We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Citric acid (BMDB00094)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-28 10:45:17
Accession Number BMDB00094
Common Name Citric acid
Description Citric acid (citrate) is a weak acid that is formed in the tricarboxylic acid cycle or that may be introduced with diet. The evaluation of plasma citric acid is scarcely used in the diagnosis of human diseases. On the contrary urinary citrate excretion is a common tool in the differential diagnosis of kidney stones, renal tubular acidosis and it plays also a role in bone diseases. The importance of hypocitraturia should be considered with regard to bone mass, urine crystallization and urolithiasis. (PMID 12957820) The secretory epithelial cells of the prostate gland of humans and other animals posses a unique citrate-related metabolic pathway regulated by testosterone and prolactin. This specialized hormone-regulated metabolic activity is responsible for the major prostate function of the production and secretion of extraordinarily high levels of citrate. The key regulatory enzymes directly associated with citrate production in the prostate cells are mitochondrial aspartate aminotransferase, pyruvate dehydrogenase, and mitochondrial aconitase. testosterone and prolactin are involved in the regulation of the corresponding genes associated with these enzymes. The regulatory regions of these genes contain the necessary response elements that confer the ability of both hormones to control gene transcription. Protein kinase c (PKC) is the signaling pathway for the prolactin regulation of the metabolic genes in prostate cells. testosterone and prolactin regulation of these metabolic genes (which are constitutively expressed in all mammalian cells) is specific for these citrate-producing cells. (PMID 12198595) Citric acid is found in citrus fruits, most concentrated in lemons and limes, where it can comprise as much as 8% of the dry weight of the fruit. Citric acid is a natural preservative and is also used to add an acidic (sour) taste to foods and soft drinks. The salts of citric acid (citrates) can be used as anticoagulants due to their calcium chelating ability. Intolerance to citric acid in the diet is known to exist. Little information is available as the condition appears to be rare, but like other types of food intolerance it is often described as a "pseudo-allergic" reaction.
Synonyms
  1. 2-Hydroxy-1,2,3-propanetricarboxylate
  2. 2-Hydroxy-1,2,3-propanetricarboxylic acid
  3. 3-Carboxy-3-hydroxypentane-1,5-dioate
  4. 3-Carboxy-3-hydroxypentane-1,5-dioic acid
  5. Aciletten
  6. Anhydrous citrate
  7. Anhydrous citric acid
  8. Chemfill
  9. Citraclean
  10. Citrate
  11. Citretten
  12. Citric acid
  13. Citro
  14. E 330
  15. Hydrocerol A
  16. Kyselina citronova
  17. Suby G
  18. Uro-trainer
  19. beta-Hydroxytricarballylate
  20. beta-Hydroxytricarballylic acid
Chemical IUPAC Name 2-hydroxypropane-1,2,3-tricarboxylic acid
Chemical Formula C6H8O7
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Organic acids
Class
  • Tricarboxylic Acids
Sub Class
  • Short chain tricarboxylic acids
Family
  • Mammalian_Metabolite
Species
  • tertiary alcohol; carboxylic acid; alpha-hydroxyacid
Biofunction
  • Component of Glyoxylate and dicarboxylate metabolism
Application
Source
  • Endogenous
Average Molecular Weight 192.124
Monoisotopic Molecular Weight 192.027008
Isomeric SMILES OC(=O)CC(O)(CC(O)=O)C(O)=O
Canonical SMILES OC(=O)CC(O)(CC(O)=O)C(O)=O
KEGG Compound ID C00158 Link Image
BioCyc ID CIT Link Image
BiGG ID 34080 Link Image
Wikipedia Link Citric acid Link Image
METLIN ID 124 Link Image
PubChem Compound 311 Link Image
PubChem Substance 10317680 Link Image
ChEBI ID 16947 Link Image
CAS Registry Number 77-92-9
InChI Identifier InChI=1/C6H8O7/c7-3(8)1-6(13,5(11)12)2-4(9)10/h13H,1-2H2,(H,7,8)(H,9,10)(H,11,12)
Synthesis Reference Evans, D. W. S. Hydrolysis of ethyl methylenecitrate [5,5-bis(ethoxycarbonylmethyl)-1,3-dioxolan-4-one] and an attempted synthesis of agaric acid. Journal of the Chemical Society (1959), 1313-14.
Melting Point (Experimental) 153 oC
Experimental Water Solubility 592.0 mg/mL [MERCK INDEX (1989)] Source: PhysProp
Predicted Water Solubility 105.99999 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -3
State Solid
Experimental LogP/Hydrophobicity -1.64 [AVDEEF,A (1997)] Source: PhysProp
Predicted LogP/Hydrophobicity -1.33 [Predicted by ALOGPS]; -2.2 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID 1A59 Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Show Image
Show Peaklist
BMRB Spectrum Show Image
Show Peaklist
Cellular Location
  • Cytoplasm
  • Extracellular
  • mitochondria
Biofluid Location
  • Breast_Milk
Tissue Location
Tissue References
All Tissues
Concentrations (Normal)
Biofluid Breast_Milk
Value 6620 - 12900 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. range over first 90 day in lactation.
References
Biofluid Breast_Milk
Value 3026 - 9854 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw. skim.
References
Biofluid Breast_Milk
Value 8180 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw.
References
Biofluid Breast_Milk
Value 9110 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw.
References
Biofluid Breast_Milk
Value 8380 uM
Age N/A
Sex N/A
Condition Normal
Comments Raw.
