We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Epinephrine (BMDB00068)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-19 14:05:21
Accession Number BMDB00068
Common Name Epinephrine
Description Epinephrine is a catecholamine, a sympathomimetic monoamine derived from the amino acids phenylalanine and tyrosine. It is the active sympathomimetic hormone secreted from the adrenal medulla in most species. It stimulates both the alpha- and beta- adrenergic systems, causes systemic vasoconstriction and gastrointestinal relaxation, stimulates the heart, and dilates bronchi and cerebral vessels. It is used in asthma and cardiac failure and to delay absorption of local anesthetics. Epinephrine also constricts arterioles in the skin and gut while dilating arterioles in leg muscles. It elevates the blood sugar level by increasing hydrolysis of glycogen to glucose in the liver, and at the same time begins the breakdown of lipids in adipocytes. Epinephrine has a suppressive effect on the immune system.
Synonyms
  1. (-)-(R)-Epinephrine
  2. (-)-3,4-Dihydroxy-a-[2-(methylamino)ethyl]benzyl alcohol
  3. (-)-3,4-dihydroxy-a-[(methylamino)methyl]-Benzyl alcohol
  4. (-)-Adrenaline
  5. (-)-Epinephrine
  6. (R)-4-[1-hydroxy-2-(methylamino)ethyl]-1,2-Benzenediol
  7. (R)-Adrenaline
  8. (R)-Epinephrine
  9. 4-[(1R)-1-hydroxy-2-(methylamino)ethyl]-1,2-Benzenediol
  10. Adnephrine
  11. Adrenal
  12. Adrenalin
  13. Adrenaline
  14. Adrenine
  15. Adrin
  16. Ana-Kit
  17. Bosmin
  18. Bronkaid Mist
  19. Chelafrin
  20. Epifrin
  21. Epiglaufrin
  22. Epinefrina
  23. Epinephran
  24. Epinephrine
  25. Epipen
  26. Epirenan
  27. Eppy
  28. Exadrin
  29. Glauposine
  30. Hemisine
  31. Hemostasin
  32. Hemostatin
  33. Hypernephrin
  34. Isoptoepinal
  35. L-Adrenaline
  36. L-Methylaminoethanolcatechol
  37. Levoepinephrine
  38. Levorenen
  39. Levorenin
  40. Levorenine
  41. Levoreninum
  42. Lyodrin
  43. Methylarterenol
  44. Mucidrina
  45. Nephridine
  46. Nieraline
  47. Paranephrin
  48. Primatene Mist
  49. R-(-)-Epinephrine
  50. Renaglandin
  51. Renaleptine
  52. Renalina
  53. Renoform
  54. Renostypticin
  55. Renostyptin
  56. Scurenaline
  57. Simplene
  58. Styptirenal
  59. Supracapsulin
  60. Supranephrane
  61. Suprarenaline
  62. Suprarenin
  63. Surrenine
  64. Sus-phrine
  65. Takamina
  66. Vasoconstrictine
  67. Vasotonin
  68. l-1-(3,4-Dihydroxyphenyl)-2-methylaminoethanol
  69. l-Epinephrine
  70. l-Epirenamine
  71. (-)-3,4-Dihydroxy-alpha-[2-(methylamino)ethyl]benzyl alcohol
  72. (-)-3,4-dihydroxy-alpha-[(methylamino)methyl]-Benzyl alcohol
Chemical IUPAC Name 4-[(1R)-1-hydroxy-2-methylamino-ethyl]benzene-1,2-diol
Chemical Formula C9H13NO3
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Alcohols
Class
  • Catecholamines and Derivatives
Sub Class
  • Epinephrines
Family
  • Mammalian_Metabolite
Species
  • secondary alcohol; 1,2-aminoalcohol; phenol or hydroxyhetarene; 1,2-diphenol; secondary amine; secondary aliphatic amine (dialkylamine); aromatic compound
Biofunction
Application
Source
  • Endogenous
Average Molecular Weight 183.204
Monoisotopic Molecular Weight 183.089539
Isomeric SMILES CNC[C@H](O)C1=CC=C(O)C(O)=C1
Canonical SMILES CNCC(O)C1=CC=C(O)C(O)=C1
KEGG Compound ID C00788 Link Image
BioCyc ID L-EPINEPHRINE Link Image
BiGG ID 35997 Link Image
Wikipedia Link Epinephrine Link Image
METLIN ID 5127 Link Image
PubChem Compound 5816 Link Image
PubChem Substance 8144253 Link Image
ChEBI ID 28918 Link Image
CAS Registry Number 51-43-4
InChI Identifier InChI=1/C9H13NO3/c1-10-5-9(13)6-2-3-7(11)8(12)4-6/h2-4,9-13H,5H2,1H3/t9-/m0/s1
Synthesis Reference Singer, Robert A.; Carreira, Erick M. An in situ procedure for catalytic, enantioselective acetate aldol addition. Application to the synthesis of (R)-(-)-epinephrine. Tetrahedron Letters (1997), 38(6), 927-930.
