTAGCCGAAGATGGGTCACGCCTGAACCAGTACGATCTT
CTTGGACAAACAGTAGATTCTGGAATTGTTCAGTCTAGTACAGGAGAGTATGTTGTTATG
ACAACTCATTTCCACCTGAAGAGAAAGATTGGATATTTTGTTATTCAAACATACCTGCCG
TGCATAATGACAGTTATTCTCTCCCAAGTCTCATTCTGGCTCAACAGAGAGTCTGTGCCA
GCGAGGACGGTCTTTGGAGTCACAACTGTGCTCACCATGACAACTTTGAGTATCAGTGCC
AGAAATTCCCTCCCTAAGGTGGCTTATGCAACTGCTATGGATTGGTTTATTGCAGTGTGC
TATGCCTTTGTATTCTCAGCTCTGATCGAGTTTGCCACAGTAAACTATTTCACCAAGAGA
GGTTATGCATGGGATGGGAAAAGTGTGGTTCCAGAAAAGCCAAAGAAAGTGAAGGACCCT
CTTATTAAGAAAAACAACACTTATGCTCCAACAGCAACCAGCTACACACCTAATCTGGCC
AGGGGTGACCCCGGCTTAGCCACCATTGCTAAAAGTGCAACCATAGAACCAAAAGAAGTC
AAGCCGGAAACAAAACCACCAGAACCGAAGAAAACCTTTAACAGTGTCAGCAAAATTGAC
CGACTGTCAAGAATAGCCTTCCCGCTGTTATTCGGAATCTTTAACTTGGTCTATTGGGCA
ACATATTTAAACAGAGAGCCTCAGCTAAAAGCCCCCACCCCCCATCAATAG
Enzyme 15 GenBank Gene ID X05717 Link Image
Enzyme 15 GeneCard ID GABRA1 Link Image
Enzyme 15 GenAtlas ID Not Available
Enzyme 15 HGNC ID Not Available
Enzyme 15 Chromosome Location Chromosome:5
Enzyme 15 Locus 5q34-q35
Enzyme 15 SNPs SNPJam Report Link Image
Enzyme 15 General References
  1. [PubMed Link Image]
Enzyme 15 Metabolite References Not Available
Enzyme 16 [top]
Enzyme 16 ID 2104
Enzyme 16 Name Lin-7 homolog C
Enzyme 16 Synonyms
  1. Lin-7C
Enzyme 16 Gene Name LIN7C
Enzyme 16 Protein Sequence >Lin-7 homolog C
MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYET
VDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYIS
RIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEE
MESRFEKMRSAKRRQQT
Enzyme 16 Number of Residues 197
Enzyme 16 Molecular Weight 21833.8
Enzyme 16 Theoretical pI 8.70
Enzyme 16 GO Classification
Function
Process
Component
Enzyme 16 General Function Involved in exocytosis
Enzyme 16 Specific Function Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells
Enzyme 16 Pathways Not Available
Enzyme 16 Reactions Not Available
Enzyme 16 Pfam Domain Function
Enzyme 16 Signals
  • None
Enzyme 16 Transmembrane Regions
  • None
Enzyme 16 Essentiality Not Available
Enzyme 16 GenBank ID Protein 112362301 Link Image
Enzyme 16 UniProtKB/Swiss-Prot ID Q0P5F3 Link Image
Enzyme 16 UniProtKB/Swiss-Prot Entry Name LIN7C_BOVIN Link Image
Enzyme 16 PDB ID Not Available
Enzyme 16 Cellular Location Not Available
Enzyme 16 Gene Sequence >594 bp
ATGGCGGCCCTGGGGGAGCCCGTGCGACTGGAGAGGGATATTTGTAGAGCAATTGAATTG
TTGGAAAAACTGCAAAGAAGTGGCGAGGTACCACCACAGAAACTTCAGGCTCTACAAAGA
GTCCTTCAGAGTGAATTCTGCAATGCTGTAAGAGAGGTATATGAACATGTCTACGAGACT