References
Biofluid Breast_Milk
Value 5295 +/- 180 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 2% milk
References
Biofluid Breast_Milk
Value 5068 +/- 227 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in skim milk
References
Biofluid Breast_Milk
Value 6001 +/- 106 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 1% milk
References
Biofluid Breast_Milk
Value 5223 +/- 801 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 3.25% milk
References
Biofluid Breast_Milk
Value NA NA
Age NA
Sex NA
Condition Normal
Comments Detected but not quantified in conventional whole milk
References
Concentrations (Abnormal) Not Available
Pathway Names
  • Citrate Cycle
  • Glyoxylate and Dicarboxylate Metabolism
HMDB Pathways
Name Citrate Cycle
Image Show Link Image
Name Glyoxylate and Dicarboxylate Metabolism
Image Show Link Image
KEGG Pathways
Name Citrate Cycle
Image Show Link Image
Name Glyoxylate and Dicarboxylate Metabolism
Image Show Link Image
SimCell Pathways
Name Citrate Cycle
Image Show Link Image
Graph Show Link Image
SBML Download (XML) Link Image
Name Glyoxylate and Dicarboxylate Metabolism
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. ATP-citrate synthase
  2. Citrate synthase, mitochondrial
  3. 6-phosphofructokinase, liver type
  4. Cytoplasmic aconitate hydratase
  5. Aconitate hydratase, mitochondrial
  6. Tricarboxylate transport protein, mitochondrial
Enzyme 1 [top]
Enzyme 1 ID 175
Enzyme 1 Name ATP-citrate synthase
Enzyme 1 Synonyms
  1. ATP-citrate (pro-S-)-lyase
  2. Citrate cleavage enzyme
Enzyme 1 Gene Name ACLY
Enzyme 1 Protein Sequence >ATP-citrate synthase
MSAKAISEQTGKELLYKYICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQSLVVKPD
QLIKRRGKLGLIGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHTQEEEFY
VCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPP
PFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNE
LANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGPLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMALG
HRPIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRTDEVAPAKKAKPAMLQGKSA
TLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEILI
PVFKNMADAMKKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLI
KKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYVSRSGGMSNEL
NNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTAGVKMIVVLGEIGGTEEYKICRG
VTEGRITKPVVCWCIGTCAAMFSSEVQFGHAGACANQASETAVAKNQALKEAGVFVPRSF
DELGEIIQSVYEDLVARGVIVPAQEVPPPTVPMDYSWARELGLIRKPASFMTSICDERGQ
ELIYAGMPITEVFKEEMGIGGVLGLLWFQKRLPKYSCQFIEMCLMVTADHGPAVSGAHNT
IICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAFDSGIIPMEFVNKMKKEGKLI
MGIGHRVKSINNPDMRVQILKDYVRQHFPATPLLDYALEVEKITTSKKPNLILNVDGLIG
VAFVDMLRHCGSFTREEADEYIDIGALNGIFVLGRSMGFIGHYLDQKRLKQGLYRHPWDD
ISYVLPEHMSM
Enzyme 1 Number of Residues 1091
Enzyme 1 Molecular Weight 119788.1
Enzyme 1 Theoretical pI 7.25
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Energy production and conversion
Enzyme 1 Specific Function ATP citrate-lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. Has a central role in de novo lipid synthesis. In nervous tissue it may be involved in the biosynthesis of acetylcholine
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 79158721 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q32PF2 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name ACLY_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >3276 bp
ATGTCGGCCAAGGCGATTTCTGAGCAGACAGGCAAAGAGCTCCTCTACAAGTACATCTGC
ACCACCTCGGCCATCCAGAACCGCTTCAAGTATGCCCGGGTCACCCCTGACACAGACTGG
GCCCGCCTGTTGCAGGACCACCCGTGGCTGCTCAGCCAGAGCTTGGTGGTCAAGCCAGAC
CAGCTGATCAAACGGCGTGGAAAGCTGGGCCTAATTGGGGTCAACCTCACTCTGGATGGA
GTCAAGTCCTGGCTGAAGCCACGCCTGGGACAGGAAGCTACAGTTGGCAAGGCCACAGGC