Melting Point (Experimental) 211.5 oC
Experimental Water Solubility 0.18 mg/mL [YALKOWSKY,SH & DANNENFELSER,RM (1992)] Source: PhysProp
Predicted Water Solubility 18.6 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 1
State Solid
Experimental LogP/Hydrophobicity -1.37 [HANSCH,C & LEO,AJ (1985)] Source: PhysProp
Predicted LogP/Hydrophobicity -0.82 [Predicted by ALOGPS]; 0.256 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm
  • Extracellular
Biofluid Location Not Available
Tissue Location
Tissue References
Adipose Tissue
Adrenal Cortex
Adrenal Gland
Adrenal Medulla
Bladder
Epidermis
Eye Lens
Fibroblasts
Gonads
Gut
Intestine
Kidney
Liver
Muscle
Myelin
Nerve Cells
Nervous Tissues
Neuron
Pancreas
Placenta
Platelet
Concentrations (Normal) Not Available
Concentrations (Abnormal) Not Available
Pathway Names
  • Catecholamine Biosynthesis
  • Tyrosine Metabolism
HMDB Pathways
Name Catecholamine Biosynthesis
Image Show Link Image
Name Tyrosine Metabolism
Image Show Link Image
KEGG Pathways
Name Tyrosine Metabolism
Image Show Link Image
SimCell Pathways
Name Tyrosine Metabolism
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Cytochrome P450 11B1, mitochondrial
  2. Cholesterol side-chain cleavage enzyme, mitochondrial
  3. Prostaglandin E2 receptor EP4 subtype
  4. Pituitary adenylate cyclase-activating polypeptide type I receptor
  5. Beta-2 adrenergic receptor
  6. Beta-1 adrenergic receptor
  7. Steroidogenic factor 1
Enzyme 1 [top]
Enzyme 1 ID 10
Enzyme 1 Name Cytochrome P450 11B1, mitochondrial
Enzyme 1 Synonyms
  1. CYPXIB1
  2. P450C11
  3. Steroid 11-beta-hydroxylase
Enzyme 1 Gene Name CYP11B1
Enzyme 1 Protein Sequence >Cytochrome P450 11B1, mitochondrial
MALWAKARVRMAGPWLSLHEARLLGTRGAAAPKAVLPFEAMPRCPGNKWMRMLQIWKEQS
SENMHLDMHQTFQELGPIFRYDVGGRHMVFVMLPEDVERLQQADSHHPQRMILEPWLAYR
QARGHKCGVFLLNGPQWRLDRLRLNPDVLSLPALQKYTPLVDGVARDFSQTLKARVLQNA
RGSLTLDIAPSVFRYTIEASTLVLYGERLGLLTQQPNPDSLNFIHALEAMLKSTVQLMFV
PRRLSRWMSTNMWREHFEAWDYIFQYANRAIQRIYQELALGHPWHYSGIVAELLMRADMT
LDTIKANTIDLTAGSVDTTAFPLLMTLFELARNPEVQQAVRQESLVAEARISENPQRAIT
ELPLLRAALKETLRLYPVGITLEREVSSDLVLQNYHIPAGTLVKVLLYSLGRNPAVFARP
ESYHPQRWLDRQGSGSRFPHLAFGFGVRQCLGRRVAEVEMLLLLHHVLKNFLVETLEQED
IKMVYRFILMPSTLPLFTFRAIQ
Enzyme 1 Number of Residues 503
Enzyme 1 Molecular Weight 57846.8
Enzyme 1 Theoretical pI 9.73
