We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Choline (BMDB00097)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-28 10:37:42
Accession Number BMDB00097
Common Name Choline
Description A basic constituent of lecithin that is found in many plants and animal organs. It is important as a precursor of acetylcholine, as a methyl donor in various metabolic processes, and in lipid metabolism. Choline is now considered to be an essential vitamin. While humans can synthesize small amounts (by converting phosphatidylethanolamine to phosphatidylcholine), it must be consumed in the diet to maintain health. Required levels are between 425 mg/day (female) and 550 mg/day (male). Milk, eggs, liver and peanuts are especially rich in choline. Most choline is found in phospholipids, namely phosphatidylcholine or lecithin. Choline can be oxidized to form betaine, which is a methyl source for many reactions (i.e. conversion of homocysteine e to methionine). Lack of sufficient amounts of choline in the diet can lead to a fatty liver condition and general liver damage. This arises from the lack of VLDL, which is necessary to transport fats away from the liver. Choline deficiency also leads to elevated serum levels of alanine amino transferase and is associated with increased incidence of liver cancer.
Synonyms
  1. (2-Hydroxyethyl)trimethyl ammonium
  2. (2-Hydroxyethyl)trimethylammonium
  3. (beta-hydroxyethyl)trimethylammonium
  4. 2-hydroxy-N,N,N-trimethylethanaminium
  5. Bilineurine
  6. Biocolina
  7. Biocoline
  8. Choline
  9. Choline cation
  10. Choline ion
  11. Cholinum
  12. Hepacholine
  13. Hormocline
  14. Lipotril
  15. N,N,N-trimethylethanolammonium
  16. Neocolina
  17. Paresan
  18. 2-hydroxy-N,N,N-trimethyl-ethanaminium
  19. N,N,N-trimethylethanol-ammonium
Chemical IUPAC Name 2-hydroxyethyl-trimethyl-ammonium
Chemical Formula C5H14NO
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Quaternary Amines
Sub Class
  • Short chain quaternary ammonium salts
Family
  • Mammalian_Metabolite
Species
  • cation; primary alcohol; quaternary ammonium salt
Biofunction
  • Essential vitamins; Component of Glycerophospholipid metabolism; Component of Glycine, serine and threonine metabolism; Component of Glycosphingolipid metabolism
Application
Source
  • Exogenous
Average Molecular Weight 104.171
Monoisotopic Molecular Weight 104.107536
Isomeric SMILES C[N+](C)(C)CCO
Canonical SMILES C[N+](C)(C)CCO
KEGG Compound ID C00114 Link Image
BioCyc ID CPD-563 Link Image
BiGG ID 33910 Link Image
Wikipedia Link Choline Link Image
METLIN ID 56 Link Image
PubChem Compound 305 Link Image
PubChem Substance 608363 Link Image
ChEBI ID 15354 Link Image
CAS Registry Number 62-49-7
InChI Identifier InChI=1/C5H14NO/c1-6(2,3)4-5-7/h7H,4-5H2,1-3H3/q+1
Synthesis Reference Hasegawa, Yoichi; Hyoda, Shunji; Sawada, Hirotoshi; Baba, Masakatsu. Preparation of high-purity organic carboxylic acid choline salts and choline. Jpn. Kokai Tokkyo Koho (1999), 9 pp.
Melting Point (Experimental) 302-303 oC (Chloride salt)
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 3.61 mg/mL [Predicted by ALOGPS]; 1000 mg/mL at 25 oC [MEYLAN,WM et al. (1996)] Calculated using ALOGPS
Physiological Charge 1
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -3.59 [Predicted by ALOGPS]; -5.16 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID 1GVM Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Show Image
Show Peaklist
BMRB Spectrum Show Image
Show Peaklist
Cellular Location
  • Cytoplasm
  • endoplasmic reticulum
  • Extracellular
  • golgi apparatus
  • mitochondria
  • nucleus
Biofluid Location
  • Breast_Milk
  • Rumen
Tissue Location
Tissue References
Basal Ganglia
Bladder
Brain
Epidermis
Fibroblasts
Hippocampus
Intestine
Kidney
Liver
Muscle
Myelin
Nerve Cells
Neuron
Placenta
Platelet
Prostate
Skeletal Muscle
Spleen
Stratum Corneum
Temporal Lobe
Testes
Thalamus
Concentrations (Normal)
Biofluid Breast_Milk
Value 106.500 uM
Age N/A
Sex N/A
Condition Normal
Comments Whole milk.
References
Biofluid Breast_Milk
Value 150 - 997 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. skim.
References
Biofluid Breast_Milk
Value 222 +/- 7 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 2% milk
References
Biofluid Breast_Milk
Value 241 +/- 16 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in skim milk
References
Biofluid Breast_Milk
Value 216 +/- 16 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 1% milk
References
Biofluid Breast_Milk
Value 221 +/- 20 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 3.25% milk
References
Biofluid Rumen
Value 17.54 +/- 6.66 uM
Age N/A
Sex N/A
Condition Normal
Comments Not Available
References
  • The rumen metabolome (in preparation)
Concentrations (Abnormal)
Biofluid Rumen
Value 24.55 +/- 12.36 uM
Age N/A
Sex N/A
Condition Rumen acidosis
Comments Not Available
References
  • The rumen metabolome (in preparation)
Pathway Names
  • Glycine, Serine and Threonine Metabolism
  • Phospholipid Synthesis
HMDB Pathways
Name Glycine, Serine and Threonine Metabolism
Image Show Link Image
Name Phospholipid Synthesis
Image Show Link Image
KEGG Pathways
Name Glycine, Serine and Threonine Metabolism
Image Show Link Image
Name Phospholipid Synthesis
Image Show Link Image
SimCell Pathways
Name Glycine, Serine and Threonine Metabolism
Image Show Link Image
Graph Show Link Image
SBML Download (XML) Link Image
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Acetylcholinesterase
  2. Phospholipase D3
  3. Cholinesterase
  4. Phospholipase D2
  5. Solute carrier family 22 member 1