TTCCTCAAGAACTTCCTGATCGAACCCTTCGTCCCCCACACTCAGGAGGAAGAGTTCTAC
GTCTGCATCTATGCTACCCGAGAAGGGGACTATGTCCTGTTCCACCACGAGGGTGGGGTG
GACGTGGGCGACGTGGATGCTAAAGCCCAGAAACTACTTGTCGGCGTCGATGAGAAGCTG
AATCCTGAGGACATCAAGAAACACCTGCTGGTCCACGCCCCCGAAGACAAGAAAGAAATT
CTGGCCAGCTTTATCTCCGGCCTCTTCAATTTCTATGAGGATCTGTACTTCACCTACCTC
GAGATCAACCCCCTTGTCGTGACCAAAGATGGCGTCTACGTCCTTGACTTGGCCGCCAAG
GTGGATGCCACTGCCGACTACATCTGCAAAGTGAAGTGGGGTGACATAGAGTTCCCACCC
CCCTTCGGACGGGAGGCTTACCCAGAGGAAGCCTACATCGCAGATCTGGACGCCAAAAGT
GGGGCAAGCTTGAAGCTGACTTTACTGAATCCCAAGGGGAGAATCTGGACCATGGTGGCC
GGAGGGGGTGCCTCTGTCGTGTACAGTGACACCATCTGCGACCTGGGGGGTGTCAACGAG
CTGGCAAACTACGGGGAGTACTCGGGCGCCCCCAGCGAGCAGCAGACCTATGACTACGCC
AAGACGATCCTCTCCCTTATGACCCGCGAGAAGCACCCAGATGGCAAGATCCTCATCATC
GGAGGCAGCATCGCAAACTTCACCAACGTGGCTGCCACATTCAAGGGCATCGTGAGAGCA
ATTCGAGATTACCAGGGTCCCCTGAAGGAGCACGAGGTCACGATCTTTGTCCGAAGAGGT
GGCCCCAACTATCAGGAGGGCTTACGGGTCATGGGAGAAGTCGGGAAGACCACTGGGATC
CCCATCCATGTCTTCGGCACTGAGACTCACATGACGGCCATCGTGGGCATGGCCCTGGGC
CATCGGCCCATCCCCAATCAGCCGCCCACAGCGGCCCACACCGCAAACTTCCTCCTCAAC
GCCAGCGGGAGTACTTCAACTCCAGCCCCCAGCAGGACGGCATCTTTTTCTGAGTCCAGA
ACTGATGAGGTGGCCCCTGCCAAGAAGGCCAAGCCTGCCATGCTCCAAGGAAAGAGCGCC
ACCCTCTTCAGCCGCCACACCAAGGCCATCGTGTGGGGCATGCAGACCCGGGCTGTGCAG
GGCATGCTGGACTTCGACTACGTCTGCTCCCGCGACGAGCCCTCAGTGGCTGCCATGGTC
TACCCGTTCACTGGGGACCACAAACAGAAGTTTTACTGGGGTCACAAGGAGATCCTGATC
CCCGTCTTTAAGAACATGGCTGATGCCATGAAGAAGCACCCAGAGGTAGACGTGCTAATC
AACTTTGCCTCCCTGCGCTCAGCCTACGACAGCACCATGGAGACCATGAATTACGCTCAG
ATCCGGACCATCGCCATCATAGCCGAAGGCATCCCTGAGGCGCTCACGAGGAAGCTGATC
AAGAAGGCAGACCAGAAGGGAGTGACCATCATTGGACCTGCCACCGTTGGTGGCATCAAG
CCCGGGTGCTTTAAGATCGGGAACACCGGCGGGATGCTGGACAACATCCTGGCCTCTAAG
CTGTACCGCCCAGGCAGTGTGGCCTATGTCTCGCGTTCGGGTGGCATGTCCAACGAGCTC
AACAATATCATCTCTCGAACCACAGATGGCGTCTACGAGGGCGTGGCCATTGGTGGGGAC
AGGTACCCCGGCTCAACGTTTATGGATCACGTGTTACGTTATCAGGACACTGCAGGAGTC
AAAATGATTGTGGTTCTTGGAGAGATAGGGGGCACAGAGGAGTATAAGATCTGCCGGGGC
GTCACGGAGGGCCGCATCACCAAGCCCGTGGTCTGCTGGTGCATCGGGACCTGTGCGGCC
ATGTTCTCCTCCGAGGTCCAGTTCGGCCACGCTGGAGCTTGTGCCAACCAGGCTTCTGAA
ACCGCAGTTGCCAAGAACCAGGCCTTGAAGGAGGCTGGAGTGTTTGTGCCCCGGAGCTTC
GATGAGCTTGGAGAAATCATCCAGTCCGTGTACGAGGATCTCGTGGCCAGAGGAGTCATT
GTGCCTGCTCAGGAGGTTCCGCCCCCCACAGTACCCATGGACTACTCTTGGGCCCGGGAA
TTGGGCTTGATCCGCAAACCTGCCTCGTTCATGACCAGCATCTGTGACGAGCGAGGACAG
GAGCTCATCTACGCGGGCATGCCCATCACTGAGGTCTTCAAGGAGGAGATGGGCATTGGC
GGGGTCCTCGGCCTCCTCTGGTTCCAGAAAAGGTTGCCCAAATACTCCTGCCAGTTCATT
GAGATGTGCCTGATGGTGACGGCTGATCACGGGCCTGCCGTCTCTGGGGCTCATAACACC
ATCATCTGCGCTCGAGCCGGCAAGGACCTCGTCTCCAGCCTCACCTCGGGACTGCTTACC
ATTGGCGACCGGTTTGGGGGTGCCCTGGATGCAGCAGCCAAGATGTTCAGCAAGGCCTTT
GACAGTGGTATCATCCCCATGGAGTTTGTGAACAAGATGAAGAAGGAAGGAAAGCTTATC
ATGGGCATTGGTCACCGAGTGAAGTCGATCAACAACCCAGACATGCGCGTGCAGATTCTC
AAAGATTATGTCAGACAACACTTCCCTGCCACCCCACTGCTCGACTACGCACTGGAAGTA
GAGAAGATTACCACTTCCAAGAAACCAAACCTTATCCTGAATGTGGACGGTTTAATCGGA
GTTGCATTTGTAGACATGCTTAGACACTGCGGGTCCTTCACTCGGGAGGAAGCTGATGAA
TATATTGACATTGGAGCCCTCAACGGCATCTTTGTGCTGGGAAGGAGCATGGGCTTCATT
GGACACTATCTTGATCAGAAGAGGCTGAAGCAGGGGCTCTACCGTCACCCATGGGATGAT
ATTTCATATGTTCTTCCGGAACACATGAGCATGTAA
Enzyme 1 GenBank Gene ID BC108138 Link Image
Enzyme 1 GeneCard ID ACLY Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 17q12-q21
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 362
Enzyme 2 Name Citrate synthase, mitochondrial
Enzyme 2 Synonyms Not Available
Enzyme 2 Gene Name CS
Enzyme 2 Protein Sequence >Citrate synthase, mitochondrial
MALLTAAARLFGAKNASCLVLAARHASASSTNLKDILADLIPKEQTRVKAFRQQHGKTVV
GQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGYSIPECQKLLPKAKGGEEPLPEGLF
WLLVTGQIPTEEQVSWLSQEWAKRAALPSHVVTMLDNFPTNLHPMSQLSAAVTALNSEST
FARAYSEGINRTKYWELIYEDSMDLIAKLPCVAAKIYRNLYREGSSIGAIDPKLDWSHNF
TNMLGYTDAQFTELMRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPL
HGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVLRKTDPRYTCQ