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Secondary metabolites biosynthesis, transport and catabolism
Enzyme 1 Specific Function Has steroid 11-beta-hydroxylase activity. In addition to this activity, the 18 or 19-hydroxylation of steroids and the aromatization of androstendione to estrone have also been ascribed to cytochrome P450 XIB
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 217535 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID P15150 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name C11B1_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1512 bp
ATGGCACTGTGGGCAAAGGCCAGGGTGCGGATGGCAGGGCCCTGGCTGTCCCTGCATGAG
GCACGCCTACTGGGCACCAGAGGTGCTGTAGCCCCCAAGGCGGTGCTGCCCTTCGAAGCC
ATGCCCCGGTGTCCTGGCAACAAGTGGATGCGGATGCTGCAGATCTGGAAGGAGCAGGGT
TCTGAGAACATGCACTTGGACATGCATCAGACCTTCCAGGAGCTGGGGCCCATTTTCAGG
TACGACGTGGGAGGGAGACACATGGTGTTCGTGATGCTGCCCGAGGACGTGGAGAGGCTG
CAGCAGGCGGACAGCCGTCACCCTCAGCGGATGATCCTGGAGCCCTGGCTGGCCTACCGA
CAGGCTCGCGGGCACAAGTGTGGCGTGTTCTTGCTCAATGGGCCCCAGTGGCGTTTGGAC
CGACTGCGGCTGAACCCAGACGTCCTCTCGCTGCCAGCCCTGCAGAAGTACACGCCCTTG
GTGGATGGCGTGGCCAGGGACTTCTCCCAGACCCTGAAGGCGAGGGTGCTGCAGAATGCT
CGGGGGAGTCTGACCCTGGACATCGCGCCCAGCGTCTTCCGCTACACCATCGAAGCCAGC
ACCTTAGTCCTTTACGGGGAGCGGCTTGGCCTTTTGACCCAGCAACCAAACCCTGACAGC
CTGAACTTTATCCACGCGCTGGAGGCCATGTTGAAGTCCACCGTGCAGCTCATGTTTGTG
CCCAGGCGCCTGTCACGGTGGATGAGCACCAACATGTGGAGGGAGCACTTTGAGGCCTGG
GACTACATCTTCCAGTATGCCAACAGAGCCATCCAGAGAATCTATCAGGAGCTGGCCCTC
GGCCACCCGTGGCACTACAGCGGCATCGTGGCAGAGCTGCTGATGCGAGCAGACATGACC
CTGGATACCATCAAGGCCAACACGATCGACCTCACTGCTGGGAGTGTGGACACGACAGCC
TTCCCCTTGCTGATGACTCTCTTTGAGCTGGCTCGGAACCCGGAGGTGCAGCAGGCGGTG
CGCCAGGAGAGCCTGGTGGCTGAGGCCCGGATCTCAGAAAATCCCCAGAGGGCCATCACG
GAGCTGCCTTTGCTGCGGGCGGCCCTCAAGGAGACCTTGAGGCTGTACCCCGTGGGTATC
ACCTTGGAGCGGGAAGTGAGCTCGGACCTGGTGCTGCAGAACTACCACATCCCAGCTGGG
ACGCTGGTGAAGGTCCTACTCTATTCCCTGGGTCGAAACCCCGCCGTGTTCGCCAGGCCT
GAGAGCTATCACCCCCAGCGCTGGCTGGACCGCCAGGGCTCTGGAAGCAGATTCCCGCAC
CTGGCCTTTGGCTTTGGCGTACGCCAGTGCCTGGGGCGGCGCGTGGCCGAGGTGGAGATG
CTGCTCCTGCTGCACCATGTGCTGAAGAACTTCCTGGTGGAGACACTGGAGCAAGAGGAC
ATAAAGATGGTCTACCGCTTCATACTGATGCCCTCCACCCTGCCCCTCTTCACCTTCCGG
GCCATCCAGTAG
Enzyme 1 GenBank Gene ID D00361 Link Image
Enzyme 1 GeneCard ID CYP11B1 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:8
Enzyme 1 Locus 8q21
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 53
Enzyme 2 Name Cholesterol side-chain cleavage enzyme, mitochondrial
Enzyme 2 Synonyms