  6. Choline transporter-like protein 2
  7. Choline transporter-like protein 4
  8. Choline transporter-like protein 3
  9. Sodium-coupled neutral amino acid transporter 2
  10. Solute carrier family 5 (Choline transporter), member 7
Enzyme 1 [top]
Enzyme 1 ID 529
Enzyme 1 Name Acetylcholinesterase
Enzyme 1 Synonyms
  1. AChE
Enzyme 1 Gene Name ACHE
Enzyme 1 Protein Sequence >Acetylcholinesterase
MRPPWCPLHTPSLTPPLLLLLFLIGGGAEAEGPEDPELLVMVRGGRLRGLRLMAPRGPVS
AFLGIPFAEPPVGPRRFLPPEPKRPWPGVLNATAFQSVCYQYVDTLYPGFEGTEMWNPNR
ELSEDCLYLNVWTPYPRPSSPTPVLVWIYGGGFYSGASSLDVYDGRFLTQAEGTVLVSMN
YRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVG
MHLLSPPSRGLFHRAVLQSGAPNGPWATVGVGEARRRATLLARLVGCPPGGAGGNDTELV
ACLRARPAQDLVDHEWRVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVGV
VKDEGSYFLVYGAPGFSKDNESLISRAQFLAGVRVGVPQASDLAAEAVVLHYTDWLHPED
PARLREALSDVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLSWPLWMGVPHGYE
IEFIFGLPLEPSLNYTIEERTFAQRLMRYWANFARTGDPNDPRDPKAPQWPPYTAGAQQY
VSLNLRPLEVRRGLRAQACAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKNQ
FDHYSKQDRCSDL
Enzyme 1 Number of Residues 613
Enzyme 1 Molecular Weight 67663.4
Enzyme 1 Theoretical pI 6.07
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Lipid transport and metabolism
Enzyme 1 Specific Function Terminates signal transduction at the neuromuscular junction by rapid hydrolysis of the acetylcholine released into the synaptic cleft
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • 1-30
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 115305091 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID P23795 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name ACES_BOVIN Link Image
Enzyme 1 PDB ID 1F8U Link Image
Enzyme 1 PDB File Show
Enzyme 1 3D Structure
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1842 bp
ATGAGGCCCCCGTGGTGTCCCCTGCACACGCCCTCCCTGACTCCCCCGCTCCTTCTCCTC
CTCTTCCTTCTGGGAGGAGGGGCAGAGGCCGAGGGCCCAGAGGACCCAGAGCTGCTGGTG
ATGGTGCGTGGGGGCCGACTGCGGGGTCTCCGCCTAATGGCCCCCAGGGGCCCTGTCTCT
GCTTTTCTGGGCATCCCCTTCGCAGAGCCACCTGTGGGCCCCCGTCGCTTTCTGCCACCA
GAGCCCAAGCGGCCCTGGCCAGGGGTGCTGAATGCCACGGCCTTCCAAAGCGTCTGCTAC
CAGTATGTGGACACCTTGTACCCCGGCTTTGAGGGCACTGAGATGTGGAACCCCAACCGT
GAGCTGAGTGAGGACTGCCTCTACCTCAACGTGTGGACACCGTACCCCCGGCCTTCGTCC
CCCACCCCTGTCCTCGTCTGGATCTATGGGGGTGGCTTCTACAGCGGGGCCTCCTCCCTG
GATGTGTACGATGGCCGTTTCCTGACCCAGGCTGAGGGGACTGTGCTGGTGTCCATGAAC
TACCGGGTGGGCGCCTTTGGCTTCTTGGCTCTGCCGGGGAGCCGGGAGGCCCCAGGCAAT
GTGGGGCTACTGGATCAGAGGCTGGCACTGCAGTGGGTGCAGGAGAATGTGGCAGCCTTC
GGGGGGGACCCAACGTCAGTGACTCTGTTTGGGGAAAGTGCAGGTGCCGCTTCTGTGGGC
ATGCACCTGCTGTCCCCACCCAGCCGGGGCCTGTTCCACAGGGCCGTGCTGCAGAGCGGG
GCACCCAATGGGCCCTGGGCCACGGTGGGCGTAGGAGAGGCCCGCCGGAGGGCCACACTG
CTGGCCCGCCTTGTGGGTTGTCCCCCGGGTGGGGCTGGTGGCAATGACACAGAGCTGGTG
GCCTGCCTGCGGGCACGGCCAGCTCAGGACCTGGTGGACCATGAGTGGCGCGTGCTGCCT
CAGGAAAGCGTCTTCCGCTTCTCCTTCGTGCCTGTGGTGGACGGAGACTTCCTCAGTGAC
ACACCCGAGGCCCTCATCAATGCTGGAGACTTCCATGGCCTGCAGGTGCTGGTGGGTGTG
GTGAAGGATGAGGGCTCCTATTTTCTGGTTTATGGGGCCCCAGGCTTCAGCAAAGACAAC
GAGTCTCTCATCAGCCGGGCCCAGTTCCTGGCCGGGGTGCGGGTCGGGGTCCCCCAGGCA
AGTGACCTGGCTGCCGAGGCTGTGGTCCTGCATTACACAGACTGGCTGCACCCTGAGGAC
CCAGCACGCCTGAGGGAGGCCTTGAGTGATGTGGTGGGTGACCACAACGTCGTGTGCCCC
GTGGCCCAGCTGGCTGGGCGACTGGCCGCTCAGGGCGCTCGTGTCTATGCCTACATCTTT
GAACACCGTGCATCCACGCTCTCCTGGCCCCTCTGGATGGGGGTGCCCCACGGCTACGAG
ATCGAGTTCATCTTCGGGCTCCCCCTGGAACCCTCGCTCAACTACACCATCGAGGAGAGA
ACCTTTGCCCAGCGACTGATGAGATACTGGGCCAACTTCGCCCGCACAGGAGACCCCAAT
GACCCCCGGGACCCCAAAGCCCCACAGTGGCCACCGTATACGGCGGGAGCGCAGCAGTAC
GTGAGCCTGAATCTGCGGCCTCTAGAGGTGCGGCGAGGGCTGCGAGCCCAGGCCTGCGCT
TTCTGGAATCGCTTCCTGCCCAAACTACTCAGCGCCACCGACACGCTGGACGAGGCGGAG
CGCCAGTGGAAGGCCGAGTTCCATCGCTGGAGCTCCTACATGGTGCACTGGAAGAACCAG
TTTGACCATTACAGCAAGCAGGATCGCTGCTCAGACCTGTGA
Enzyme 1 GenBank Gene ID BC123898 Link Image
Enzyme 1 GeneCard ID ACHE Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:7
Enzyme 1 Locus 7q22
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 834
Enzyme 2 Name Phospholipase D3
Enzyme 2 Synonyms
  1. PLD 3
  2. Choline phosphatase 3
  3. Phosphatidylcholine-hydrolyzing phospholipase D3
Enzyme 2 Gene Name PLD3
Enzyme 2 Protein Sequence >Phospholipase D3
MKPKLMYQELKVPAEEPASELPMNEIEAWKAAEKKARWVLLVLILAVVGFGALMTQLFLW
EYGDLHLFGPNQRPAPCYDPCEAVLVESIPEGLDFPNASTSNPSTSQAWLGLLAGAHSSL
DIASFYWTLTNNDTHTQEASAQQGEEVLRQLQTLAPRGVKVRIAVSKPNGPQPQADLQAL
LQSGAQVRMVDMQKLTHGVLHTKFWVVDQTHFYLGSANMDWRSLTQVKELGVVMYNCSCL
ARDLTKIFEAYWFLGQAGSSIPSTWPRPYDTRYNQETPMEICLNGTPALAYLASAPPPLC
PSGRTPDLKALLNVVDNARSFIYIAVMNYLPIMEFSHPRRFWPAIDDGLRRAAYERGVKV
RLLISCWGHSDPSMRAFLLSLAALRDNHTHSDIQVKLFVVPADDAQARIPYARVNHNKYM
VTERATYIGTSNWSGSYFTETAGTSLLVTQNGRGGLRSQLEAVFLRDWDSPYSHDLDAAA
DSVGNACRLL
Enzyme 2 Number of Residues 490
Enzyme 2 Molecular Weight 54618.8
Enzyme 2 Theoretical pI 6.64
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Involved in NAPE-specific phospholipase D activity
Enzyme 2 Specific Function A phosphatidylcholine + H(2)O = choline + a phosphatidate
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • 39-59
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 86820171 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q2KJJ8 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name PLD3_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1473 bp
ATGAAGCCTAAACTGATGTACCAGGAGCTGAAGGTGCCTGCTGAGGAACCTGCCAGCGAA
CTGCCCATGAATGAGATCGAGGCATGGAAAGCTGCAGAAAAGAAAGCTCGTTGGGTCCTT
CTGGTCCTTATCCTGGCAGTTGTGGGCTTCGGTGCCCTGATGACTCAGCTGTTTCTATGG
GAATACGGCGACTTGCATCTCTTTGGGCCCAATCAGCGCCCAGCCCCCTGCTATGACCCT
TGCGAAGCAGTGCTGGTGGAGAGCATTCCCGAGGGCCTGGACTTCCCCAATGCCTCCACG
AGCAACCCCTCCACCAGCCAGGCCTGGCTGGGCCTGCTCGCTGGTGCCCACAGCAGCCTG