REFALKHLPQDPMFKLVAQLYKIVPNILLEQGKAKNPWPNVDAHSGVLLQYYGMTEMNYY
TVLFGVSRALGVLAQLIWSRALGFPLERPKSMSTDGLMKFVDSKSG
Enzyme 2 Number of Residues 466
Enzyme 2 Molecular Weight 51772.1
Enzyme 2 Theoretical pI 8.29
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Energy production and conversion
Enzyme 2 Specific Function Acetyl-CoA + H(2)O + oxaloacetate = citrate + CoA
Enzyme 2 Pathways
  • Carbohydrate metabolism
  • tricarboxylic acid cycle
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 88954189 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q29RK1 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name CISY_BOVIN Link Image
Enzyme 2 PDB ID 4CTS Link Image
Enzyme 2 PDB File Show
Enzyme 2 3D Structure
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1401 bp
ATGGCTTTACTCACTGCGGCCGCCCGGCTATTCGGAGCTAAGAATGCATCCTGTCTTGTT
CTTGCTGCCAGGCATGCCAGTGCTTCTTCCACGAATTTGAAAGACATATTGGCTGATCTG
ATACCTAAGGAGCAGACCAGAGTGAAGGCCTTCAGGCAGCAACATGGCAAGACGGTGGTG
GGCCAGATCACTGTGGACATGATGTATGGTGGCATGCGAGGCATGAAGGGATTGGTATAT
GAAACATCAGTTCTTGATCCTGATGAGGGCATCCGTTTTAGAGGCTACAGCATCCCTGAA
TGCCAGAAACTGCTGCCAAAGGCTAAAGGGGGCGAAGAACCCTTGCCAGAGGGCTTATTT
TGGCTGCTGGTAACTGGACAAATCCCAACAGAGGAACAGGTATCTTGGCTCTCACAGGAG
TGGGCAAAGAGGGCAGCTCTGCCTTCCCACGTGGTCACCATGCTGGACAACTTTCCCACT
AATCTACACCCCATGTCTCAGCTCAGTGCAGCTGTTACAGCTCTCAACAGTGAAAGTACC
TTTGCCCGAGCATATTCAGAGGGTATCAACCGAACCAAGTACTGGGAGTTGATTTATGAA
GACTCTATGGATCTGATCGCAAAGCTTCCTTGTGTTGCAGCAAAGATCTACCGGAACCTG
TACCGAGAGGGCAGCAGTATTGGGGCCATTGACCCTAAGCTGGACTGGTCCCACAATTTC
ACCAACATGTTAGGCTATACTGACGCTCAGTTCACAGAGCTCATGCGCTTGTACCTCACC
ATCCACAGTGACCATGAAGGTGGCAACGTAAGTGCCCACACCAGCCACTTGGTGGGCAGT
GCCCTTTCAGACCCCTATTTGTCCTTTGCAGCAGCCATGAATGGGCTGGCAGGGCCCCTG
CATGGACTGGCAAATCAGGAAGTGCTTGTTTGGCTGACACAACTTCAGAAGGAAGTTGGC
AAAGATGTGTCAGATGAGAAGTTACGAGACTACATCTGGAACACACTCAACTCAGGACGG
GTTGTCCCGGGCTATGGCCATGCAGTACTAAGGAAGACTGATCCACGATATACCTGTCAA
CGAGAGTTTGCTCTGAAACACCTGCCTCAGGACCCCATGTTTAAGCTGGTTGCTCAGCTG
TACAAGATTGTGCCCAATATCCTCCTAGAGCAGGGCAAGGCAAAGAATCCGTGGCCCAAT
GTAGATGCTCACAGCGGGGTGCTGCTCCAGTACTACGGCATGACGGAGATGAATTACTAC
ACAGTCCTGTTTGGGGTATCACGGGCACTAGGTGTATTAGCACAGCTCATTTGGAGCCGA
GCCCTAGGCTTCCCTCTAGAAAGACCCAAGTCCATGAGCACAGATGGTCTGATGAAGTTT
GTGGACTCTAAGTCAGGGTGA
Enzyme 2 GenBank Gene ID BC114138 Link Image
Enzyme 2 GeneCard ID CS Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 12q13.2-q13.3
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 479
Enzyme 3 Name 6-phosphofructokinase, liver type
Enzyme 3 Synonyms
  1. Phosphofructokinase 1
  2. Phosphohexokinase
  3. Phosphofructo-1-kinase isozyme B
  4. PFK-B
Enzyme 3 Gene Name PFKL
Enzyme 3 Protein Sequence >6-phosphofructokinase, liver type
MASVDLEKLRTTGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKQANWLSVSNIIQLGGTVIGSARCKAFTTREGRRAAAYNLVQRGITNLCVIGGDG
SLTGANIFRSEWGSLLEELVSEGKISEGTAQTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSRYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQMTKEVQK
AMDEKRFDEAIQLRGGSFENNWNIYKLLSHQKISKEKTNFSLAILNVGAPAAGMNAAVRS
AVRSGISQGHTVYVVHDGFEGLAKNQVQEVSWHDVAGWLGRGGSMLGTKRTLPKGFMEKI
VENIRLHNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IQDLKANVEHMTEKMKTEIQRGLVLRNEKCHEHYTTEFLYNLYSSEGKGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAIIWMSEKLRAVYRNGRVFANASDSACVIGLQKKVVAFS
PVTELKKDTDFEHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIETGF
Enzyme 3 Number of Residues 780
Enzyme 3 Molecular Weight 85291.0
Enzyme 3 Theoretical pI 7.39
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Carbohydrate transport and metabolism
Enzyme 3 Specific Function ATP + D-fructose 6-phosphate = ADP + D- fructose 1,6-bisphosphate
Enzyme 3 Pathways
  • Carbohydrate degradation
  • glycolysis
  • D-glyceraldehyde 3- phosphate and glycerone phosphate from D-glucose:step 3/4