GTGGACATCAGTAGCAGTCCTGAAGTGAGAGCTAATGCAACTGCAAAGGCTACTGTTGCT
GCATTTGCTGCCAGCGAAGGGCATTCTCATCCTCGAGTTGTTGAGCTGCCAAAAACAGAA
GAAGGCCTTGGATTCAATATTATGGGAGGCAAAGAACAAAACTCTCCAATCTATATCTCT
CGAATAATTCCAGGTGGAATTGCTGATAGACATGGGGGCCTCAAGCGAGGAGATCAGCTC
CTTTCTGTTAATGGAGTGAGTGTTGAAGGAGAGCATCATGAAAAAGCTGTAGAGCTGCTG
AAAGCAGCGCAGGGAAAGGTTAAATTAGTAGTGCGGTATACACCCAAGGTCTTGGAAGAG
ATGGAGTCGCGCTTTGAAAAAATGCGATCAGCAAAACGCAGGCAACAGACCTAA
Enzyme 16 GenBank Gene ID BC120124 Link Image
Enzyme 16 GeneCard ID LIN7C Link Image
Enzyme 16 GenAtlas ID Not Available
Enzyme 16 HGNC ID Not Available
Enzyme 16 Chromosome Location Chromosome:1
Enzyme 16 Locus 11p14
Enzyme 16 SNPs SNPJam Report Link Image
Enzyme 16 General References Not Available
Enzyme 16 Metabolite References Not Available
Enzyme 17 [top]
Enzyme 17 ID 2105
Enzyme 17 Name Lin-7 homolog B
Enzyme 17 Synonyms
  1. Lin-7B
Enzyme 17 Gene Name LIN7B
Enzyme 17 Protein Sequence >Lin-7 homolog B
MAALVEPLGLEREVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDT
LDITGSAEIRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYIS
RVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEE
MEARFEKMRSARRRQQHQSYS
Enzyme 17 Number of Residues 201
Enzyme 17 Molecular Weight 22280.2
Enzyme 17 Theoretical pI 9.01
Enzyme 17 GO Classification
Function
Process
Component
Enzyme 17 General Function Involved in protein binding
Enzyme 17 Specific Function Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells. May increase the amplitude of ACCN3 acid-evoked currents by stabilizing the channel at the cell surface
Enzyme 17 Pathways Not Available
Enzyme 17 Reactions Not Available
Enzyme 17 Pfam Domain Function
Enzyme 17 Signals
  • None
Enzyme 17 Transmembrane Regions
  • None
Enzyme 17 Essentiality Not Available
Enzyme 17 GenBank ID Protein 86827445 Link Image
Enzyme 17 UniProtKB/Swiss-Prot ID Q2KIB6 Link Image
Enzyme 17 UniProtKB/Swiss-Prot Entry Name LIN7B_BOVIN Link Image
Enzyme 17 PDB ID 1Y74 Link Image
Enzyme 17 PDB File Show
Enzyme 17 3D Structure
Enzyme 17 Cellular Location Not Available
Enzyme 17 Gene Sequence >606 bp
ATGGCTGCGCTGGTGGAGCCGCTGGGGCTGGAGCGGGAAGTGTCCCGGGCGGTGGAGCTC
CTCGAGCGGCTCCAGCGCAGCGGGGAGCTGCCCCCGCAGAAGCTGCAGGCCCTCCAGCGA
GTCCTGCAGAGCCGCTTCTGCTCTGCCATCCGAGAGGTGTATGAGCAGCTCTACGACACG
CTGGACATCACCGGCAGTGCTGAGATCCGGGCCCACGCCACGGCCAAGGCCACGGTGGCC
GCCTTCACAGCCAGTGAGGGCCATGCACATCCCAGGGTAGTGGAACTGCCCAAGACGGAT
GAGGGCCTGGGCTTCAACATCATGGGGGGCAAGGAGCAGAATTCACCTATCTACATCTCC