GACATTGCCTCCTTCTACTGGACTCTCACCAACAATGACACCCACACTCAGGAAGCCTCT
GCTCAGCAGGGCGAGGAGGTCCTCCGGCAGCTGCAGACTCTGGCACCCCGAGGTGTGAAG
GTCCGCATTGCTGTGAGCAAGCCCAATGGGCCCCAGCCCCAGGCAGACCTACAGGCGCTG
CTACAGAGCGGTGCCCAGGTCCGCATGGTGGACATGCAGAAGCTGACCCATGGCGTCCTG
CATACCAAGTTCTGGGTGGTGGACCAGACCCACTTCTACCTCGGCAGTGCCAACATGGAT
TGGCGCTCCCTGACCCAGGTCAAGGAGCTGGGTGTGGTCATGTACAACTGCAGCTGCCTA
GCTCGAGACCTGACCAAGATCTTCGAGGCCTACTGGTTCCTGGGCCAGGCGGGCAGCTCC
ATCCCATCAACCTGGCCCCGGCCTTACGACACCCGCTACAATCAAGAGACTCCAATGGAA
ATCTGCCTCAACGGAACCCCTGCTCTGGCCTACCTGGCGAGTGCACCCCCACCGCTGTGT
CCGAGTGGCCGCACCCCAGACTTGAAGGCCCTGCTCAACGTGGTGGACAACGCCCGGAGT
TTCATCTACATCGCAGTCATGAACTACCTGCCCATCATGGAGTTCTCCCACCCACGCCGG
TTCTGGCCTGCCATTGACGACGGGCTGCGGCGGGCTGCCTATGAGCGGGGCGTCAAGGTA
CGCCTGCTGATCAGCTGCTGGGGACACTCTGACCCCTCAATGCGGGCCTTCCTGCTCTCC
CTGGCTGCCCTGCGTGACAACCACACCCACTCCGACATCCAGGTGAAACTCTTTGTGGTC
CCTGCGGACGATGCCCAGGCCCGAATCCCTTATGCCCGCGTCAACCATAACAAGTACATG
GTGACTGAACGGGCCACCTACATCGGAACCTCCAACTGGTCTGGCAGCTACTTCACCGAG
ACGGCAGGCACCTCGCTGCTGGTGACACAGAACGGGCGGGGTGGCCTGCGGAGCCAGCTG
GAGGCCGTGTTCCTGAGGGACTGGGACTCCCCTTATAGCCATGACCTTGACGCTGCCGCC
GACAGCGTGGGCAACGCCTGTCGCCTGCTCTGA
Enzyme 2 GenBank Gene ID BC105309 Link Image
Enzyme 2 GeneCard ID PLD3 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 19q13.2
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 835
Enzyme 3 Name Cholinesterase
Enzyme 3 Synonyms
  1. Acylcholine acylhydrolase
  2. Choline esterase II
  3. Butyrylcholine esterase
  4. Pseudocholinesterase
Enzyme 3 Gene Name BCHE
Enzyme 3 Protein Sequence >Cholinesterase
MQSRSTVIYIRFVLWFLLLWVLFEKSHTEEDIIITTKNGKVRGMHLPVLGGTVTAFLGIP
YAQPPLGRLRFKKPQSLTKWPDIWNATKYANSCYQNTDQSFPGFLGSEMWNPNTDLSEDC
LYLNVWIPTPKPKNATVMIWIYGGSFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALG
FLALPGNPEAPGNVGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPE
SHPLFTRAILQSGSSNAPWAVTSRYEARNRTLTLAKFIGCSRENDTEIIKCLRNKDPQEI
LRHEVFVVPYGTLLSVNFGPTVDGDFLTDMPDTLLQLGQFKKTQILVGVNKDEGTAFLVY
GAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYMDWLDDQRAEKYREALDDV
VGDYNIICPALEFTKKFSDMGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLER
RVNYTKAEEIFSRSIMKRWANFAKYGNPNGTQNNSTRWPVFKSNEQKYFTLNTESPKVNT
KLRAQQCRFWTLFFPKVLEITGNIDEVEREWKAGFHRWNNYMMDWKNQFNDYTSKKESCA
GL
Enzyme 3 Number of Residues 602
Enzyme 3 Molecular Weight 68866.2
Enzyme 3 Theoretical pI 8.57
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Lipid transport and metabolism
Enzyme 3 Specific Function An acylcholine + H(2)O = choline + a carboxylate
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • 1-28
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 115304881 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID P32749 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name CHLE_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1809 bp
ATGCAGAGCCGGAGTACAGTCATATACATCAGATTTGTCTTGTGGTTCCTTCTGCTCTGG
GTACTCTTTGAGAAGTCACACACTGAAGAAGACATCATAATTACCACCAAGAATGGAAAA
GTCAGGGGGATGCACTTGCCAGTACTTGGTGGCACAGTAACAGCCTTTCTTGGAATCCCG
TATGCACAGCCACCTCTTGGTAGACTACGATTCAAAAAGCCACAATCTTTGACCAAGTGG
CCTGATATTTGGAATGCCACAAAATATGCAAATTCTTGTTATCAGAACACAGATCAAAGT
TTTCCAGGCTTCCTTGGTTCAGAGATGTGGAACCCAAACACTGACCTCAGTGAAGACTGT
TTATATCTAAATGTGTGGATTCCAACACCTAAACCAAAAAATGCTACTGTAATGATATGG
ATCTACGGTGGTAGTTTTCAGACTGGAACATCATCTTTGCATGTTTATGATGGCAAGTTT
CTGGCACGGGTTGAAAGAGTTATTGTGGTTTCAATGAACTATAGAGTGGGTGCCCTCGGA
TTCTTAGCTTTACCAGGAAATCCTGAGGCACCAGGGAATGTTGGTCTATTTGATCAACAG
TTGGCTCTTCAGTGGGTCCAAAAAAACATAGCAGCCTTTGGTGGAAATCCTAAAAGTGTA
ACTCTCTTTGGAGAAAGTGCAGGAGCAGCTTCAGTTAGCCTTCATTTACTTTCTCCTGAA
AGCCACCCGTTGTTTACCAGAGCTATTCTGCAAAGTGGATCCTCTAATGCTCCTTGGGCA
GTGACATCTCGTTATGAAGCTAGGAACAGAACATTGACTTTAGCTAAATTTATTGGTTGC
TCTAGAGAAAATGACACTGAGATAATCAAATGCCTTCGAAATAAAGATCCCCAGGAGATT
CTTCGTCATGAAGTGTTTGTTGTCCCCTATGGTACACTCTTATCAGTAAATTTTGGTCCC
ACTGTGGATGGTGATTTTCTCACTGACATGCCAGACACACTACTCCAACTTGGACAGTTC
AAAAAAACCCAGATCTTGGTGGGTGTTAATAAAGATGAAGGGACAGCATTTTTAGTATAT
GGTGCTCCTGGCTTCAGCAAAGATAACAATAGTATTATAACCAGAAAAGAATTTCAAGAA
GGTTTAAAAATATTTTTTCCAGGAGTGAGTGAGTTTGGAAAGGAATCGATCCTTTTCCAC
TACATGGACTGGTTAGATGATCAGAGAGCTGAAAAGTACCGTGAGGCCTTGGATGATGTT
GTTGGGGATTATAATATCATATGTCCTGCTTTGGAGTTCACCAAAAAGTTCTCAGATATG
GGAAACAATGCCTTTTTCTACTACTTCGAGCACCGATCCTCCAAACTCCCTTGGCCAGAA
TGGATGGGAGTGATGCATGGTTATGAGATCGAATTTGTTTTTGGTTTGCCACTGGAAAGA
AGAGTTAATTACACAAAAGCTGAGGAAATTTTTAGTAGATCCATTATGAAACGTTGGGCA
AATTTTGCAAAATATGGAAATCCGAATGGGACCCAGAACAATAGTACAAGATGGCCTGTC
TTCAAAAGCAATGAACAAAAGTATTTCACCTTAAATACAGAGTCACCAAAAGTAAATACC
AAACTACGTGCTCAACAATGCCGATTCTGGACACTATTTTTTCCCAAAGTTTTGGAAATT
ACAGGAAATATTGATGAAGTAGAACGAGAATGGAAAGCAGGATTCCATCGCTGGAACAAT
TACATGATGGATTGGAAAAATCAATTTAACGATTACACTAGCAAGAAAGAAAGCTGTGCA
GGTCTCTAA
Enzyme 3 GenBank Gene ID BC123600 Link Image
Enzyme 3 GeneCard ID BCHE Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:3
Enzyme 3 Locus 3q26.1-q26.2
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 836
Enzyme 4 Name Phospholipase D2
Enzyme 4 Synonyms
  1. PLD 2
  2. Choline phosphatase 2
  3. Phosphatidylcholine-hydrolyzing phospholipase D2
Enzyme 4 Gene Name PLD2
Enzyme 4 Protein Sequence >Phospholipase D2
MAATPQSLFPSGDDLDSSQLQMEPDEVDTLKEGEDPADRMHPFLAIYHLQPLKLHPLVFA
PGVPVIAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLLRHKVF
MSLLPLARFAVASSPAPEGDSREIPSLPRAGPEGSSRRTASKQKYLENYLNRLLTMSFYR
NYHAMTEFLEVSQLSFIPDLGCKGLEGVIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYMCLETGAISFVQLFDPGFKVQVGKRSTEARYGVRVDTSHRSLILKCSSYRQAR
WWAQEITELAQGPGRDFIQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIF
ITDWWLSPEIYLKRPAHSDDWRLDIMLKKKAEEGVHVSVLLFKEVELALAINSGYSKKAL
MLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSE
SAAPQPPTSCSDLPATPDLTHNQLFWLGKDYSNLITKDWVQLDRPFDDFIDRETMPRMPW
RDIGVVVHGSPARDLARHFIQRWNFTKTTKTKYKIPIYPYLLPKSTSTANQLPFTLSGGQ
CATVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHKQGQCFRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHR
LKAAMGTEWRNYISVCGLRTHGELGGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLL
GKRDSELAVLIEDTEMEPSLMNGVEYQAGRFALSLRKHCFSVILGAAARPHLDLRDPVCD
AFFQLWQDTAESNANIYEQIFRCLPSNATRSLRALREYVVVEPLATVSPPLARSELNQVQ
GHLVHFPLKFLEDEYLLPSLGSKEGVMPLEVWT
Enzyme 4 Number of Residues 933
Enzyme 4 Molecular Weight 105765.2
Enzyme 4 Theoretical pI 7.87
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Lipid transport and metabolism
Enzyme 4 Specific Function May have a role in signal-induced cytoskeletal regulation and/or endocytosis
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 110331871 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q0V8L6 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name PLD2_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >2802 bp
ATGGCGGCAACCCCCCAGAGCCTTTTTCCCTCTGGGGATGACCTGGACTCCAGCCAGTTA
CAGATGGAGCCCGATGAGGTGGACACCCTGAAGGAGGGAGAGGACCCAGCCGACCGGATG
CATCCCTTTCTGGCCATCTACCACCTCCAGCCTCTGAAATTGCATCCCTTGGTGTTTGCC
CCTGGGGTCCCCGTCATAGCTCAGGTGGTGGGCACTGAAAGATACACCAGTGGATCCAAG
GTGGGCACGTGCACTCTGTATTCCGTCCGCTTGACTCACGGTGACTTCACCTGGACAACC
AAGAAGAAGTTCCGTCATTTCCAGGAGTTGCATCGGGACCTCCTGAGACACAAAGTCTTC
ATGAGTCTGCTCCCTCTGGCTCGTTTTGCTGTTGCTTCATCTCCAGCCCCAGAGGGAGAC
AGCAGAGAGATACCCTCTCTACCCCGAGCAGGTCCTGAGGGCTCCTCCAGACGCACCGCT
AGCAAGCAGAAATACCTGGAGAATTATCTCAACCGCCTCCTGACCATGTCTTTCTACCGC
AACTACCATGCCATGACAGAGTTCCTGGAAGTCAGTCAGCTGTCCTTTATCCCAGACCTC
GGATGCAAAGGACTGGAGGGGGTGATCCGGAAGCGCTCAGGTGGCCACCGCGTTCCTGGC
CTCACCTGCTGCGGCCGAGACCAAGTTTGTTATCGTTGGTCCAAGCGGTGGCTGGTGGTG
AAGGACTCCTTCCTGCTGTACATGTGCCTGGAGACTGGCGCCATCTCCTTTGTTCAGCTC
TTCGACCCTGGCTTCAAGGTGCAGGTGGGGAAAAGGAGTACAGAGGCACGGTACGGGGTC
CGGGTCGACACCTCTCACAGGTCCTTGATTCTCAAGTGCAGCAGCTACCGGCAGGCACGG
TGGTGGGCCCAGGAGATCACCGAGCTGGCCCAGGGCCCGGGCAGAGACTTCATTCAGCTG
CACCGGCACGACAGCTATGCTCCTCCCCGGCCTGGGACCCTAGCCCGGTGGTTTGTGAAT
GGGGCAGGTTACTTTGCTGCTGTGGCAGATGCCATCCTTCGAGCTCAAGAAGAGATTTTC
ATCACAGACTGGTGGTTGAGTCCTGAGATTTACCTGAAGCGTCCAGCCCATTCAGATGAC
TGGAGACTGGACATTATGCTCAAGAAGAAGGCGGAGGAGGGTGTCCATGTGTCTGTACTG
CTGTTCAAGGAAGTGGAGTTGGCCTTGGCCATCAACAGTGGCTACAGCAAGAAGGCACTG
ATGCTGCTGCATCCCAACATAAAGGTGATGCGCCACCCAGACCAGGTGACACTGTGGGCC
CATCATGAGAAGCTCCTGGTGGTGGACCAAGTAGTGGCCTTCCTGGGGGGGCTGGACCTT
GCCTATGGCCGCTGGGATGACCTACACTACAGACTGACTGATCTGGGGGACTCCTCTGAG
TCAGCTGCCCCCCAGCCTCCCACCTCATGCTCAGACCTTCCAGCTACCCCCGACCTCACT
CACAACCAACTCTTCTGGCTGGGCAAGGACTACAGCAATCTTATCACTAAGGACTGGGTG
CAGCTGGATCGGCCTTTTGATGATTTCATTGACAGGGAGACTATGCCACGGATGCCGTGG
CGGGACATTGGGGTGGTGGTCCACGGCTCACCTGCCCGGGACCTTGCCCGGCACTTCATC
CAGCGCTGGAATTTCACCAAGACTACCAAGACCAAGTACAAGATACCCATTTACCCCTAC
CTGCTGCCCAAATCCACCAGCACCGCAAACCAGCTCCCTTTCACACTTTCCGGAGGGCAG
TGCGCCACTGTGCAGGTCTTACGGTCAGTGGACCGCTGGTCAGCGGGCACCCTGGAGAAC
TCCATTCTCAATGCCTATCTGCACACCATCAGAGAGAGCCAGCACTTCCTCTACATTGAG
AATCAGTTCTTCATTAGCTGCTCAGATGGGCGGACAGTGCTGAACAAGGTGGGCGATGAG
ATTGTGGACAGAATCCTGAAGGCCCACAAACAGGGGCAGTGCTTCCGAGTCTACGTGCTT
TTGCCCCTGCTCCCTGGGTTCGAGGGTGACATCTCCACAGGTGGTGGTAACTCCATCCAG
GCCATTCTGCACTTCACTTACAGGACGCTGTGTCGTGGGGAATATTCAATTTTACATCGT
CTCAAAGCAGCCATGGGGACAGAATGGCGGAACTATATTTCCGTCTGTGGGCTACGCACA
CACGGAGAACTAGGCGGGCACCCAGTATCGGAGCTCATCTATATCCACAGCAAGATGCTT
ATCGCAGATGACCGGACAGTCATCATTGGCTCAGCAAACATCAATGACCGGAGCTTGCTG
GGGAAGCGAGACAGTGAGCTGGCCGTGCTGATCGAGGACACAGAAATGGAGCCATCCCTC
ATGAACGGTGTGGAGTATCAGGCAGGCAGGTTTGCCTTGAGTCTGCGGAAGCACTGCTTC
AGCGTGATTCTAGGGGCTGCTGCTCGGCCACATCTGGATCTCCGAGACCCTGTCTGTGAT
GCCTTCTTCCAGTTGTGGCAAGACACAGCTGAGAGCAATGCCAATATCTATGAGCAGATC
TTCCGATGCCTTCCATCCAATGCCACACGCTCCCTGCGGGCACTTCGGGAGTATGTAGTC
GTGGAGCCCCTGGCCACGGTCAGCCCTCCCTTGGCCCGATCTGAACTCAACCAGGTCCAG
GGCCACCTCGTCCACTTCCCCCTCAAGTTCCTGGAGGATGAGTATTTGCTGCCCTCCCTG
GGTAGCAAGGAGGGTGTGATGCCCCTAGAAGTGTGGACATAG
Enzyme 4 GenBank Gene ID BT026202 Link Image
Enzyme 4 GeneCard ID PLD2 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 17p13.1
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 1355
Enzyme 5 Name Solute carrier family 22 member 1
Enzyme 5 Synonyms
  1. Organic cation transporter 1
Enzyme 5 Gene Name SLC22A1
Enzyme 5 Protein Sequence >Solute carrier family 22 member 1
MLTVDDVLEQVGEFGWFQKQTFLILCLLSAAFAPIYVGIVFLAFTPDHRCRSPGVAELSR
RCGWSLAEELNYTVPGPGPESQCLRYEVDWNQSTLGCLDPLASLATNGSPLPLGPCEQGW
VYDTPGSSIVTEFNLVCDDSWKVDLFQSCVNLGFFLGSLGVGYIADRFGRKVCLLATTLT
CASLGVLTAVAPDYTSLLIFRLLQGLVSKGSWTAGYTLITEFVGLGYRRTVAILYQMAFT
VGLVLLSGLAYILPHWRWLQLAVSLPIFLLLFRFWFVPESPRWLLSQKRNTEAIKIMDHI
AQKNGKLPPADLKMLSLEEDVTEKLSPSFIDLFRTPNLRKYTFILMYLWFTSSVVYQGLI
MHVGATGGNLYLDFLYSALVEFPAGFIILVTIDRFGRRYPLATSNLAAGLACFLMIFIPH
DLPWLNIMVACVGRMGITIVFQMVCLVNAELFPTFIRNLGMMVCSSLCDLGGVLTPFLVF
RLMEVWQGSPLILFAALGLVAGGMTLLLPETKGVTLPETIEDAENLQRKAKPKENKIYLQ
VQTSELNTQAAERDASQGTAQQK
Enzyme 5 Number of Residues 563
Enzyme 5 Molecular Weight 62501.6
Enzyme 5 Theoretical pI 5.77
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Carbohydrate transport and metabolism