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 119223906 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID A1A4J1 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name K6PL_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >2343 bp
ATGGCCAGCGTGGATCTGGAGAAGCTGCGGACCACCGGGGCTGGCAAGGCCATCGGCGTG
CTGACCAGTGGCGGTGATGCGCAAGGCATGAATGCCGCTGTCAGAGCCGTGACTCGTATG
GGCATTTACGTGGGGGCCAAGGTCTTCCTCATCTACGAGGGCTATGAAGGCCTCGTGGAG
GGCGGCGAGAACATCAAGCAGGCCAACTGGCTGAGCGTCTCCAACATCATCCAGTTGGGC
GGCACCGTCATCGGCAGCGCCCGCTGCAAGGCCTTCACCACGCGGGAGGGACGCCGGGCG
GCCGCCTACAACCTGGTCCAGCGTGGCATCACCAACCTGTGCGTCATCGGCGGGGACGGC
AGCCTCACTGGGGCCAACATCTTCCGCAGCGAGTGGGGCAGCCTCCTGGAGGAGCTGGTG
AGCGAAGGCAAGATCTCAGAGGGCACGGCTCAGACCTATTCACACCTGAACATCGCGGGG
CTGGTGGGCTCCATCGACAATGACTTCTGTGGCACCGACATGACCATCGGCACAGACTCG
GCGCTGCACCGCATCATGGAAGTCATCGACGCCATCACCACCACTGCCCAGAGCCACCAG
AGGACCTTTGTGCTGGAGGTGATGGGACGGCACTGCGGGTACCTGGCCCTGGTGTCTGCC
CTGGCCTCGGGGGCCGACTGGCTGTTCATCCCTGAGGCGCCCCCTGAGGACGGCTGGGAG
AACTTCATGTGTGAGCGGCTCGGCGAGACTCGGAGCCGAGGGTCCCGCCTCAACATTATC
ATCATTGCTGAGGGCGCCATCGACCGCAACGGGAAGCCCATCTCGTCCCGCTACGTGAAG
GACCTGGTGGTCCAGAGACTGGGCTTCGACACGCGTGTGACTGTGCTGGGCCACGTGCAG
AGGGGAGGGACCCCCTCGGCATTCGACCGCATCCTGAGCAGTAAGATGGGCATGGAGGCG
GTGATGGCGCTGCTGGAGGCCACGCCCGACACGCCGGCCTGCGTGGTCAGCCTCTCGGGG
AACCAGTCCGTGCGGCTGCCCCTCATGGAGTGTGTGCAGATGACCAAGGAGGTGCAGAAG
GCCATGGACGAGAAGAGGTTTGACGAGGCCATCCAGCTCCGAGGCGGGAGCTTTGAGAAC
AACTGGAATATTTACAAGCTGCTTTCCCACCAGAAGATCTCCAAGGAGAAGACCAACTTC
TCCCTGGCCATCCTGAACGTGGGGGCCCCAGCAGCCGGCATGAACGCGGCCGTGCGCTCG
GCGGTGCGTTCTGGCATCTCCCAGGGCCACACGGTGTACGTTGTGCATGACGGCTTTGAA
GGCCTGGCCAAGAACCAGGTGCAAGAAGTGAGCTGGCATGACGTGGCCGGCTGGCTGGGG
CGTGGTGGCTCCATGCTGGGGACAAAGAGGACGCTGCCCAAAGGCTTCATGGAGAAAATT
GTGGAAAACATCCGCCTTCACAACATCCACGCCCTGCTGGTCATCGGGGGCTTTGAGGCC
TACGAGGGGGTGCTGCAGCTGGTGGAGGCCCGTGGGCGCTATGAGGAGCTGTGCATCGTC
ATGTGCGTCATCCCCGCCACCATCAGCAACAACGTGCCAGGCACGGACTTCAGCCTGGGC
TCCGACACGGCCGTCAACGCCGCCATGGAGAGTTGTGACCGCATCAAGCAGTCGGCCTCG
GGGACCAAGCGCCGTGTGTTCATCGTGGAGACCATGGGTGGCTACTGCGGCTACCTGGCT
ACTGTGACTGGCATTGCTGTGGGCGCCGACGCTGCCTATGTCTTCGAGGATCCCTTCAAC
ATTCAAGACTTAAAGGCCAATGTGGAGCACATGACCGAGAAGATGAAGACAGAGATCCAG
CGGGGCCTGGTACTCCGGAACGAGAAGTGCCACGAGCACTACACCACAGAGTTCCTGTAC
AACCTCTACTCCTCCGAGGGCAAGGGCGTGTTTGACTGCAGGACCAACGTCCTGGGCCAC
CTGCAGCAGGGTGGAGCTCCCACCCCCTTTGACCGGAACTATGGTACCAAGCTCGGGGTG
AAAGCCATAATCTGGATGTCGGAGAAGCTGCGGGCAGTCTATCGCAATGGGCGGGTGTTT
GCCAATGCCTCTGACTCGGCCTGCGTGATTGGCCTGCAGAAGAAAGTGGTGGCCTTCAGC
CCTGTCACCGAGCTCAAGAAAGACACCGACTTTGAGCACCGCATGCCCCGGGAGCAGTGG
TGGCTGAACCTGCGGCTCATGCTGAAGATGCTGGCACACTACCGCATCAGCATGGCTGAC
TACGTGTCCGGGGAGCTGGAGCACGTCACCCGCCGCACCCTCAGCATTGAGACGGGCTTC
TGA
Enzyme 3 GenBank Gene ID BC126578 Link Image
Enzyme 3 GeneCard ID PFKL Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:2
Enzyme 3 Locus 21q22.3
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 681
Enzyme 4 Name Cytoplasmic aconitate hydratase
Enzyme 4 Synonyms
  1. Aconitase
  2. Citrate hydro-lyase
  3. Iron-responsive element-binding protein 1
  4. IRE-BP 1
Enzyme 4 Gene Name ACO1
Enzyme 4 Protein Sequence >Cytoplasmic aconitate hydratase
MSNPFAHLVEPLDPAQPGKKFFNLNKLEDSRYGSLPFSIRVLLEAAIRNCDQFLVKKNDV
ENILNWKVMQHKNIEVPFKPARVILQDFTGVPAVVDFAAMRDAVKKLGGNPEKINPICPA
DLVIDHSIQVDFNRRADSLKKNQDLEFERNKERFEFLKWGSQAFHNMRIIPPGSGIIHQV
NLEYLARVVFDQDGYYYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPISMVLP
QVIGYRLVGNPHPLVTSTDIVLTITKHLRQVGVVGKFVEFFGPGVAQLSIADRATIANMC
PEYGATAAFFPVDEVSIKYLVQTGRDKEKVKHIKQYLQAVGMFRDFSDSSQDPDFAQVVE
LDLKTVVPCCSGPKRPQDKVAVSDMKKDFESCLGAKQGFKGFQVAPDHHNDHKTFIYNNS
KFTLAHGSVVIAAITSCTNTSNPSVMLGAGLLAKKAVDAGLSVKPYIKTSLSPGSGVVTY
YLRESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEAVVEAIVQGDLVAVGVLSGNRNFEG
