We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Dimethylglycine (BMDB00092)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-05 20:57:41
Accession Number BMDB00092
Common Name Dimethylglycine
Description Dimethylglycine (DMG) is an amino acid derivative found in the cells of all plants and animals and can be obtained in the diet in small amounts from grains and meat. The human body produces DMG when metabolizing choline into Glycine. Dimethylglycine that is not metabolized in the liver is transported by the circulatory system to body tissue. Dimethylglycine was popular with Russian athletes and cosmonauts owing to its reputed ability to increase endurance and reduce fatigue. DMG is also a byproduct of homocysteine metabolism. Homocysteine and betaine are converted to methionine and N, N-dimethylglycine by betaine-homocysteine methyltransferase.
Synonyms
  1. (Dimethylamino)acetate
  2. (Dimethylamino)acetic acid
  3. 2-(Dimethylamino)acetate
  4. 2-(Dimethylamino)acetic acid
  5. Dimethylglycine
  6. N,N-Dimethylaminoacetate
  7. N,N-Dimethylaminoacetic acid
  8. N,N-Dimethylglycine
  9. N-Methylsarcosine N,N-dimethyl-Glycine
Chemical IUPAC Name 2-dimethylaminoacetic acid
Chemical Formula C4H9NO2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Amino Acids
Sub Class
  • NA
Family
  • Mammalian_Metabolite
Species
  • tertiary amine; tertiary aliphatic amine (trialkylamine); carboxylic acid
Biofunction
  • Component of Glycine, serine and threonine metabolism; Component of Methionine metabolism
Application
Source
  • Endogenous
Average Molecular Weight 103.120
Monoisotopic Molecular Weight 103.063332
Isomeric SMILES CN(C)CC(O)=O
Canonical SMILES CN(C)CC(O)=O
KEGG Compound ID C01026 Link Image
BioCyc ID DIMETHYL-GLYCINE Link Image
BiGG ID 36652 Link Image
Wikipedia Link Dimethylglycine Link Image
METLIN ID 277 Link Image
PubChem Compound 673 Link Image
PubChem Substance 6436203 Link Image
ChEBI ID 17724 Link Image
CAS Registry Number 1118-68-9
InChI Identifier InChI=1/C4H9NO2/c1-5(2)3-4(6)7/h3H2,1-2H3,(H,6,7)
Synthesis Reference Lai, Mei-Chin; Wang, Chia-Chi; Chuang, Ming-Jen; Wu, Yen-Chi; Lee, Yu-Chien. Effects of substrate and potassium on the betaine-synthesizing enzyme glycine sarcosine dimethylglycine N-methyltransferase from a halophilic methanoarchaeon Methanohalophilus po
Melting Point (Experimental) 185.5 oC
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 298.0 mg/mL [MEYLAN,WM et al. (1996)]; 939.00006 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity -2.91 [TSAI,RS ET AL. (1991)] Source: PhysProp
Predicted LogP/Hydrophobicity -1.70 [Predicted by ALOGPS]; -0.6 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID 1EL5 Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Show Image
Show Peaklist
Cellular Location
  • Cytoplasm
  • mitochondria
Biofluid Location Not Available
Tissue Location
Tissue References
Kidney
Liver
Concentrations (Normal) Not Available
Concentrations (Abnormal) Not Available
Pathway Names
  • Glycine, Serine and Threonine Metabolism
HMDB Pathways
Name Glycine, Serine and Threonine Metabolism
Image Show Link Image
KEGG Pathways
Name Glycine, Serine and Threonine Metabolism
Image Show Link Image
SimCell Pathways