Enzyme 5 Specific Function Translocates a broad array of organic cations with various structures and molecular weights including the model compounds 1-methyl-4-phenylpyridinium (MPP), tetraethylammonium (TEA), N-1-methylnicotinamide (NMN), 4-(4-(dimethylamino)styryl)- N-methylpyridinium (ASP), the endogenous compounds choline, guanidine, histamine, epinephrine, adrenaline, noradrenaline and dopamine, and the drugs quinine, and metformin. The transport of organic cations is inhibited by a broad array of compounds like tetramethylammonium (TMA), cocaine, lidocaine, NMDA receptor antagonists, atropine, prazosin, cimetidine, TEA and NMN, guanidine, cimetidine, choline, procainamide, quinine, tetrabutylammonium, and tetrapentylammonium. Translocates organic cations in an electrogenic and pH-independent manner. Translocates organic cations across the plasma membrane in both directions. Transports the polyamines spermine and spermidine. Transports pramipexole across the basolateral membrane of the proximal tubular epithelial cells. The choline transport is activated by MMTS. Regulated by various intracellular signaling pathways including inhibition by protein kinase A activation, and endogenously activation by the calmodulin complex, the calmodulin- dependent kinase II and LCK tyrosine kinase
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • 22-42 145-165 172-192 197-219 233-253 258-278 343-363 372-392 399-418 424-446 460-480 488-508
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 154426216 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID A7MBE0 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name S22A1_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >1692 bp
ATGCTCACTGTAGATGATGTACTGGAGCAGGTTGGGGAGTTCGGTTGGTTCCAGAAGCAA
ACCTTCCTGATCCTGTGCCTGCTCTCGGCCGCCTTCGCCCCCATCTACGTGGGCATCGTC
TTCCTGGCCTTCACCCCGGACCACCGCTGCCGGAGCCCCGGGGTGGCGGAGCTGAGCCGG
CGATGCGGCTGGAGCCTGGCGGAGGAGCTCAACTACACGGTGCCAGGCCCGGGACCCGAG
AGCCAGTGCCTCCGCTACGAGGTGGACTGGAACCAGAGCACCCTTGGCTGCCTGGACCCG
CTGGCCAGCCTGGCTACCAACGGCAGCCCCCTGCCCCTGGGCCCCTGCGAGCAGGGCTGG
GTGTACGACACGCCCGGCTCCTCCATCGTGACCGAGTTTAACCTGGTGTGTGATGACTCT
TGGAAGGTGGACCTCTTTCAGTCCTGTGTGAACTTGGGCTTCTTCCTGGGCTCTCTGGGA
GTCGGCTACATCGCAGACAGGTTTGGCCGCAAGGTGTGCCTCTTGGCTACCACCCTCACC
TGCGCCAGCTTGGGCGTCCTGACGGCCGTGGCTCCGGACTACACGTCCCTGCTGATCTTC
CGCCTGCTGCAGGGGCTGGTCAGCAAGGGCAGCTGGACGGCTGGCTACACCCTGATCACG
GAGTTCGTGGGCCTGGGCTACAGACGGACAGTGGCGATCCTCTACCAGATGGCCTTCACC
GTGGGGCTGGTGCTGCTCTCCGGACTGGCCTACATCCTCCCGCACTGGCGCTGGCTGCAG
CTGGCCGTCTCCCTGCCCATCTTCCTGCTCCTCTTCCGCTTCTGGTTTGTGCCCGAGTCC
CCCCGATGGCTGTTATCGCAAAAGAGAAACACTGAGGCGATAAAGATCATGGACCACATT
GCGCAAAAGAACGGGAAGCTGCCTCCTGCTGACCTGAAGATGCTGTCTCTCGAGGAGGAC
GTCACTGAGAAGCTGAGCCCCTCATTCATAGACCTGTTCCGCACGCCCAACCTGAGGAAG
TACACCTTCATCCTGATGTACCTGTGGTTCACCAGCTCCGTGGTCTACCAGGGCCTCATC
ATGCACGTGGGCGCCACCGGCGGGAACCTCTACCTGGACTTCCTCTACTCCGCTCTGGTC
GAGTTCCCCGCAGGCTTCATCATCCTCGTCACCATCGACCGCTTCGGCCGCCGCTACCCG
CTGGCCACGTCCAACTTGGCGGCCGGGCTGGCCTGCTTCCTCATGATCTTTATCCCACAC
GATCTGCCCTGGTTGAATATCATGGTAGCTTGTGTTGGCAGAATGGGGATCACCATCGTG
TTCCAGATGGTGTGCCTGGTCAACGCCGAGCTGTTCCCGACCTTCATCCGGAACCTTGGC
ATGATGGTGTGTTCCTCCCTGTGTGATTTGGGTGGGGTTCTCACCCCGTTCCTGGTCTTC
AGGCTGATGGAGGTTTGGCAAGGCTCGCCGCTCATTTTGTTTGCGGCCTTGGGGCTGGTT
GCCGGGGGAATGACGCTGCTTCTTCCGGAGACCAAGGGGGTCACTTTGCCAGAGACCATC
GAGGATGCCGAGAACCTGCAGAGGAAAGCAAAACCCAAAGAAAACAAGATTTACCTTCAG
GTTCAAACATCAGAACTCAACACACAGGCAGCCGAGAGAGATGCTTCGCAGGGGACCGCG
CAGCAGAAGTGA
Enzyme 5 GenBank Gene ID BC151505 Link Image
Enzyme 5 GeneCard ID SLC22A1 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:6
Enzyme 5 Locus 6q26
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References Not Available
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 2082
Enzyme 6 Name Choline transporter-like protein 2
Enzyme 6 Synonyms
  1. Solute carrier family 44 member 2
Enzyme 6 Gene Name SLC44A2
Enzyme 6 Protein Sequence >Choline transporter-like protein 2
MGKEQQLYYGKHGTPQKYDPAFRGPIYNRGCTDIICCVFLFLAIVGYVAVGIIAWTHGDP
RKVIYPTDSRGQFCGQKGTKNENKPFLFYFNIVKCASPLVLLEFQCPTPQICVEKCPSRY
LTYLNAHASEDFEYYKQYCLPGFQKNKGVAEVLRDGDCPAVLIPSKPFAQRCFPAVHAHK
GILMVGNETTYEDGLGSRKNITELVEGAKKASGILEARQLAMRIFEDYTVSWYWIIIGLI
IAMVLSLLFIILLRFLAGIMVWVMIVMVILVLGYGILHCYMEYARLRGEAGSDVSLVDLG
FQTDFRVYLHLRQTWVAFMIILSIVEVIIILLLIFLRKRILIAIALIKEASRAVGYVMCS
LLYPLVTFFLLCLCIAYWASTAIFLSTSNEAVYKIFNETSCPVAGKTCNPETFPSSNESR
LCPGAHCQFAFYGGESTYHRALLGLQIFNVFMFFWLANFVLALGQVTLAGAFASYYWAMN
KPDDLPAFPLFSAFGRALRYHTGSLAFGSLLLAIVQVIRVILEYLDQRLKAAENKFAKFL
MSCLKCCFWCLEKFIKFLNRNAYIMIAIYGTNFCTSARNAFFLLMRNIIRVAVLDKVTDF
LFLLGKLLIVGSVGILAFFFFTHRIRIVQDTAPSLNYYWVPVVTVVIGSYLIAHGFFSVY
GMCVDTLFLCFLEDLERNDGTPERPYFMSLTLKKILNKTNKRQAEA
Enzyme 6 Number of Residues 706
Enzyme 6 Molecular Weight 80025.8
Enzyme 6 Theoretical pI 8.64
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Involved in transport
Enzyme 6 Specific Function Putative choline transporter
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • 34-54 233-253 257-277 316-336 365-385 458-480 505-525 564-584 600-620 639-659
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 146186615 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID A5D7H3 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name CTL2_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >2121 bp
ATGGGGAAGGAGCAGCAGCTTTATTACGGGAAGCACGGAACACCGCAGAAGTATGACCCC
GCCTTCAGAGGACCCATTTACAACAGAGGCTGCACAGATATCATTTGCTGTGTCTTCCTC
TTCCTGGCTATTGTGGGTTATGTAGCTGTAGGCATCATAGCTTGGACCCATGGAGACCCT
CGAAAGGTGATCTACCCCACTGACAGCCGAGGCCAATTCTGCGGGCAGAAGGGCACGAAG
AATGAGAACAAACCCTTCCTGTTTTATTTCAACATCGTGAAGTGTGCTAGCCCCCTGGTC
CTGCTGGAATTCCAGTGTCCCACCCCCCAGATTTGTGTGGAGAAATGTCCCAGCCGTTAC
CTCACCTACCTGAATGCTCATGCATCTGAGGACTTTGAGTACTACAAGCAGTACTGTTTA
CCTGGCTTCCAGAAAAACAAGGGTGTGGCTGAAGTCCTTCGAGATGGAGACTGCCCCGCT
GTCCTCATTCCCAGCAAACCCTTTGCCCAGCGATGTTTCCCGGCTGTCCATGCCCACAAG
GGGATCCTCATGGTGGGCAACGAGACAACCTATGAGGATGGGCTTGGCTCTCGGAAAAAC
ATCACGGAGCTGGTGGAAGGCGCCAAGAAGGCCAGTGGAATCCTGGAGGCTCGGCAGCTG
GCCATGAGGATATTTGAAGATTACACAGTCTCCTGGTACTGGATTATCATAGGCCTGATT
ATTGCCATGGTGCTGAGCCTCCTGTTCATCATCCTGCTCCGATTCTTGGCTGGCATTATG
GTCTGGGTGATGATCGTCATGGTGATCCTGGTCCTAGGCTACGGAATACTGCATTGCTAC
ATGGAGTATGCTCGGCTGCGTGGTGAGGCTGGCTCTGACGTCTCCCTGGTGGACCTTGGC