RVHPNTRANYLASPPLVIAYAIAGTIRIDFEKEPLGVNAKGQQVFLKDIWPTRDEIQAVE
RQYVIPGMFKEVYQKIETVNESWNALAAPSDKLYCWNPKSTYIKSPPFFEDLTLDLQPPK
SIVDAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTPREFNSYGSRRGNDAIMA
RGTFANIRLLNKFLNKQAPQTIHLPSGEILDVFDAAERYQQAGLPLIVLAGKEYGSGSSR
DWAAKGPFLLGIRAVLAESYERIHRSNLVGMGVIPLEYLPGENADTLGLTGRERYTISIP
ETLKPRMKVQIKLDTGKTFQAVMRFDTDVELTYFHNGGILNYMIRKMTK
Enzyme 4 Number of Residues 889
Enzyme 4 Molecular Weight 98203.0
Enzyme 4 Theoretical pI 8.09
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Energy production and conversion
Enzyme 4 Specific Function Binds to iron-responsive elements (IRES), which are stem-loop structures found in the 5'-UTR of ferritin, and delta aminolevulinic acid synthase mRNAs, and in the 3'-UTR of transferrin receptor mRNA. Binding to the IRE element in ferritin results in the repression of its mRNA translation. Binding of the protein to the transferrin receptor mRNA inhibits the degradation of this otherwise rapidly degraded mRNA. This protein also expresses aconitase activity (By similarity)
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 111304916 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q0VCU1 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name ACOC_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >2670 bp
ATGAGCAACCCATTTGCACACCTTGTTGAGCCTTTGGATCCTGCACAACCAGGAAAGAAG
TTCTTCAATTTGAATAAATTGGAGGATTCCAGATATGGATCCTTACCATTTTCTATCAGA
GTTCTCCTGGAGGCAGCCATTCGGAACTGTGATCAATTTTTGGTGAAGAAAAATGATGTT
GAAAATATCCTGAATTGGAAGGTCATGCAGCATAAGAACATAGAAGTGCCCTTTAAGCCT
GCCCGAGTCATCCTGCAGGACTTTACGGGTGTGCCAGCTGTGGTTGACTTTGCTGCCATG
CGTGATGCTGTGAAAAAGTTAGGAGGCAATCCAGAGAAAATAAACCCCATCTGTCCTGCT
GATCTTGTCATTGATCATTCCATCCAGGTTGATTTCAACAGAAGGGCAGACAGTTTAAAG
AAGAATCAAGACTTGGAATTTGAAAGAAATAAAGAACGATTTGAATTTTTAAAGTGGGGC
TCTCAGGCCTTTCACAACATGAGGATTATTCCACCGGGCTCAGGAATCATCCACCAGGTG
AATCTGGAGTATTTGGCAAGAGTGGTCTTTGATCAGGATGGATATTACTACCCAGACAGC
CTTGTGGGCACAGATTCGCACACCACCATGATTGATGGTTTGGGTGTCCTTGGTTGGGGT
GTGGGTGGTATCGAAGCAGAAGCTGTGATGCTGGGCCAGCCAATCAGCATGGTGCTTCCC
CAGGTGATCGGCTACAGGCTGGTGGGAAATCCCCACCCCCTGGTCACATCCACTGACATC
GTGCTCACCATCACCAAGCACCTCCGCCAGGTTGGGGTAGTAGGCAAGTTTGTCGAGTTC
TTTGGGCCAGGAGTAGCCCAACTGTCCATTGCCGACCGAGCTACAATTGCCAACATGTGT
CCAGAGTATGGGGCCACTGCCGCCTTTTTCCCAGTTGATGAAGTTAGTATCAAGTACCTG
GTGCAGACAGGTCGTGACAAAGAAAAAGTAAAGCATATTAAACAGTATCTTCAGGCTGTA
GGAATGTTTCGGGACTTCAGTGACTCCTCTCAAGACCCAGACTTTGCCCAGGTTGTGGAA
TTAGACTTGAAAACAGTAGTGCCTTGCTGCAGCGGACCCAAAAGGCCTCAGGACAAAGTT
GCCGTGTCTGATATGAAAAAGGACTTTGAGAGCTGCCTGGGGGCCAAGCAAGGATTTAAA
GGATTCCAGGTTGCTCCAGACCATCATAATGACCATAAGACATTTATCTATAATAACAGC
AAGTTCACCCTTGCTCATGGTTCTGTGGTAATCGCTGCCATTACTAGCTGCACAAACACC
AGTAATCCATCTGTGATGTTAGGGGCAGGCTTGTTAGCGAAGAAGGCTGTGGATGCAGGC
CTGAGCGTGAAGCCTTACATCAAAACTAGCCTGTCTCCTGGCAGTGGTGTGGTCACCTAC
TACCTGCGGGAAAGCGGAGTCATGCCTTACCTGTCTCAGCTTGGGTTTGACGTGGTGGGC
TATGGCTGCATGACCTGCATCGGCAACAGCGGGCCCTTACCGGAAGCTGTGGTAGAAGCC
ATCGTACAGGGGGACCTCGTAGCTGTTGGAGTACTGTCTGGGAACAGGAACTTTGAAGGG
CGAGTCCACCCCAATACCCGGGCCAACTATTTAGCCTCTCCGCCCTTAGTAATAGCCTAT
GCGATTGCTGGGACCATCAGGATCGACTTTGAGAAAGAGCCACTAGGTGTCAATGCCAAG
GGACAGCAAGTATTTCTGAAAGATATCTGGCCGACCAGAGATGAGATCCAGGCAGTGGAA
CGTCAGTACGTGATCCCTGGGATGTTTAAGGAGGTCTACCAGAAAATAGAGACTGTGAAT
GAGAGCTGGAATGCCTTAGCAGCCCCGTCAGATAAGCTATATTGCTGGAATCCCAAATCT
ACATACATTAAATCACCACCATTCTTTGAAGACCTGACTTTGGATCTTCAGCCCCCTAAG
TCTATTGTGGATGCCTATGTGCTATTAAACTTGGGAGATTCAGTAACAACAGACCACATC
TCTCCAGCTGGAAACATCGCAAGAAACAGCCCTGCTGCTCGCTACTTAACTAACAGAGGC
CTGACTCCTCGAGAATTCAACTCCTACGGCTCCCGCCGAGGGAATGATGCCATCATGGCA
CGGGGGACATTTGCCAACATCCGCTTATTAAACAAATTCTTGAACAAGCAGGCACCGCAG
ACTATCCACCTGCCTTCTGGTGAAATTCTTGACGTGTTCGACGCCGCTGAGCGGTACCAG
CAGGCGGGCCTCCCCCTCATCGTCCTGGCGGGCAAAGAGTACGGCTCGGGCAGCTCCCGA
GACTGGGCCGCCAAGGGCCCTTTCCTCCTGGGAATCAGAGCTGTCCTAGCAGAGAGTTAC