CGTGTCATCCCTGGGGGTGTGGCTGACCGCCACGGAGGCCTGAAGCGTGGGGACCAGCTG
CTGTCAGTGAATGGTGTGAGCGTTGAGGGCGAGCAGCATGAGAAGGCAGTGGAGCTTCTG
AAGGCTGCCCAGGGCTCGGTGAAGCTGGTGGTACGCTACACACCTCGAGTGCTGGAGGAG
ATGGAAGCCCGCTTTGAGAAGATGCGCTCCGCCCGGCGGCGCCAGCAACATCAGAGCTAC
TCGTGA
Enzyme 17 GenBank Gene ID BC112698 Link Image
Enzyme 17 GeneCard ID LIN7B Link Image
Enzyme 17 GenAtlas ID Not Available
Enzyme 17 HGNC ID Not Available
Enzyme 17 Chromosome Location Chromosome:1
Enzyme 17 Locus 19q13.3
Enzyme 17 SNPs SNPJam Report Link Image
Enzyme 17 General References Not Available
Enzyme 17 Metabolite References Not Available
Enzyme 18 [top]
Enzyme 18 ID 2106
Enzyme 18 Name Lin-7 homolog A
Enzyme 18 Synonyms
  1. Lin-7A
Enzyme 18 Gene Name LIN7A
Enzyme 18 Protein Sequence >Lin-7 homolog A
MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSE
FCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGF
NVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKD
SVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQTQQNHMS
Enzyme 18 Number of Residues 233
Enzyme 18 Molecular Weight 25996.6
Enzyme 18 Theoretical pI 9.10
Enzyme 18 GO Classification
Function
Process
Component
Enzyme 18 General Function Involved in protein binding
Enzyme 18 Specific Function Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells
Enzyme 18 Pathways Not Available
Enzyme 18 Reactions Not Available
Enzyme 18 Pfam Domain Function
Enzyme 18 Signals
  • None
Enzyme 18 Transmembrane Regions
  • None
Enzyme 18 Essentiality Not Available
Enzyme 18 GenBank ID Protein 81674220 Link Image
Enzyme 18 UniProtKB/Swiss-Prot ID Q32LM6 Link Image
Enzyme 18 UniProtKB/Swiss-Prot Entry Name LIN7A_BOVIN Link Image
Enzyme 18 PDB ID Not Available
Enzyme 18 Cellular Location Not Available
Enzyme 18 Gene Sequence >702 bp
ATGCTGAAGCCGAGCGTCACTTCGGCTCCCACGGCAGACATGGCGACATTGACAGTGGTC
CAGCCGCTCACTCTGGACAGAGATGTTGCCAGAGCAATTGAATTACTGGAAAAACTGCAG
GAATCTGGAGAAGTACCAGTGCACAAGCTACAATCCCTCAAAAAAGTGCTTCAGAGTGAG
TTTTGTACTGCTATTCGAGAGGTGTATCAATATATGCATGAAACGATAACTGTTAATGGC
TGTCCCGAATTCCGTGCCAGGGCCACAGCAAAGGCTACAGTTGCAGCTTTTGCAGCTAGT
GAAGGCCATTCCCACCCTCGGGTAGTCGAACTGCCAAAGACAGATGAAGGCCTTGGTTTT
AACGTGATGGGAGGAAAGGAGCAAAATTCTCCCATTTATATCTCTCGCATCATTCCTGGA
GGGGTGGCTGAAAGACACGGAGGCCTCAAGAGAGGAGACCAGCTGCTATCAGTGAATGGA
GTGAGTGTGGAAGGAGAACACCATGAAAAAGCCGTAGAACTGCTTAAGGCTGCCAAGGAC
AGTGTCAAGCTGGTGGTGCGATACACCCCGAAAGTCCTAGAAGAAATGGAGGCTCGCTTT
GAAAAGCTACGGACAGCCCGGCGTCGGCAACAGCAACAGTTGCTAATTCAGCAGCAGCAA
CAGCAGCAGCAGCAACAAACACAGCAAAACCACATGTCATAG