TTCCAGACGGACTTCCGAGTGTACCTGCACTTGCGGCAGACCTGGGTGGCCTTCATGATC
ATTCTGAGCATCGTTGAGGTTATTATCATCTTGCTGCTCATTTTTCTACGGAAGAGAATT
CTCATTGCCATCGCACTCATCAAAGAAGCCAGCAGGGCTGTGGGATACGTGATGTGCTCC
TTGCTGTACCCACTGGTCACCTTCTTCCTGCTGTGCCTTTGCATCGCCTACTGGGCTAGC
ACTGCTATCTTCCTGTCCACTTCCAACGAAGCTGTCTATAAGATCTTCAATGAGACCAGC
TGCCCAGTTGCTGGGAAAACCTGCAACCCCGAGACCTTCCCCTCCTCCAATGAATCCCGC
CTGTGTCCTGGAGCCCACTGCCAGTTCGCCTTCTATGGTGGTGAATCGACCTACCACCGG
GCCCTGTTGGGCCTGCAGATCTTCAACGTCTTCATGTTCTTCTGGCTGGCCAACTTCGTG
CTGGCACTGGGCCAGGTCACACTAGCCGGGGCGTTTGCCTCCTACTACTGGGCCATGAAC
AAGCCGGATGATTTGCCTGCCTTCCCGCTCTTCTCTGCCTTTGGCCGGGCGCTCAGGTAT
CACACAGGCTCCCTGGCCTTTGGCTCCCTCCTTCTGGCCATCGTGCAGGTCATCCGAGTG
ATACTGGAGTACTTGGATCAGCGCTTGAAAGCGGCAGAGAACAAGTTTGCAAAGTTCCTC
ATGAGCTGTCTCAAATGCTGCTTTTGGTGTCTGGAGAAATTCATCAAATTCCTCAACAGA
AACGCCTACATCATGATTGCCATCTACGGCACCAACTTCTGCACCTCAGCCAGAAACGCC
TTCTTCCTGCTCATGAGAAACATCATCAGGGTGGCTGTCCTGGATAAAGTCACCGACTTC
CTCTTCCTGTTGGGCAAACTTCTGATAGTCGGTAGCGTGGGGATCCTGGCTTTCTTCTTC
TTCACTCACCGAATCAGGATCGTGCAGGACACAGCACCATCCCTCAATTATTACTGGGTC
CCTGTAGTGACGGTGGTCATTGGCTCCTACCTGATCGCCCATGGCTTCTTCAGTGTCTAT
GGCATGTGTGTGGACACACTTTTCCTCTGTTTCTTGGAGGACCTGGAGAGGAACGATGGG
ACACCCGAGAGGCCTTACTTCATGTCTCTCACCCTGAAGAAGATCTTGAACAAGACCAAC
AAGAGGCAGGCGGAGGCCTAG
Enzyme 6 GenBank Gene ID BC140554 Link Image
Enzyme 6 GeneCard ID SLC44A2 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:1
Enzyme 6 Locus 19p13.1
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References Not Available
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 2083
Enzyme 7 Name Choline transporter-like protein 4
Enzyme 7 Synonyms
  1. Solute carrier family 44 member 4
Enzyme 7 Gene Name SLC44A4
Enzyme 7 Protein Sequence >Choline transporter-like protein 4
MGGKQDQDKEAYGKPAKYDPSFRGPIRNRSCTDIICCVLFFLFILGYIAVGILAWVYGDP
KQVLYPRNSTGAYCGIGENKEKPYLLYFNIFSCVLNTNIIAIAQNGLKCPTPQVCVSSCP
EASWTVEPRQFSQTVEQVFYAANRNFCLPGVPGNMQVLQSLQQELCPSFLLPSTPALGRC
FPWTNSTVPELPGISNTSISQSISGLLDSLNARDISVKIFEDFAQSWYWILIALGLALVL
SLLFILLLRLVAGPLVFVLIIGVLGVLAYGIYHCWEEYRVLRDKGASISQLGFTTNLSAY
RNVQETWLAALIILAVLEGVLLLMLIFLRQRICIAIALLKEASRAVGYIMSTMFYPLVTF
ALLLVCIAYWAIIALFLATSGQPQYVFWAPNSSLPGCEKVPMNTSCDPMEQVNSSCPGLM
CVFQGYQSTGLAQRSLFNLQIYAVLGLFWTINWVLALGQCVLAGAFASFYWAFHKPRDIP
TFPLGSAFLRTLRYHTGSLAFGALILTLVQIARVILEYIDHKLRGAQNPLTRCILCCFKC
CLWCLEKFIKFLNRNAYIMIAIYGKNFCVSAKNAFMLLMRNIVRVVVLDKVTDLLLFFGK
LLVVGGVGVLSFFFFTGRIPSLGKTFENPQLNYYWLPIMVSILGAYLIASGFFSVFGMCV
DTLFLCFLEDLERNDGSADRPYYMSKSLLKILGKKNKGTPGDKKRKK
Enzyme 7 Number of Residues 707
Enzyme 7 Molecular Weight 78937.5
Enzyme 7 Theoretical pI 8.75
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Not Available
Enzyme 7 Specific Function Not Available
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • 34-54 228-248 251-271 308-328 357-377 453-473 499-519 558-578 595-615 636-656
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 126717417 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID A3KMY4 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name CTL4_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >2124 bp
ATGGGGGGAAAACAGGACCAGGACAAGGAGGCCTACGGGAAACCAGCCAAATATGACCCC
TCCTTTCGAGGCCCCATTAGGAACAGGAGCTGCACAGATATCATCTGCTGTGTGCTCTTC
TTCCTTTTCATTCTGGGTTACATCGCCGTGGGGATCTTGGCCTGGGTGTACGGAGACCCC
AAACAAGTCCTCTACCCCAGGAACTCCACGGGGGCCTATTGCGGGATCGGGGAAAACAAA
GAGAAACCATATCTCCTATATTTCAACATCTTCAGCTGCGTCCTAAACACTAATATCATC
GCGATCGCCCAGAATGGCCTGAAGTGCCCCACGCCCCAGGTGTGTGTATCTTCCTGCCCA
GAGGCCTCATGGACCGTGGAACCGAGACAGTTCTCACAGACGGTCGAACAGGTCTTCTAC
GCAGCAAATAGGAATTTCTGTCTGCCAGGGGTGCCTGGGAACATGCAAGTACTCCAAAGC
CTACAACAGGAGCTCTGCCCCAGTTTCCTCCTGCCTTCCACTCCAGCTCTGGGGCGCTGT
TTCCCATGGACCAATAGTACCGTGCCTGAGCTCCCAGGGATCTCCAACACATCCATCTCC
CAGAGCATCAGTGGTCTTCTCGACAGCCTCAATGCCCGTGACATCAGTGTCAAGATCTTT
GAAGATTTTGCCCAGTCCTGGTATTGGATTCTTATTGCACTAGGCCTGGCTTTGGTTCTG
AGCCTGCTGTTTATCTTGCTTCTACGGCTGGTGGCCGGGCCCCTGGTGTTTGTGCTGATC
ATAGGGGTGCTGGGCGTGCTGGCGTATGGCATCTACCACTGCTGGGAAGAATATCGCGTG
CTGCGGGACAAGGGTGCCTCCATCTCCCAGCTGGGCTTCACCACCAACCTCAGTGCCTAC
AGAAACGTTCAGGAGACCTGGCTAGCCGCCTTGATCATACTGGCTGTGCTCGAAGGCGTC
CTGCTGCTGATGCTCATCTTCCTGCGGCAGCGGATTTGCATCGCCATCGCCCTCCTGAAG
GAGGCCAGCAGGGCTGTAGGATACATAATGTCCACCATGTTCTACCCGCTGGTCACCTTC
GCCCTCCTGCTTGTCTGCATTGCCTACTGGGCTATAATCGCTCTATTCCTGGCCACATCG
GGGCAACCCCAGTACGTGTTCTGGGCGCCCAACAGCAGTTTGCCCGGCTGTGAGAAAGTG
CCCATGAATACATCATGCGACCCCATGGAGCAAGTGAACTCCTCTTGTCCCGGGCTGATG
TGCGTCTTCCAGGGCTACCAGTCCACAGGCCTGGCACAGCGTTCTCTCTTCAACTTGCAA
ATCTATGCAGTTCTGGGGCTATTCTGGACCATCAACTGGGTACTGGCCCTGGGCCAGTGT
GTCCTGGCTGGGGCCTTTGCTTCCTTTTACTGGGCCTTCCACAAGCCCCGGGACATCCCT
ACCTTTCCCCTGGGCTCTGCTTTCCTGCGCACACTCCGTTACCACACGGGATCACTAGCC
TTTGGAGCCCTCATTCTGACCCTGGTGCAGATAGCTCGGGTCATCCTGGAATACATTGAC
CACAAATTGAGAGGAGCCCAGAACCCATTGACTCGCTGTATCCTGTGCTGCTTCAAGTGC
TGCCTCTGGTGTTTGGAAAAGTTCATCAAGTTCCTGAACCGCAATGCATACATCATGATT
GCCATCTACGGGAAGAACTTCTGTGTCTCAGCCAAAAACGCCTTCATGCTGCTCATGCGG
AACATTGTCAGGGTGGTCGTCCTGGACAAAGTCACAGACCTGCTACTGTTCTTTGGGAAG
CTGCTGGTGGTTGGAGGTGTCGGGGTCCTGTCCTTCTTTTTCTTCACGGGTCGCATCCCT
AGTCTGGGTAAAACCTTTGAGAATCCTCAACTCAACTATTACTGGCTGCCCATCATGGTC
TCCATCCTAGGGGCCTACCTCATCGCCAGCGGCTTCTTCAGTGTTTTTGGAATGTGTGTG
GACACTCTCTTCCTCTGTTTCTTGGAAGACTTGGAGCGGAATGATGGCTCAGCAGACCGG
CCCTACTACATGTCCAAGAGCCTTCTGAAGATTCTTGGCAAGAAGAACAAGGGGACCCCG
GGAGACAAGAAGAGGAAGAAGTGA
Enzyme 7 GenBank Gene ID BC133403 Link Image
Enzyme 7 GeneCard ID SLC44A4 Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:6
Enzyme 7 Locus 6p21.3
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References Not Available
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 2084
Enzyme 8 Name Choline transporter-like protein 3
Enzyme 8 Synonyms