GAGCGCATTCACCGAAGTAACTTGGTCGGGATGGGGGTGATCCCTCTCGAGTACCTCCCT
GGGGAGAATGCAGACACCCTGGGACTCACTGGGCGTGAACGATACACTATTAGCATTCCA
GAAACCCTGAAACCACGAATGAAAGTCCAGATCAAGCTGGATACCGGGAAGACCTTCCAG
GCTGTCATGAGGTTTGACACCGACGTGGAGCTCACTTATTTCCATAACGGGGGCATCCTC
AACTACATGATCCGCAAGATGACCAAGTAG
Enzyme 4 GenBank Gene ID BC120006 Link Image
Enzyme 4 GeneCard ID ACO1 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:9
Enzyme 4 Locus 9p22-q32|9p21.1
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References Not Available
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 687
Enzyme 5 Name Aconitate hydratase, mitochondrial
Enzyme 5 Synonyms
  1. Aconitase
  2. Citrate hydro-lyase
Enzyme 5 Gene Name ACO2
Enzyme 5 Protein Sequence >Aconitate hydratase, mitochondrial
MAPYSLLVSRLQKALGARQYHVASVLCQRAKVAMSHFEPNEYIRYDLLEKNINIVRKRLN
RPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAV
PSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILEN
YAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSG
WTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYN
HRMKKYLSKTGRADIANLADEFKDHLVPDSGCHYDQLIEINLSELKPHINGPFTPDLAHP
VAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLQCKSQFTITPGS
EQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRN
DANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPRAEFDPG
QDTYQHPPKDSSGQQVDVSPTSQRLQLLEPFDKWDGRDLEDLQILIKVKGKCTTDHISAA
GPWLKFRGHLDNISNNLLIGAINVENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVI
GDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHP
VDKLTIKGLKDFAPGKPLTCIIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQK
Enzyme 5 Number of Residues 780
Enzyme 5 Molecular Weight 85358.7
Enzyme 5 Theoretical pI 7.90
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Energy production and conversion
Enzyme 5 Specific Function Citrate = isocitrate
Enzyme 5 Pathways
  • Carbohydrate metabolism
  • tricarboxylic acid cycle
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 1364216 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID P20004 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name ACON_BOVIN Link Image
Enzyme 5 PDB ID 1AMJ Link Image
Enzyme 5 PDB File Show
Enzyme 5 3D Structure
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >2343 bp
ATGGCGCCTTACAGCCTACTGGTGTCCCGGCTGCAGAAAGCCCTGGGTGCGCGGCAGTAC
CATGTGGCCTCAGTCCTGTGCCAACGGGCCAAGGTGGCCATGAGCCACTTTGAACCCAAT
GAGTACATCCGCTATGACCTGCTCGAGAAGAACATTAACATTGTCCGCAAACGGCTGAAC
CGGCCTCTGACCCTCTCAGAGAAGATCGTGTATGGACACCTGGATGACCCGGCCAACCAG
GAGATCGAGCGGGGCAAGACATACCTGCGGCTGCGGCCTGACCGCGTGGCCATGCGGGAT
GCCACGGCCCAGATGGCCATGCTGCAGTTCATCAGCAGCGGCCTGCCCAAGGTGGCCGTG
CCGTCCACCATCCACTGTGACCATTTGATCGAGGCCCAGCTCGGCGGGGAGAAGGACCTG
CGTCGGGCCAAGGACATAAACCAGGAAGTGTATAATTTCCTGGCCACTGCAGGTGCCAAG
TACGGCGTGGGCTTCTGGAGGCCTGGCTCTGGAATCATTCACCAGATCATTCTGGAAAAC
TATGCGTACCCTGGGGTTCTTCTGATTGGCACTGATTCCCACACCCCTAATGGCGGTGGC
CTGGGAGGCATCTGCATTGGAGTCGGGGGTGCTGATGCCGTGGACGTCACGGCTGGGATC
CCCTGGGAGTTGAAGTGCCCCAAGGTGATTGGCGTGAAGCTGACAGGCTCCCTCTCTGGC
TGGACCTCACCTAAAGATGTGATCCTGAAGGTGGCGGGTATCCTCACAGTGAAAGGTGGC
ACGGGCGCCATCGTGGAGTACCACGGGCCTGGAGTAGACTCCATCTCCTGCACCGGCATG
GCGACCATCTGCAACATGGGTGCAGAAATCGGGGCCACCACTTCGGTGTTCCCTTACAAC
CACAGGATGAAGAAATACCTGAGCAAGACAGGCCGGGCAGATATTGCCAACCTTGCTGAT
GAATTCAAGGATCACTTGGTACCTGACTCTGGCTGCCATTATGACCAACTGATTGAAATT
AACCTCAGTGAGCTGAAGCCGCACATCAATGGGCCCTTTACCCCTGACCTGGCTCACCCT
GTGGCAGAAGTGGGCAGTGTGGCAGAGAAGGAGGGGTGGCCCTTGGACATCCGAGTTGGT
CTGATTGGCAGCTGTACCAACTCCAGCTATGAAGACATGGGCCGCTCCGCAGCCGTGGCC
AAGCAGGCGCTGGCCCACGGACTCCAGTGCAAATCCCAGTTCACCATCACCCCAGGCTCG
GAGCAGATCCGCGCCACCATCGAGCGGGATGGCTATGCACAGATCCTGAGGGATGTGGGT
GGCATCGTCCTGGCCAATGCCTGCGGGCCCTGCATTGGCCAATGGGACAGGAAGGACATC
AAGAAGGGGGAGAAGAACACCATCGTCACCTCCTACAACAGGAACTTCACAGGCCGCAAC
GACGCAAATCCTGAGACCCACGCCTTCGTCACGTCCCCAGAGATTGTCACAGCCCTGGCC