Enzyme 18 GenBank Gene ID BC109509 Link Image
Enzyme 18 GeneCard ID LIN7A Link Image
Enzyme 18 GenAtlas ID Not Available
Enzyme 18 HGNC ID Not Available
Enzyme 18 Chromosome Location Chromosome:1
Enzyme 18 Locus 12q21
Enzyme 18 SNPs SNPJam Report Link Image
Enzyme 18 General References Not Available
Enzyme 18 Metabolite References Not Available
Enzyme 19 [top]
Enzyme 19 ID 2177
Enzyme 19 Name Gamma-aminobutyric acid receptor-associated protein
Enzyme 19 Synonyms
  1. GABA(A) receptor-associated protein
Enzyme 19 Gene Name GABARAP
Enzyme 19 Protein Sequence >Gamma-aminobutyric acid receptor-associated protein
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Enzyme 19 Number of Residues 117
Enzyme 19 Molecular Weight 13917.9
Enzyme 19 Theoretical pI 9.21
Enzyme 19 GO Classification
Function
Process
Component
Enzyme 19 General Function Involved in protein transport
Enzyme 19 Specific Function May play a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton
Enzyme 19 Pathways Not Available
Enzyme 19 Reactions Not Available
Enzyme 19 Pfam Domain Function
Enzyme 19 Signals
  • None
Enzyme 19 Transmembrane Regions
  • None
Enzyme 19 Essentiality Not Available
Enzyme 19 GenBank ID Protein 74268390 Link Image
Enzyme 19 UniProtKB/Swiss-Prot ID Q9GJW7 Link Image
Enzyme 19 UniProtKB/Swiss-Prot Entry Name GBRAP_BOVIN Link Image
Enzyme 19 PDB ID 1KM7 Link Image
Enzyme 19 PDB File Show
Enzyme 19 3D Structure
Enzyme 19 Cellular Location Not Available
Enzyme 19 Gene Sequence >354 bp
ATGAAGTTCGTGTATAAAGAGGAGCATCCGTTCGAGAAGCGTCGCTCTGAGGGCGAAAAG
ATCCGAAAGAAATACCCGGACCGGGTCCCGGTAATAGTAGAAAAGGCTCCTAAAGCTCGG
ATAGGAGACCTGGACAAAAAGAAATACCTGGTGCCTTCTGATCTTACAGTTGGTCAGTTC
TACTTCTTAATCCGGAAGCGAATTCATCTCCGAGCAGAGGATGCCTTGTTTTTCTTCGTC
AACAACGTCATTCCGCCCACCAGTGCCACGATGGGTCAGCTGTACCAGGAACACCATGAA
GAAGACTTCTTTCTATACATTGCCTACAGTGATGAAAGTGTCTACGGTCTGTGA
Enzyme 19 GenBank Gene ID BC103060 Link Image
Enzyme 19 GeneCard ID GABARAP Link Image
Enzyme 19 GenAtlas ID Not Available
Enzyme 19 HGNC ID Not Available
Enzyme 19 Chromosome Location Chromosome:1
Enzyme 19 Locus 17p13.1
Enzyme 19 SNPs SNPJam Report Link Image
Enzyme 19 General References Not Available
Enzyme 19 Metabolite References Not Available
Enzyme 20 [top]
Enzyme 20 ID 2178
Enzyme 20 Name Gamma-aminobutyric acid receptor-associated protein-like 1
Enzyme 20 Synonyms
  1. GABA(A) receptor-associated protein-like 1
Enzyme 20 Gene Name GABARAPL1