  1. Cytochrome P450 11A1
  2. CYPXIA1
  3. P450(scc)
  4. Cholesterol desmolase
Enzyme 2 Gene Name CYP11A1
Enzyme 2 Protein Sequence >Cholesterol side-chain cleavage enzyme, mitochondrial
MLARGLPLRSALVKACPPILSTVGEGWGHHRVGTGEGAGISTKTPRPYSEIPSPGDNGWL
NLYHFWREKGSQRIHFRHIENFQKYGPIYREKLGNLESVYIIHPEDVAHLFKFEGSYPER
YDIPPWLAYHRYYQKPIGVLFKKSGTWKKDRVVLNTEVMAPEAIKNFIPLLNPVSQDFVS
LLHKRIKQQGSGKFVGDIKEDLFHFAFESITNVMFGERLGMLEETVNPEAQKFIDAVYKM
FHTSVPLLNVPPELYRLFRTKTWRDHVAAWDTIFNKAEKYTEIFYQDLRRKTEFRNYPGI
LYCLLKSEKMLLEDVKANITEMLAGGVNTTSMTLQWHLYEMARSLNVQEMLREEVLNARR
QAEGDISKMLQMVPLLKASIKETLRLHPISVTLQRYPESDLVLQDYLIPAKTLVQVAIYA
MGRDPAFFSSPDKFDPTRWLSKDKDLIHFRNLGFGWGVRQCVGRRIAELEMTLFLIHILE
NFKVEMQHIGDVDTIFNLILTPDKPIFLVFRPFNQDPPQA
Enzyme 2 Number of Residues 520
Enzyme 2 Molecular Weight 60332.4
Enzyme 2 Theoretical pI 9.15
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Secondary metabolites biosynthesis, transport and catabolism
Enzyme 2 Specific Function Catalyzes the side-chain cleavage reaction of cholesterol to pregnenolone
Enzyme 2 Pathways
  • Lipid metabolism
  • C21-steroid hormone metabolism
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 162951 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID P00189 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name CP11A_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1563 bp
.AGCAGCAGCTGTGGGGGCAGCATGCTAGCAAGGGGGCTTCCCCTCCGCTCAGCCCTGGT
CAAAGCCTGCCCACCCATCCTGAGCACAGTGGGGGAGGGCTGGGGCCACCACAGGGTGGG
CACTGGAGAGGGAGCTGGCATCTCCACAAAGACCCCTCGCCCCTACAGTGAGATCCCCTC
CCCTGGTGACAATGGCTGGCTTAACCTCTACCATTTCTGGAGGGAGAAGGGCTCACAGAG
AATCCACTTTCGCCACATCGAGAACTTCCAGAAGTATGGCCCCATTTACAGGGAGAAGCT
TGGCAATTTGGAGTCAGTTTATATCATTCACCCTGAAGACGTGGCCCATCTCTTCAAGTT
CGAGGGATCCTACCCAGAGAGATATGACATCCCGCCCTGGCTGGCCTATCACCGATATTA
TCAGAAACCCATTGGAGTCCTGTTTAAGAAGTCAGGAACCTGGAAGAAAGACCGGGTGGT
CCTGAACACGGAGGTGATGGCTCCAGAGGCAATAAAGAACTTCATCCCACTGCTGAATCC
AGTGTCTCAGGACTTCGTCAGCCTCCTGCACAAGCGCATCAAGCAGCAGGGCTCCGGAAA
GTTTGTAGGGGACATCAAGGAAGACCTGTTTCACTTTGCCTTTGAGTCCATCACCAATGT
CATGTTTGGGGAGCGCCTGGGGATGCTGGAGGAGACAGTGAACCCCGAGGCCCAGAAGTT
CATTGATGCCGTCTACAAGATGTTCCACACCAGTGTCCCTCTGCTCAACGTCCCTCCAGA
ACTGTACCGTCTATTCAGAACCAAGACTTGGAGGGACCATGTAGCCGCATGGGACACAAT
TTTCAATAAAGCTGAAAAATACACTGAGATCTTCTACCAGGACCTGAGACGGAAAACAGA
ATTTAGGAATTACCCAGGCATCCTCTACTGCCTCCTGAAAAGTGAGAAGATGCTCTTGGA
