We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Dimethylamine (BMDB00087)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-08-27 12:29:37
Accession Number BMDB00087
Common Name Dimethylamine
Description Dimethylamine (DMA) is an organic secondary amine. It is a colorless, liquefied and flammable gas with an ammonia and fish-like odor. Dimethylamine is abundantly present in human urine. Main sources of urinary DMA have been reported to include trimethylamine N-oxide, a common food component, and asymmetric dimethylarginine (ADMA), an endogenous inhibitor of nitric oxide (NO) synthesis. ADMA is excreted in the urine in part unmetabolized and in part after hydrolysis to DMA by dimethylarginine dimethylaminohydrolase (DDAH). Statistically significant increases in urinary DMA have been found in individuals after the consumption of fish and seafoods. The highest values were obtained for individuals that consumed coley, squid and whiting with cod, haddock, sardine, skate and swordfish (PMID: 18282650). As a pure chemical substance Dimethylamine is used as dehairing agent in tanning, in dyes, in rubber accelerators, in soaps and cleaning compounds and as an agricultural fungicide. In the body, DMA also undergoes nitrosation under weak acid conditions to give dimethlynitrosamine.
Synonyms
  1. Dimethylamine
  2. Dimethylamine anhydrous
  3. N,N-Dimethylamine
  4. N-Methylmethanamine
  5. N-methyl-Methanamine
  6. Dimethylamine solution
  7. Dimethylamine anhydrous (dot)
  8. Dimethylamine hydrobromide
  9. Dimethylamine aqueous solution
  10. N-methylmethanamine (ACD/Name 4.0)
Chemical IUPAC Name N-methylmethanamine
Chemical Formula C2H7N
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amines
Class
  • Aliphatic and Aryl Amines
Sub Class
  • Tertiary aliphatic amines
Family
  • Mammalian_Metabolite
Species
  • secondary amine; secondary aliphatic amine (dialkylamine)
Biofunction
  • Osmolyte
Application
Source
  • Endogenous
Average Molecular Weight 45.084
Monoisotopic Molecular Weight 45.057850
Isomeric SMILES CNC
Canonical SMILES CNC
KEGG Compound ID C00543 Link Image
BioCyc ID DIMETHYLAMINE Link Image
BiGG ID Not Available
Wikipedia Link Dimethylamine Link Image
METLIN ID 3758 Link Image
PubChem Compound 674 Link Image
PubChem Substance 3824 Link Image
ChEBI ID 17170 Link Image
CAS Registry Number 124-40-3
InChI Identifier InChI=1/C2H7N/c1-3-2/h3H,1-2H3
Synthesis Reference Zones, Stacey I.; Burton, Allen W. Production of methylamine and dimethylamine using STI zeolite catalysts. U.S. Pat. Appl. Publ. (2007), 6pp.
Melting Point (Experimental) -92.2 oC
Experimental Water Solubility 1630 mg/mL at 40 oC [SCHWEIZER,AE et al. (1978)] Source: PhysProp
Predicted Water Solubility 516.0 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 1
State Liquid
Experimental LogP/Hydrophobicity -0.38 [HANSCH,C ET AL. (1995)] Source: PhysProp
Predicted LogP/Hydrophobicity -0.53 [Predicted by ALOGPS]; -0.2 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm
Biofluid Location Not Available
Tissue Location
Tissue References
Fibroblasts
Neuron
Concentrations (Normal) Not Available
Concentrations (Abnormal) Not Available
Pathway Names Not Available
HMDB Pathways Not Available
KEGG Pathways Not Available
SimCell Pathways Not Available
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
  2. N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
Enzyme 1 [top]
Enzyme 1 ID 611
Enzyme 1 Name N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
Enzyme 1 Synonyms
  1. Dimethylarginine dimethylaminohydrolase 2
  2. DDAH-2
  3. DDAHII
  4. Dimethylargininase-2
Enzyme 1 Gene Name DDAH2
Enzyme 1 Protein Sequence >N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
MGTPGEGLGRCSHALIRGVPESLASGEGAAAGLPALDLAKAQREHGVLGGKLRQRLGLQL
VELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEMGDE
NATLDGTDVLFTGREFFVGLSKWTNHRGAEIVADTFRDFAVSTVPVTSTSHLRGLCGMGG
PRTVVAGSSEAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLRPGQPGLPPFLLHRGGG
DLPNSQEALQKLSDVTLVPVSCSELEKAGAGLSSLCLVLSTRPHN
Enzyme 1 Number of Residues 285
Enzyme 1 Molecular Weight 29779.7
Enzyme 1 Theoretical pI 5.90
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Amino acid transport and metabolism
Enzyme 1 Specific Function Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in nitric oxide generation
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 74356281 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q3SX44 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name DDAH2_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >858 bp
ATGGGGACGCCAGGGGAGGGGCTGGGCCGCTGCTCCCATGCCCTGATCCGGGGGGTCCCG
GAGAGCCTGGCGTCGGGGGAGGGTGCAGCAGCTGGCCTCCCAGCTCTGGACCTAGCCAAA
GCTCAGAGGGAACATGGGGTGCTGGGGGGTAAGCTGAGGCAGCGATTGGGGCTGCAACTA
GTAGAACTGCCTCCTGAAGAGTCGCTGCCGCTGGGACCGCTGCTCGGTGACACCGCCGTG
ATCCAAGGGGATACGGCTCTAATCACGCGGCCCTGGAGCCCCGCCCGCAGGCCGGAGGTC
GATGGAGTCCGCAAAGCCCTCCAGGACCTGGGGCTCCGAATTGTGGAGATGGGGGACGAG
AACGCAACGCTGGATGGCACTGATGTTCTCTTCACCGGCCGGGAGTTTTTCGTAGGCCTC
TCCAAGTGGACCAATCACCGAGGAGCTGAGATCGTGGCGGACACGTTCCGGGACTTTGCC
GTCTCCACGGTGCCCGTCACAAGCACCTCCCACCTGCGTGGCCTCTGCGGTATGGGGGGA
CCCCGCACCGTGGTGGCGGGTTCCAGCGAAGCTGCCCAAAAAGCTGTCAGGGCAATGGCA
GTGTTGACTGATCACCCCTATGCCTCCCTGACCCTCCCGGATGACGCAGCAGCTGACTGT
CTCTTTCTGCGTCCTGGGCAGCCCGGCCTGCCCCCTTTCCTCCTGCACCGGGGAGGCGGG
GACCTGCCCAACAGCCAAGAGGCACTGCAGAAGCTCTCTGACGTCACCCTCGTACCTGTG
TCCTGTTCAGAACTGGAGAAGGCCGGCGCTGGGCTCAGTTCCCTCTGCCTGGTGCTCAGC
ACACGCCCCCACAACTGA
Enzyme 1 GenBank Gene ID BC104509 Link Image
Enzyme 1 GeneCard ID DDAH2 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:6
Enzyme 1 Locus 6p21.3
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 612
Enzyme 2 Name N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
Enzyme 2 Synonyms
  1. Dimethylarginine dimethylaminohydrolase 1
  2. DDAH-1
  3. DDAHI
  4. Dimethylargininase-1
Enzyme 2 Gene Name DDAH1
Enzyme 2 Protein Sequence >N(G),N(G)-dimethylarginine dimethylaminohydrolase 1
MASLGHPATFGRATHVVVRALPESLAQQALRRTKGDEVDFARAERQHQLYVGVLGSKLGL
QVVQLPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEADMMKEALEKLQLNIVEMK
DENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVVDALHLKSFCSM
AGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDTAANCIYLNIPSKGHVLLHRTPE
EYPESAKVYEKLKDHMLIPVSNSELEKVDGLLTCSSVLINKKVDS
Enzyme 2 Number of Residues 285
Enzyme 2 Molecular Weight 31288.6
Enzyme 2 Theoretical pI 5.88
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Amino acid transport and metabolism
Enzyme 2 Specific Function Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in nitric oxide generation
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 151554584 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID P56965 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name DDAH1_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >858 bp
ATGGCTTCTCTCGGCCACCCAGCCACCTTTGGCCGGGCCACCCATGTCGTGGTACGGGCG
CTGCCCGAGTCCCTCGCCCAACAGGCGCTGAGGCGCACCAAGGGCGACGAGGTGGATTTC
GCCCGCGCTGAGCGGCAGCACCAGCTCTACGTGGGCGTGCTGGGCAGTAAACTGGGGCTG
CAGGTGGTGCAGCTGCCCGCCGACGAGAGCCTCCCAGACTGCGTGTTCGTGGAGGACGTG
GCCGTGGTGTGCGAGGAGACGGCCCTGATCACCCGCCCCGGGGCGCCGAGCCGGAGGAAG
GAGGCTGACATGATGAAAGAAGCACTAGAAAAACTTCAGCTCAACATAGTAGAGATGAAA
GATGAAAATGCAACTTTAGATGGTGGAGATGTCTTATTCACAGGCAGAGAATTTTTTGTG
GGCCTTTCCAAAAGGACAAATCAACGAGGTGCGGAAATCTTGGCTGATACTTTTAAGGAC
TATGCGGTCTCCACGGTCCCTGTGGTGGATGCTTTGCACTTGAAGAGTTTCTGCAGCATG
GCTGGGCCTAACCTAATCGCTATTGGATCCAGTGAATCTGCACAGAAGGCCCTCAAGATC
ATGCAACAGATGAGTGATCATCGCTACGACAAACTCACAGTGCCTGATGACACGGCCGCA
AACTGCATATACCTGAATATCCCCAGCAAAGGCCACGTCTTGCTGCACCGAACCCCAGAA
GAGTACCCAGAGAGTGCAAAGGTTTATGAAAAGCTGAAGGACCATATGCTGATCCCCGTG
AGCAATTCTGAACTGGAAAAGGTGGACGGGCTGCTCACCTGCAGCTCGGTTTTAATTAAC
AAGAAAGTAGACTCCTGA
Enzyme 2 GenBank Gene ID BC149998 Link Image
Enzyme 2 GeneCard ID DDAH1 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 1p22
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available