Enzyme 20 Protein Sequence >Gamma-aminobutyric acid receptor-associated protein-like 1
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
Enzyme 20 Number of Residues 117
Enzyme 20 Molecular Weight 14044.0
Enzyme 20 Theoretical pI 9.13
Enzyme 20 GO Classification
Function
Process
Component
Enzyme 20 General Function Not Available
Enzyme 20 Specific Function Increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor
Enzyme 20 Pathways Not Available
Enzyme 20 Reactions Not Available
Enzyme 20 Pfam Domain Function
Enzyme 20 Signals
  • None
Enzyme 20 Transmembrane Regions
  • None
Enzyme 20 Essentiality Not Available
Enzyme 20 GenBank ID Protein 73587226 Link Image
Enzyme 20 UniProtKB/Swiss-Prot ID Q8HYB6 Link Image
Enzyme 20 UniProtKB/Swiss-Prot Entry Name GBRL1_BOVIN Link Image
Enzyme 20 PDB ID Not Available
Enzyme 20 Cellular Location Not Available
Enzyme 20 Gene Sequence >354 bp
ATGAAGTTCCAGTATAAGGAGGACCATCCCTTTGAGTATCGGAAAAAGGAAGGAGAAAAG
ATCCGAAAGAAATATCCGGACCGGGTCCCTGTGATCGTGGAGAAGGCTCCCAAGGCCAGG
GTGCCTGACCTGGACAAGAGGAAGTACCTCGTGCCCTCTGACCTCACTGTTGGCCAGTTC
TACTTCTTAATCCGGAAGAGAATCCACCTGAGACCTGAGGACGCCTTATTCTTCTTTGTC
AACAACACCATACCTCCCACTAGTGCGACCATGGGCCAGCTGTATGAGGACAACCATGAG
GAAGACTACTTTCTGTATGTGGCCTACAGTGACGAGAGTGTCTACGGGAAGTGA
Enzyme 20 GenBank Gene ID BC103442 Link Image
Enzyme 20 GeneCard ID GABARAPL1 Link Image
Enzyme 20 GenAtlas ID Not Available
Enzyme 20 HGNC ID Not Available
Enzyme 20 Chromosome Location Chromosome:1
Enzyme 20 Locus 12p13.2
Enzyme 20 SNPs SNPJam Report Link Image
Enzyme 20 General References
  1. [PubMed Link Image]
Enzyme 20 Metabolite References Not Available
Enzyme 21 [top]
Enzyme 21 ID 2179
Enzyme 21 Name Acyl-CoA-binding protein
Enzyme 21 Synonyms
  1. ACBP
  2. Diazepam-binding inhibitor
  3. DBI
  4. Endozepine
  5. EP
Enzyme 21 Gene Name DBI
Enzyme 21 Protein Sequence >Acyl-CoA-binding protein
MSQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWN
ELKGTSKEDAMKAYIDKVEELKKKYGI
Enzyme 21 Number of Residues 87
Enzyme 21 Molecular Weight 10044.4
Enzyme 21 Theoretical pI 6.54
Enzyme 21 GO Classification
Function
Process
Component
Enzyme 21 General Function Involved in acyl-CoA binding
Enzyme 21 Specific Function Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor
Enzyme 21 Pathways Not Available
Enzyme 21 Reactions Not Available
Enzyme 21 Pfam Domain Function
Enzyme 21 Signals
  • None
Enzyme 21 Transmembrane Regions
  • None
Enzyme 21 Essentiality Not Available