GGATGTCAAGGCCAATATTACGGAGATGCTGGCAGGGGGTGTGAACACGACATCCATGAC
ATTGCAATGGCACTTGTACGAGATGGCACGCAGCCTGAATGTGCAGGAGATGCTGCGGGA
GGAGGTTCTGAATGCCCGACGCCAGGCAGAGGGAGACATAAGCAAGATGCTGCAAATGGT
CCCACTTCTCAAAGCTAGCATCAAGGAGACGCTGAGACTCCACCCCATCTCCGTGACCCT
GCAGAGATACCCTGAAAGTGACTTGGTTCTTCAAGATTACCTGATTCCTGCCAAGACACT
GGTGCAAGTGGCCATCTATGCCATGGGCCGAGACCCTGCCTTCTTCTCCAGTCCGGACAA
GTTTGACCCAACCAGGTGGCTGAGTAAAGACAAAGACCTCATCCACTTCCGGAACCTGGG
CTTTGGCTGGGGAGTGCGGCAGTGCGTGGGCCGGCGGATCGCCGAGCTGGAGATGACCCT
CTTCCTCATCCACATTCTGGAGAACTTCAAGGTTGAAATGCAGCATATCGGTGACGTGGA
CACCATATTCAACCTCATCCTGACGCCGGACAAGCCCATCTTCCTTGTCTTCCGCCCCTT
CAA
Enzyme 2 GenBank Gene ID K02130 Link Image
Enzyme 2 GeneCard ID CYP11A1 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 15q23-q24
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 1608
Enzyme 3 Name Prostaglandin E2 receptor EP4 subtype
Enzyme 3 Synonyms
  1. PGE receptor, EP4 subtype
  2. Prostanoid EP4 receptor
Enzyme 3 Gene Name PTGER4
Enzyme 3 Protein Sequence >Prostaglandin E2 receptor EP4 subtype
MSIPGTNASSSQASNPLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYLKGQWPGGHALCEYSTFILLFFGLSGLSIICAMSIERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPSMGLGSSRLQYPATWCFIDWTTNVTA
HAAFSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQQHHAAAAAVALAP
TACRAPPAASSPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFV
NQLYRPQLEPVIGKNPDLQAIRIASVSPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGS
RRERSGPHCSDSRRTSSAVSGHSRSFLSRELKEISSTSQTLLYTPELSENGLGGGRNLLP
GVPGVGLTQIDSTSLRTLRISETSDSSQGQDSESFLLVDEVGGSCRAGPAPKGSSLQVTF
PSETLNLSEKCI
Enzyme 3 Number of Residues 492
Enzyme 3 Molecular Weight 53297.3
Enzyme 3 Theoretical pI 9.29
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Involved in prostaglandin E receptor activity
Enzyme 3 Specific Function Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • 20-43 56-79 97-115 136-160 185-211 274-301 319-338
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 22536174 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q8MJ08 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name PE2R4_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1479 bp
ATGTCCATTCCCGGGACCAATGCATCATCCTCCCAGGCCTCCAACCCACTGAACAGCCCA
GTGACCATCCCGGCGGTGATGTTCATCTTCGGGGTCGTGGGCAACCTGGTGGCCATCGTG
GTGCTCTGTAAATCGCGCAAGGAGCAGAAGGAGACAACTTTCTACACACTGGTATGCGGG
CTGGCGGTCACCGACCTGCTGGGTACGTTGCTGGTGAGCCCGGTGACCATCGCCACCTAC