  1. Solute carrier family 44 member 3
Enzyme 8 Gene Name SLC44A3
Enzyme 8 Protein Sequence >Choline transporter-like protein 3
MQCLGAEHLDSAERIPTQRQWRPQIYRKCTDTAWLFLFFLFWTGLVFIMGYSVAAGATGR
LLFGYDSFGNVCGKKNSPVEGAPLSGQDMTQKKHVFFMNSCNLEVKDVRLSSTVLCVSSC
PEEQLDTLEEVQLFANTSGSFLCVYNLNSFNYTQIPNADLLCPRLPVPPSKSFPLFNRCI
PQTPECYSLFASVLINDVDSLHRILSGIMSGRDTVLGLCILAFALSLAMMFTFRFITTLL
VHIFIALIVLGLLFVCSVLWWLYYDYTNDLSIELDTERENMKCLLGFAIVSTVITAVLLI
LIYVLRKRIKLTVELLQVTNKAISSSPFLLFQPLWTFAILIFFWVLWVAVLLSLGTAGAA
QVVEGGQVEYKPLSGIRYMWWYHLIGLIWTSEFILACQQMAVAGTVVTCYFNRNKSDPPD
RPILSSLSILFCYHQGTVVKGSFLITVVRIPRAVLMYVYNTLKEKDGALSRCVSQCCCCC
FWCLDKCLRHLNQNAYTTTAINGTDFCTSAKDALKLLSKNSSHFTSVNCFGDFIIFLGKV
LVVCFTVFGGLMAFNYHRVLQVWAVPLLLVAFFAYLVAHSFLSVFETVLDALFLCFAVDL
ETNDGSSEKPYFMDQEFLNFVKRINKLNTRAQRNKNSLTSEEGTELRPL
Enzyme 8 Number of Residues 649
Enzyme 8 Molecular Weight 73219.1
Enzyme 8 Theoretical pI 7.65
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Not Available
Enzyme 8 Specific Function Not Available
Enzyme 8 Pathways Not Available
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • None
Enzyme 8 Transmembrane Regions
  • 33-53 213-233 235-255 284-304 334-354 384-404 533-553 562-582
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 148744975 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID A5PK40 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name CTL3_BOVIN Link Image
Enzyme 8 PDB ID Not Available
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence >1950 bp
ATGCAGTGCCTCGGAGCGGAGCACCTGGATTCCGCAGAAAGAATCCCCACGCAAAGACAG
TGGCGACCTCAGATTTATAGGAAATGCACAGATACGGCATGGTTGTTCCTGTTCTTTCTC
TTCTGGACTGGTTTGGTGTTCATCATGGGCTACTCAGTGGCGGCTGGAGCCACAGGAAGA
CTCCTCTTCGGCTACGACAGCTTTGGGAATGTGTGTGGCAAGAAGAACTCCCCAGTAGAA
GGGGCTCCTCTTTCAGGGCAGGATATGACTCAAAAAAAGCACGTGTTTTTTATGAATTCC
TGCAACCTGGAAGTCAAGGATGTGAGGCTCAGTTCCACCGTTCTCTGTGTATCCAGTTGT
CCTGAAGAGCAGCTTGATACCCTGGAAGAGGTCCAGCTCTTTGCAAACACCAGTGGGTCC
TTCCTGTGTGTTTATAATTTGAATTCCTTCAACTACACCCAGATTCCAAATGCAGACTTG
CTGTGCCCCAGGCTACCAGTTCCCCCAAGCAAGTCTTTTCCCTTGTTTAATCGATGCATC
CCTCAAACTCCTGAGTGTTATTCTCTGTTTGCATCTGTTCTGATCAATGATGTGGACTCC
CTCCATCGAATTCTAAGTGGAATAATGTCAGGAAGAGACACAGTCCTCGGCCTCTGTATC
CTCGCCTTTGCCTTGTCTTTGGCCATGATGTTCACCTTCCGCTTCATCACCACCCTTCTG
GTTCACATTTTCATTGCACTGATTGTTTTGGGATTGTTGTTTGTCTGCAGTGTCTTGTGG
TGGCTGTACTATGACTATACCAATGACCTCAGCATAGAACTGGACACAGAAAGGGAAAAT
ATGAAGTGTCTGCTGGGATTTGCTATTGTATCTACAGTAATCACGGCAGTTCTACTCATC
TTGATTTATGTCCTCAGAAAGAGGATCAAATTGACAGTTGAACTTCTCCAAGTCACCAAT
AAAGCCATCAGCAGCTCTCCCTTCCTGCTGTTCCAGCCGCTGTGGACGTTTGCCATCCTC
ATTTTCTTCTGGGTCCTCTGGGTGGCTGTGCTCCTGAGCCTGGGGACTGCAGGAGCTGCA
CAGGTCGTTGAAGGTGGCCAAGTGGAATATAAGCCTCTTTCAGGCATTCGGTATATGTGG
TGGTACCATTTAATTGGCCTCATCTGGACTAGTGAATTCATCCTTGCATGCCAACAAATG
GCTGTAGCTGGGACGGTGGTGACGTGTTATTTTAACAGAAATAAAAGTGACCCTCCTGAT
CGCCCGATCCTTTCATCTCTCTCCATTCTTTTCTGCTACCATCAGGGAACAGTTGTCAAA
GGGTCATTTTTAATCACTGTGGTGAGGATTCCAAGAGCCGTTCTCATGTACGTGTATAAC
ACTCTGAAAGAGAAGGACGGTGCCTTGTCCAGGTGCGTGTCCCAGTGCTGCTGCTGCTGT
TTCTGGTGTCTGGACAAGTGCTTGCGCCATCTCAACCAGAATGCATACACTACAACTGCC
ATTAATGGGACAGATTTTTGTACATCAGCAAAAGATGCACTCAAACTCTTATCCAAGAAT
TCAAGTCATTTTACATCTGTTAACTGCTTTGGAGACTTCATAATTTTTCTAGGAAAGGTG
TTGGTGGTGTGTTTCACAGTTTTTGGAGGACTGATGGCATTTAACTACCACCGTGTGCTT
CAGGTGTGGGCAGTCCCACTGCTCTTGGTCGCTTTTTTTGCCTACTTAGTAGCCCACAGT
TTTTTATCTGTGTTTGAAACTGTGCTGGATGCACTTTTCCTGTGTTTTGCTGTTGACCTA
GAAACAAATGATGGATCCTCAGAAAAGCCCTACTTTATGGACCAAGAGTTTTTGAATTTT
GTAAAAAGGATCAACAAATTAAACACAAGGGCACAGAGAAACAAGAACTCATTAACAAGC
GAAGAGGGAACAGAACTCCGGCCATTGTGA
Enzyme 8 GenBank Gene ID BC142344 Link Image
Enzyme 8 GeneCard ID SLC44A3 Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:1
Enzyme 8 Locus 1p21.3
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References Not Available
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 2085
Enzyme 9 Name Sodium-coupled neutral amino acid transporter 2
Enzyme 9 Synonyms
  1. Amino acid transporter A2
  2. System A amino acid transporter 2
  3. System N amino acid transporter 2
  4. System A transporter 1
  5. Solute carrier family 38 member 2
  6. Protein 40-9-1
Enzyme 9 Gene Name SLC38A2
Enzyme 9 Protein Sequence >Sodium-coupled neutral amino acid transporter 2
MKKAEMGRFNISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKK
KYETDFHPGTTSFGMSVFNLSNAIVGSGILGLSYAMANTGIALFIILLTFVSIFSLYSVH
LLLKTANEGGSLLYEQLGHKAFGMVGKLTASGSITMQNIGAMSSYLFIVKYELPLVIQAL
MNIEDTNGLWYLNGDYLVLLVSLVLILPLSLLRNLGYLGYTSGLSLLCMMFFLIVVIFKK
FQISCPAEIAFLVNETVNSSLTQPATFLPDMGFNRTESDSCQPRYFIFNSQTVYAVPILT
FSFVCHPAILPIYEELKGRSRRRMMNVSKISFFAMFLMYLLAALFGYLTFYGHVESELLH
TYSSVMETDILLLIVRLAVLVAVTLTVPVVIFPIRSSITHLLCASKEFSWWRHSVITVSI
LVFTNLLVIFVPNIRDIFGFIGASAAAMLIFILPSAFYIKLVKKEPMKSVQKIGAMFFLL
SGIVVMTGSMALIVLDWVHNAPGGGH
Enzyme 9 Number of Residues 506
Enzyme 9 Molecular Weight 56213.6
Enzyme 9 Theoretical pI 7.92
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Amino acid transport and metabolism
Enzyme 9 Specific Function Functions as a sodium-dependent amino acid transporter. Mediates the saturable, pH-sensitive and electrogenic cotransport of neutral amino acids and sodium ions with a stoichiometry of 1:1. May function in the transport of amino acids at the blood- brain barrier and in the supply of maternal nutrients to the fetus through the placenta
Enzyme 9 Pathways Not Available
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • None
Enzyme 9 Transmembrane Regions
  • 77-97 103-123 159-179 189-209 218-238 293-313 330-350 372-392 414-434 437-457 475-495
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 126010778 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID A2VE31 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name S38A2_BOVIN Link Image