Enzyme 21 GenBank ID Protein 162979 Link Image
Enzyme 21 UniProtKB/Swiss-Prot ID P07107 Link Image
Enzyme 21 UniProtKB/Swiss-Prot Entry Name ACBP_BOVIN Link Image
Enzyme 21 PDB ID 1NVL Link Image
Enzyme 21 PDB File Show
Enzyme 21 3D Structure
Enzyme 21 Cellular Location Not Available
Enzyme 21 Gene Sequence >264 bp
AATCTTTGCAACACCGCCGGCATGTCTCAGGCTGAGTTTGACAAAGCTGCTGAGGAAGTT
AAGCATCTTAAGACCAAGCCAGCAGATGAGGAGATGCTGTTCATCTACAGCCACTACAAA
CAAGCAACTGTGGGTGACATAAATACAGAACGTCCTGGAATGTTGGACTTCAAAGGCAAG
GCCAAGTGGGATGCCTGGAATGAGCTGAAAGGGACTTCTAAAGAAGATGCCATGAAAGCT
TACATTGACAAAGTAGAAGAACTA
Enzyme 21 GenBank Gene ID M15886 Link Image
Enzyme 21 GeneCard ID DBI Link Image
Enzyme 21 GenAtlas ID Not Available
Enzyme 21 HGNC ID Not Available
Enzyme 21 Chromosome Location Chromosome:2
Enzyme 21 Locus 2q12-q21
Enzyme 21 SNPs SNPJam Report Link Image
Enzyme 21 General References
  1. [PubMed Link Image]
Enzyme 21 Metabolite References Not Available
Enzyme 22 [top]
Enzyme 22 ID 2180
Enzyme 22 Name Sodium- and chloride-dependent GABA transporter 2
Enzyme 22 Synonyms
  1. GAT-2
  2. Solute carrier family 6 member 13
Enzyme 22 Gene Name SLC6A13
Enzyme 22 Protein Sequence >Sodium- and chloride-dependent GABA transporter 2
MDSRVSGTTSNGETKPVCPGLEKAAEDGALQREQWSNKMEFLLSVAGEIIGLGNVWRFPY
LCYKNGGGAFFIPYLIFLFTCGIPVFLLETALGQYTSQGGITAWRKICPIFEGIGYASQM
IVTLLNIYYIIVLAWALFYLFSSFTIDLPWGSCRHDWNTERCVEFQRTNGSLNATAENAT
SPVIEFWERRVLKISEGIQHLGALRWELALCLLLAWVVCYFCIWKGVKSTGKVVYFTATF
PYLMLVVLLIRGVTLPGAAQGIQFYLYPNLTRLWDPQVWMDAGTQIFFSFAICLGCLTAL
GSYNKYHNNCYRDSIALCFLNSGTSFVAGFAIFSILGFMSQEQGVPISEVAESGPGLAFI
AYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPRVFRKKNRREVLI
LGVSVTSFLVGLVMLTEGGMYVFQLFDYYAASGMCLLFVAIFESFCVAWAYGAGRFYDNI
EDMIGYRPWPLIKYCWLFLTPAVCTATFLFSLIKYTPLTYNKKYKYPWWGDALGWLLALS
SMVCIPAWSCYKLSTLKGSFRERVRQLLCPAKDLPQGHREGPSAPATPRTSLLILTELEP
HH
Enzyme 22 Number of Residues 602
Enzyme 22 Molecular Weight 67787.8
Enzyme 22 Theoretical pI 7.82
Enzyme 22 GO Classification
Function
Process
Component
Enzyme 22 General Function Involved in gamma-aminobutyric acid:sodium symporter ac
Enzyme 22 Specific Function Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals
Enzyme 22 Pathways Not Available
Enzyme 22 Reactions Not Available
Enzyme 22 Pfam Domain Function
Enzyme 22 Signals
  • None
Enzyme 22 Transmembrane Regions
  • 41-61 68-88 121-141 207-227 233-253 282-302 319-339 366-386 418-438 453-473 490-510 528-548
Enzyme 22 Essentiality Not Available