TTGAAGGGCCAATGGCCCGGGGGCCACGCGCTGTGCGAATACAGCACCTTCATCCTGCTC
TTCTTTGGCCTGTCGGGGCTCAGCATCATCTGTGCGATGAGTATTGAGCGCTACCTGGCC
ATCAACCACGCCTACTTCTACAGCCACTACGTGGACAAGCGGCTGGCGGGGCTCACGCTC
TTCGCGGTCTACGCGTCCAACGTGCTCTTCTGCGCGCTGCCCAGCATGGGCCTGGGCAGT
TCGCGGCTGCAGTACCCGGCCACCTGGTGCTTCATCGACTGGACCACCAACGTGACAGCG
CACGCCGCCTTCTCCTACATGTATGCGGGCTTCAGTTCCTTCCTCATCCTCGCCACCGTG
CTCTGCAACGTGCTCGTGTGCGGCGCGCTGCTCCGCATGCACCGCCAGTTCATGCGCCGC
ACCTCGCTGGGCACCGAGCAGCAGCACCACGCGGCCGCCGCCGCCGTCGCCTTGGCCCCG
ACAGCCTGCCGGGCTCCCCCGGCCGCCTCCTCCCCCGCCCTGCCGCGCCTCAGCGACTTT
CGCCGCCGCCGGAGCTTCCGCCGCATCGCGGGCGCCGAGATCCAGATGGTCATCTTACTC
ATCGCCACCTCTCTGGTGGTGCTCATCTGCTCCATCCCGCTTGTGGTGCGAGTGTTCGTC
AACCAGTTATATCGGCCACAACTGGAGCCAGTCATCGGCAAAAACCCTGATTTGCAGGCC
ATCCGAATTGCTTCTGTGAGCCCCATTCTGGACCCCTGGATATACATCCTCCTGCGGAAG
ACAGTGCTCAGTAAAGCCATAGAGAAGATCAAATGCCTCTTCTGCCGCATCGGCGGGTCG
CGCCGGGAGCGTTCGGGGCCGCACTGCTCAGACAGCAGAAGGACGTCCTCCGCCGTGTCC
GGCCACTCCCGCTCCTTCCTCTCCCGGGAGCTGAAAGAGATCAGCAGCACGTCGCAGACC
CTCCTGTACACGCCAGAACTCAGTGAAAACGGCCTCGGGGGAGGCAGGAATCTGCTGCCA
GGTGTGCCCGGCGTGGGCCTGACCCAAATAGACAGCACGTCGCTTAGGACTCTGCGAATA
TCGGAGACCTCAGACTCCTCACAGGGGCAGGACTCGGAGAGCTTCTTACTGGTGGACGAG
GTTGGCGGGAGCTGCAGGGCTGGGCCCGCCCCTAAGGGGAGCTCCCTGCAAGTCACGTTT
CCCAGTGAAACGCTGAACTTATCAGAAAAATGTATATAG
Enzyme 3 GenBank Gene ID AF539403 Link Image
Enzyme 3 GeneCard ID PTGER4 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:5
Enzyme 3 Locus 5p13.1
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 1816
Enzyme 4 Name Pituitary adenylate cyclase-activating polypeptide type I receptor
Enzyme 4 Synonyms
  1. PACAP type I receptor
  2. PACAP-R-1
Enzyme 4 Gene Name ADCYAP1R1
Enzyme 4 Protein Sequence >Pituitary adenylate cyclase-activating polypeptide type I receptor
MRGGRHWPEPPCRLRSVMASIAQVSLAALLLLPMATAMHSDCIFKKEQAMCLEKIQRVND
LMGLNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRIFNPDQVWETETIGEFGFADS
KSLDLSDMRVVSRNCTEDGWSEPFPHYFDACGFEEYESETGDQDYYYLSVKALYTVGYST
SLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSNHCFVST
VECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFFPERRYFYWYIIIGWGTPTVCVSV
WAMLRLYFDDTGCWDMNDNTALWWVIKGPVVGSIMVNFVLFIGIIVILVQKLQSPDMGGN
ESSIYFSCVQKCYCKPQRAQQHSCKMSELSTITLRLARSTLLLIPLFGIHYTVFAFSPEN
VSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFTMDFKHRHPSL
ASSGVNGGTQLSILSKSSSQIRMSGLPADNLAT
Enzyme 4 Number of Residues 513
Enzyme 4 Molecular Weight 58784.8