ATTGCTGGCACCCTCAAGTTCAACCCAGAGACTGACTTCCTGACGGGCAAGGACGGCAAG
AAGTTCAAGCTGGAGGCTCCAGACGCAGATGAGCTTCCTCGAGCGGAGTTCGACCCCGGA
CAGGACACCTACCAGCACCCCCCCAAGGACAGCAGTGGGCAGCAGGTGGACGTGAGTCCC
ACCAGCCAGCGCCTGCAGCTCCTGGAGCCTTTCGACAAGTGGGACGGCCGAGACCTGGAG
GACCTGCAGATCCTCATCAAGGTCAAAGGGAAGTGTACCACCGACCACATCTCGGCTGCT
GGTCCCTGGCTCAAGTTCCGTGGGCACCTGGACAACATCTCCAACAACCTGCTCATTGGC
GCCATCAACGTGGAAAACGGCAAGGCCAACTCCGTGCGCAATGCCGTCACCCAGGAGTTC
GGTCCTGTCCCTGACACCGCCCGCTACTACAAGAAACACGGCATCCGGTGGGTGGTGATT
GGAGATGAAAACTATGGTGAGGGCTCGAGCCGGGAGCACGCAGCCCTGGAGCCTCGCCAC
CTCGGGGGCCGGGCCATCATCACCAAGAGCTTTGCCAGGATCCACGAAACCAACCTGAAG
AAGCAGGGCCTGCTGCCCCTCACCTTCGCTGACCCAGCTGACTACAACAAGATTCACCCT
GTGGACAAGCTGACCATCAAGGGCCTGAAGGACTTTGCCCCCGGCAAGCCGCTGACATGT
ATCATCAAGCACCCCAACGGGACCCAGGAGACCATCCTCCTGAACCACACCTTCAACGAG
ACCCAGATCGAGTGGTTCCGCGCCGGCAGCGCGCTCAACAGGATGAAGGAGCTGCAGAAG
TGA
Enzyme 5 GenBank Gene ID Z49931 Link Image
Enzyme 5 GeneCard ID ACO2 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:2
Enzyme 5 Locus 22q11.2-q13.31|22q13.2|22q13.2-q13.31
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References
  1. [PubMed Link Image]
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 2161
Enzyme 6 Name Tricarboxylate transport protein, mitochondrial
Enzyme 6 Synonyms
  1. Citrate transport protein
  2. CTP
  3. Tricarboxylate carrier protein
  4. Solute carrier family 25 member 1
Enzyme 6 Gene Name SLC25A1
Enzyme 6 Protein Sequence >Tricarboxylate transport protein, mitochondrial
MAAARAPRALTSASPGSGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSH
PPRYRGIGDCVRQTVRSHGLLGLYRGLSSLLYGSIPKAAVRFGTFEFLSNHMRDAQGRLD
STRGLLCGLGAGVPEAVVVVCPMETIKVKFIHDQTSASPKYRGFFHGVREIVREQGLKGT
YQGLTATVLKQGSNQGIRFFVMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTP
LDVIKTRMQGLEAHKYRNTLDCGLQILRNEGLKAFYKGTVPRLGRVCLDVAIVFIIYDEV
VKLLNKVWKAD
Enzyme 6 Number of Residues 311
Enzyme 6 Molecular Weight 33876.1
Enzyme 6 Theoretical pI 10.41
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Involved in binding
Enzyme 6 Specific Function Involved in citrate-H(+)/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD+ for the glycolytic pathway
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • 29-46 86-105 129-143 183-202 224-241 278-297
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 1765906 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID P79110 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name TXTP_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >936 bp
ATGGCTGCGGCTCGCGCACCCCGCGCTCTGACCTCTGCCTCGCCTGGGTCTGGGAAAGCC
AAACTGACACACCCAGGGAAGGCGATCCTAGCAGGCGGCCTGGCTGGCGGCATCGAAATC
TGCATCACTTTCCCCACCGAGTACGTGAAGACGCAGCTGCAGCTGGACGAGCGCTCGCAC
CCGCCGCGCTACCGGGGCATCGGGGACTGCGTGCGGCAGACGGTTCGCAGCCATGGGCTC
CTGGGCCTGTACCGCGGCCTTAGCTCCCTGCTCTACGGCTCCATCCCCAAGGCGGCCGTC
AGGTTCGGGACGTTCGAATTTCTCAGCAACCACATGCGGGACGCCCAGGGACGGCTGGAC
AGCACGCGCGGGCTGCTGTGCGGCCTGGGCGCCGGAGTGCCAGAGGCCGTGGTGGTCGTG
TGCCCCATGGAGACCATCAAGGTGAAATTTATCCATGACCAGACCTCTGCCAGCCCCAAA
TACCGAGGATTCTTCCACGGGGTCAGGGAGATCGTGCGGGAACAGGGGCTGAAGGGGACG
TATCAAGGCCTCACAGCCACCGTGCTGAAGCAGGGATCCAATCAGGGCATCCGCTTCTTC
GTCATGACTTCCCTGCGCAACTGGTACCGAGGAGACAACCCCAACAAACCCATGAACCCA
CTGATCACTGGTGTGTTCGGAGCCATCGCAGGCGCAGCCAGTGTCTTCGGGAACACTCCA
CTGGACGTGATCAAGACCCGGATGCAGGGACTGGAAGCACACAAGTACCGGAACACGTTG
GACTGCGGCCTGCAGATCCTGAGGAACGAGGGACTCAAGGCGTTCTACAAGGGCACTGTC
CCGCGCCTCGGCCGAGTCTGCCTGGACGTGGCCATCGTGTTCATCATCTACGACGAGGTG
GTGAAGCTTCTCAACAAAGTGTGGAAGGCGGACTGA
Enzyme 6 GenBank Gene ID X97773 Link Image
Enzyme 6 GeneCard ID SLC25A1 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:2
Enzyme 6 Locus 22q11.21
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References
  1. [PubMed Link Image]
Enzyme 6 Metabolite References Not Available