Enzyme 22 GenBank ID Protein 148744094 Link Image
Enzyme 22 UniProtKB/Swiss-Prot ID A5PJX7 Link Image
Enzyme 22 UniProtKB/Swiss-Prot Entry Name S6A13_BOVIN Link Image
Enzyme 22 PDB ID Not Available
Enzyme 22 Cellular Location Not Available
Enzyme 22 Gene Sequence >1809 bp
ATGGATAGCAGGGTCTCGGGCACCACCAGTAATGGCGAGACCAAACCAGTGTGCCCAGGC
CTGGAAAAGGCGGCGGAGGATGGTGCCCTGCAGCGAGAGCAGTGGAGCAACAAGATGGAG
TTCCTGCTGTCCGTGGCCGGGGAGATCATTGGGCTGGGCAACGTCTGGAGGTTCCCCTAC
CTCTGCTACAAAAACGGGGGAGGTGCCTTCTTCATCCCCTACCTCATCTTCCTCTTTACC
TGCGGCATTCCTGTCTTCCTCCTGGAGACGGCGCTGGGCCAGTACACCAGTCAGGGGGGC
ATCACTGCCTGGAGGAAGATCTGCCCCATCTTTGAGGGCATTGGCTACGCCTCCCAGATG
ATCGTCACCCTCCTCAACATCTACTACATCATTGTCCTGGCCTGGGCCCTCTTCTACCTC
TTCAGCAGCTTTACCATCGACCTGCCCTGGGGGAGCTGCCGCCACGACTGGAACACGGAG
CGCTGCGTGGAGTTCCAGAGGACCAATGGCTCTCTGAATGCGACCGCTGAGAATGCCACC
TCTCCCGTCATCGAGTTCTGGGAGCGGCGGGTCCTGAAGATCTCAGAGGGCATCCAGCAC
CTGGGGGCCCTGCGCTGGGAGCTGGCCCTGTGCCTCCTGCTTGCCTGGGTCGTCTGCTAC
TTCTGCATCTGGAAGGGCGTCAAGTCCACGGGCAAGGTGGTGTACTTCACGGCCACCTTC
CCTTACCTCATGCTGGTGGTCCTATTGATTCGAGGGGTGACGCTGCCCGGGGCAGCGCAA
GGAATTCAGTTCTACCTGTACCCAAACCTCACGCGTCTGTGGGACCCCCAGGTGTGGATG
GACGCGGGCACCCAGATCTTCTTCTCCTTTGCCATCTGCCTAGGGTGCCTGACGGCCCTG
GGCAGCTACAACAAGTATCACAACAACTGCTACAGGGACAGCATCGCGCTCTGCTTCCTC
AACAGCGGCACCAGCTTCGTGGCCGGGTTTGCCATCTTCTCCATCCTGGGCTTCATGTCC
CAAGAGCAGGGGGTGCCCATCTCTGAGGTGGCCGAGTCAGGCCCTGGCCTGGCCTTCATT
GCCTACCCCCGGGCTGTGGTGATGTTGCCCTTCTCGCCCCTCTGGGCCTGCTGCTTCTTC
TTCATGGTCGTCCTCCTGGGACTGGACAGCCAGTTCGTGTGTGTGGAAAGCCTGGTGACG
GCGCTGGTGGACATGTATCCCCGTGTGTTCCGCAAGAAGAACCGCAGGGAGGTCCTCATT
CTGGGGGTATCTGTCACCTCCTTCCTCGTCGGGCTGGTCATGCTCACAGAGGGCGGCATG
TACGTGTTCCAGCTCTTTGACTACTATGCAGCCAGCGGCATGTGCCTGCTGTTCGTGGCT
ATCTTTGAGTCCTTCTGCGTGGCGTGGGCCTATGGAGCTGGGCGCTTTTATGACAACATC
GAGGACATGATTGGGTATAGGCCGTGGCCTCTCATCAAATACTGTTGGCTCTTCCTCACA
CCGGCTGTGTGCACAGCCACCTTCCTCTTCTCCCTGATCAAGTACACCCCGCTGACCTAC
AACAAGAAGTACAAATACCCGTGGTGGGGCGATGCCCTGGGCTGGCTCCTGGCCCTCTCC
TCCATGGTCTGCATTCCTGCCTGGAGCTGCTACAAACTCAGCACCCTCAAGGGGTCTTTC
AGAGAGAGAGTTCGCCAGCTCCTGTGCCCAGCCAAGGACCTTCCCCAGGGGCACCGAGAA
GGACCCTCCGCCCCGGCCACACCCAGGACATCACTTCTCATCCTCACCGAGCTGGAGCCT
CACCACTAG
Enzyme 22 GenBank Gene ID BC142276 Link Image
Enzyme 22 GeneCard ID SLC6A13 Link Image
Enzyme 22 GenAtlas ID Not Available
Enzyme 22 HGNC ID Not Available
Enzyme 22 Chromosome Location Chromosome:1
Enzyme 22 Locus 12p13.3
Enzyme 22 SNPs SNPJam Report Link Image
Enzyme 22 General References Not Available
Enzyme 22 Metabolite References Not Available