Name Glycine, Serine and Threonine Metabolism
Image Show Link Image
Graph Show Link Image
SBML Download (XML) Link Image
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Betaine--homocysteine S-methyltransferase 1
Enzyme 1 [top]
Enzyme 1 ID 1057
Enzyme 1 Name Betaine--homocysteine S-methyltransferase 1
Enzyme 1 Synonyms Not Available
Enzyme 1 Gene Name BHMT
Enzyme 1 Protein Sequence >Betaine--homocysteine S-methyltransferase 1
MAPAGGKNVKKGILERLNSGEVIIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLH
REFLRAGSNVMQTFTFYASEDKLENRGNYVAEKISGQKVNEAACDIARQVADEGDALVAG
GVSQTPSYLSCKSETEVKKVFQQQLEVFVKKNVDFLIAEYFEHVEEAVWAVEALKASGKP
VAATMCIGPEGDLHSVTPGECAVRLVKAGASIVGVNCHFDPTISLQTVKLMKEGLEAAGL
KAHLMSQPLAYHTPDCGKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRYIGGCC
GFEPYHIRAIAEELAPERGFLPLASEKHGSWGSGLDMHTKPWIRARARKEYWENLQIASG
RPYNPSMSKPDAWGVTKGTAELMQQKEATTEQQLRELFEKQKFKSAQ
Enzyme 1 Number of Residues 407
Enzyme 1 Molecular Weight 44877.9
Enzyme 1 Theoretical pI 6.84
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Amino acid transport and metabolism
Enzyme 1 Specific Function Involved in the regulation of homocysteine metabolism. Converts betaine and homocysteine to dimethylglycine and methionine, respectively. This reaction is also required for the irreversible oxidation of choline
Enzyme 1 Pathways
  • Amino-acid biosynthesis
  • L-methionine biosynthesis via de novo pathway
  • L-methionine from L-homocysteine (BhmT route):step 1/1
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 57222553 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q5I597 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name BHMT1_BOVIN Link Image
Enzyme 1 PDB ID 1UMY Link Image
Enzyme 1 PDB File Show
Enzyme 1 3D Structure
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1224 bp
ATGGCACCGGCTGGGGGCAAAAATGTCAAGAAGGGCATCCTAGAACGGCTAAACTCTGGA
GAGGTCATCATCGGAGACGGAGGGTTTGTCTTTGCGCTGGAGAAGAGGGGCTACGTGAAG
GCAGGGCCCTGGACCCCAGAAGCTGCTGTGGAACACCCAGAAGCAGTTCGCCAACTTCAT
CGAGAGTTCCTCAGAGCTGGCTCGAATGTCATGCAGACCTTCACCTTCTATGCCAGTGAA
GACAAGCTGGAGAACAGGGGGAACTATGTTGCAGAGAAAATATCCGGGCAGAAAGTCAAT
GAAGCCGCTTGTGACATTGCCCGGCAAGTGGCTGATGAAGGAGATGCTTTGGTAGCAGGG
GGTGTGAGCCAGACACCTTCGTACCTTAGCTGCAAGAGCGAAACTGAAGTCAAAAAAGTC
TTTCAGCAACAGTTAGAGGTCTTCGTAAAGAAGAACGTGGACTTCTTGATCGCAGAGTAT
TTTGAACATGTTGAAGAGGCTGTATGGGCAGTTGAAGCCTTGAAAGCATCAGGGAAACCA
GTGGCGGCAACTATGTGCATCGGCCCAGAGGGAGACTTGCACAGCGTGACCCCTGGCGAG
TGTGCAGTGCGCCTGGTTAAAGCAGGAGCTTCCATCGTGGGGGTAAACTGCCATTTTGAC
CCCACAATTAGCTTACAGACAGTGAAGCTCATGAAAGAAGGCTTGGAGGCTGCCGGACTG
AAAGCCCACCTCATGAGCCAGCCCTTGGCCTACCACACTCCTGACTGCGGCAAGCAGGGG
TTTATTGACCTGCCAGAATTCCCCTTTGGACTGGAACCCAGAGTTGCAACCAGATGGGAT
ATTCAAAAGTATGCCAGAGAGGCCTACAACCTGGGGGTCAGGTACATAGGTGGGTGCTGT
GGATTTGAACCCTACCACATCAGGGCAATTGCAGAGGAGCTGGCTCCGGAGAGGGGATTT
TTGCCACTGGCTTCAGAAAAACATGGCAGCTGGGGAAGTGGTTTGGATATGCACACCAAA
CCCTGGATTAGAGCCAGGGCCAGGAAGGAATACTGGGAGAATCTTCAGATAGCCTCGGGC
AGGCCGTACAACCCTTCCATGTCAAAGCCGGACGCCTGGGGAGTGACCAAAGGAACAGCC
GAGCTTATGCAGCAGAAGGAAGCCACAACGGAGCAGCAGCTGAGAGAGCTCTTCGAAAAA
CAGAAGTTCAAGTCTGCACAGTAG
Enzyme 1 GenBank Gene ID AY854632 Link Image
Enzyme 1 GeneCard ID BHMT Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:5
Enzyme 1 Locus 5q13.1-q15
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available