Enzyme 9 PDB ID Not Available
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence >1521 bp
ATGAAGAAAGCTGAAATGGGAAGGTTCAATATTTCCCCAGATGAGGACAGCAGCAGCTAT
AGTTCCAACAGCGACTTCAACTACTCCTACCCCACCAAACAAGCTGCTCTGAAAAGCCAT
TATGCCGATGTAGATCCTGAAAACCAGAACTTTTTACTTGAATCGAATTTGGGGAAGAAG
AAGTATGAAACTGACTTTCATCCAGGTACTACTTCCTTTGGAATGTCAGTATTTAATCTG
AGCAATGCGATTGTGGGCAGTGGAATCCTTGGGCTTTCTTATGCCATGGCTAATACTGGA
ATTGCTCTTTTTATAATTCTGTTGACATTTGTGTCAATATTTTCCCTGTATTCTGTTCAT
CTCCTTCTGAAGACTGCCAATGAAGGAGGGTCTTTATTATATGAACAGCTGGGACATAAA
GCATTTGGAATGGTTGGGAAGCTCACAGCATCTGGATCCATTACAATGCAGAACATTGGA
GCTATGTCAAGCTACCTCTTCATAGTGAAATATGAGTTACCTTTGGTGATCCAGGCATTA
ATGAACATTGAAGATACAAATGGATTGTGGTATCTGAACGGTGACTATTTGGTTCTGCTG
GTATCACTGGTGCTCATTCTTCCCTTGTCACTGTTGAGGAATTTAGGATATTTGGGATAT
ACCAGTGGCCTTTCCTTGCTGTGTATGATGTTCTTTCTGATTGTGGTGATTTTCAAGAAA
TTTCAGATTTCTTGTCCTGCGGAAATTGCTTTTCTAGTTAATGAAACAGTAAACAGCAGC
TTAACACAGCCAGCAACTTTTCTACCTGATATGGGTTTTAATAGGACTGAAAGTGATTCT
TGCCAACCACGTTATTTTATCTTCAACTCACAGACTGTCTACGCTGTGCCAATTCTGACC
TTTTCATTTGTCTGTCATCCTGCTATTCTTCCTATTTATGAAGAGCTTAAAGGCCGCAGC
CGTCGAAGAATGATGAATGTGTCCAAGATTTCCTTTTTTGCTATGTTTCTCATGTACCTG
CTTGCTGCCCTCTTTGGATACCTGACATTTTACGGACACGTTGAGTCAGAATTGCTTCAT
ACCTACTCTTCTGTCATGGAAACTGATATTCTGCTTCTCATTGTCCGTTTGGCTGTGTTG
GTGGCTGTCACCCTGACAGTACCTGTTGTCATTTTCCCAATCCGGAGTTCCATAACTCAT
TTGCTGTGTGCATCGAAAGAGTTCAGTTGGTGGCGTCATAGTGTCATTACAGTGTCTATC
TTGGTGTTTACCAATTTGCTTGTCATCTTTGTACCAAATATTAGGGATATCTTTGGTTTC
ATTGGTGCATCTGCAGCTGCTATGTTGATTTTTATTCTTCCATCTGCATTCTATATCAAG
TTAGTGAAGAAAGAACCTATGAAGTCTGTACAAAAGATTGGGGCTATGTTCTTTCTGCTC
AGTGGCATAGTGGTGATGACCGGAAGCATGGCCTTGATTGTGTTGGATTGGGTCCACAAT
GCCCCAGGAGGTGGCCATTAA
Enzyme 9 GenBank Gene ID BC133547 Link Image
Enzyme 9 GeneCard ID SLC38A2 Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Chromosome:1
Enzyme 9 Locus 12q
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References Not Available
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 2086
Enzyme 10 Name Solute carrier family 5 (Choline transporter), member 7
Enzyme 10 Synonyms Not Available
Enzyme 10 Gene Name SLC5A7
Enzyme 10 Protein Sequence >Solute carrier family 5 (Choline transporter), member 7
MDFQVEGLVAIVVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYVPDYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ
IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIRASVHMSVIVSALIATLYTLVGG
LYSVAYTDVVQLFCIFVGLWISVPFALSNSAVADIGFTALHTKYQKPWLGTIEPFEIYTW
LDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMALPAVLIGAIGASTAW
NQTAYGPLAPREKQEADMILPIVLKYLCPVYISYFGLGAVSAAVMSSADSSILSASSMFA
RNIYQLSFRQNASDKEIVWVMRITVFVFGASAMTMALLTKTVYGLWYLSSDLVYIIIFPQ
LLCVLFIKGTNTYGAAAGYISGLFLRVTGGEPYLNLQPLIFYPGYYIDKGGIYNQRFPFK
TLAMVTSFLSNICISYIAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVRNENIKLD
ELAPVKPRQSITLSSTFTHQEALLEMDSSPEGSGTEDNLQ
Enzyme 10 Number of Residues 580
Enzyme 10 Molecular Weight 63384.4
Enzyme 10 Theoretical pI 5.47
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Amino acid transport and metabolism
Enzyme 10 Specific Function Not Available
Enzyme 10 Pathways Not Available
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • None
Enzyme 10 Transmembrane Regions
  • None
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 86438440 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID Q2KI26 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name Q2KI26_BOVIN Link Image
Enzyme 10 PDB ID Not Available
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >1743 bp
ATGGATTTCCAGGTGGAAGGGCTGGTAGCCATCGTGGTGTTCTACCTTCTCATCTTGCTG
GTCGGCATCTGGGCCGCCTGGAGGACCAAGAACAGTGGCAGTGCGGAGGAGCGTAGCGAG
GCCATCATCGTGGGCGGCCGCGACATCGGGCTGCTGGTGGGTGGATTCACCATGACAGCC
ACCTGGGTTGGAGGAGGCTACATCAACGGGACAGCGGAGGCCGTGTATGTTCCAGATTAC
GGCTTGGCGTGGGCTCAGGCACCCATTGGATATTCTCTTAGTCTGATTTTAGGTGGTCTG
TTCTTCGCAAAACCCATGCGTTCCAAGGGCTACGTGACCATGCTAGACCCCTTCCAGCAG
ATCTATGGGAAGCGCATGGGTGGGCTGCTGTTCATCCCTGCGCTGATGGGAGAGATGTTC
TGGGCAGCAGCCATCTTCTCAGCCTTAGGAGCCACCATCAGCGTGATCATCAGGGCCAGT
GTGCACATGTCTGTCATCGTCTCTGCGCTCATCGCCACCCTGTACACCCTGGTGGGCGGG
CTGTACTCTGTGGCCTACACGGATGTCGTTCAGCTCTTTTGCATTTTCGTGGGCCTGTGG
ATCAGCGTGCCGTTTGCGCTGTCCAATTCTGCAGTTGCTGACATTGGCTTCACTGCCCTG
CACACCAAGTACCAGAAGCCCTGGCTGGGGACCATCGAGCCATTTGAAATCTACACGTGG
CTTGACAGCTTTTTGTTGTTGATGCTGGGTGGAATCCCGTGGCAAGCCTACTTCCAGAGG
GTCCTGTCTTCATCCTCCGCCACCTACGCTCAGGTGCTGTCTTTCCTGGCAGCTTTCGGG
TGCCTGGTAATGGCTCTGCCAGCCGTGCTCATTGGAGCCATTGGCGCATCGACAGCCTGG
AACCAGACTGCATACGGGCCTCTTGCTCCCAGGGAGAAACAGGAGGCAGACATGATCTTG
CCGATTGTCCTCAAGTATCTCTGCCCCGTGTACATTTCTTACTTTGGTCTTGGAGCCGTT
TCTGCTGCTGTCATGTCCTCAGCAGATTCTTCCATCTTGTCAGCAAGTTCGATGTTTGCT
CGCAACATCTACCAGCTTTCATTCAGACAAAATGCTTCTGACAAGGAGATAGTCTGGGTC
ATGCGCATCACGGTATTTGTGTTTGGAGCTTCTGCGATGACCATGGCCTTGCTAACGAAG
ACGGTGTATGGGCTCTGGTACCTCAGCTCTGACCTGGTCTACATCATCATCTTCCCGCAG
TTGCTCTGCGTGCTCTTCATCAAGGGTACCAACACGTATGGGGCCGCGGCAGGTTACATC
TCGGGCCTTTTCCTGCGAGTCACTGGCGGGGAGCCCTACCTGAACCTGCAGCCTTTGATC
TTTTACCCTGGCTATTACATTGATAAAGGTGGCATATATAACCAGAGATTCCCATTTAAA
ACCCTTGCCATGGTGACATCATTTTTATCCAACATTTGCATCTCCTATATAGCCAAATAC
CTGTTTGAAAGTGGAACCTTACCACCAAAATTGGATGTATTCGATGCTGTTGTCGCAAGG
CACAGTGAAGAAAACATGGACAAGACGATTCTGGTTAGAAATGAAAACATTAAACTAGAT
GAACTCGCACCTGTGAAGCCACGGCAGAGCATAACTCTCAGCTCGACCTTCACCCATCAG
GAGGCCCTCCTGGAAATGGATTCAAGTCCAGAGGGCTCTGGGACTGAGGATAATTTACAG
TAA
Enzyme 10 GenBank Gene ID BC112794 Link Image
Enzyme 10 GeneCard ID SLC5A7 Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:2
Enzyme 10 Locus 2q12
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References Not Available
Enzyme 10 Metabolite References Not Available