Enzyme 4 Theoretical pI 7.04
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in vasoactive intestinal polypeptide receptor
Enzyme 4 Specific Function This is a receptor for PACAP-27 and PACAP-38. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. May regulate the release of adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. May play a role in spermatogenesis and sperm motility. Causes smooth muscle relaxation and secretion in the gastrointestinal tract
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • 1-37
Enzyme 4 Transmembrane Regions
  • 173-195 204-222 245-270 286-308 327-349 396-416 431-450
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 1374682 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q29627 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name PACR_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >1542 bp
ATGAGAGGCGGGCGGCACTGGCCCGAGCCGCCTTGCAGGCTGAGAAGCGTCATGGCCAGC
ATCGCGCAGGTCTCCCTGGCTGCTCTCCTCCTGCTGCCTATGGCCACCGCCATGCATTCC
GACTGCATCTTCAAGAAGGAGCAAGCCATGTGCCTGGAGAAGATCCAGAGGGTGAATGAC
CTGATGGGCTTGAATGACTCCTCCCCAGGGTGCCCTGGGATGTGGGACAACATCACGTGT
TGGAAGCCCGCCCACGTGGGTGAGATGGTCCTGGTCAGTTGCCCTGAACTCTTCCGAATC
TTCAACCCAGACCAAGTCTGGGAGACGGAAACCATCGGAGAGTTCGGTTTTGCAGACAGT
AAATCCTTGGATCTCTCAGACATGAGGGTGGTGAGCCGGAATTGCACGGAGGATGGATGG
TCAGAGCCATTCCCTCATTATTTCGATGCCTGTGGGTTTGAGGAGTACGAATCTGAGACT
GGGGACCAGGATTACTACTACCTGTCAGTGAAGGCCCTGTACACAGTTGGCTACAGCACG
TCCCTCGTCACCCTCACCACTGCCATGGTCATCCTGTGTCGTTTCCGGAAGCTGCACTGC
ACCCGCAACTTCATCCACATGAACCTCTTCGTGTCGTTTATGCTGAGGGCCATCTCCGTC
TTCATCAAAGACTGGATCCTCTATGCTGAGCAGGACAGCAATCACTGCTTTGTCTCCACT
GTGGAATGCAAGGCTGTGATGGTTTTCTTCCACTACTGTGTTGTATCCAACTACTTCTGG
CTGTTCATCGAGGGCCTGTATCTCTTCACCCTGCTGGTGGAGACCTTCTTCCCCGAGAGG
AGATATTTCTACTGGTACATCATCATTGGCTGGGGGACACCAACTGTGTGTGTGTCTGTG
TGGGCTATGCTGAGGCTCTACTTCGATGACACAGGCTGCTGGGATATGAATGACAACACG
GCTCTGTGGTGGGTGATCAAAGGCCCTGTAGTTGGCTCCATAATGGTTAATTTTGTGCTC
TTCATCGGCATCATTGTCATCCTTGTGCAGAAACTTCAGTCTCCAGACATGGGAGGCAAC
GAGTCCAGCATCTACTTCAGCTGCGTGCAGAAATGCTACTGCAAGCCACAGCGGGCTCAG
CAGCACTCTTGCAAGATGTCAGAACTGTCCACCATTACTCTACGGCTCGCCAGGTCCACC
TTGCTGCTCATCCCACTCTTTGGAATCCACTACACTGTCTTTGCTTTCTCCCCGGAGAAC
GTCAGCAAGAGGGAGAGACTGGTGTTTGAGCTGGGTCTGGGCTCCTTCCAGGGCTTTGTG
GTGGCTGTTCTCTATTGCTTTCTGAATGGAGAGGTGCAGGCGGAGATCAAGAGGAAGTGG
CGGAGCTGGAAGGTGAACCGCTACTTCACCATGGACTTCAAGCACCGGCACCCATCCCTG
GCCAGCAGCGGGGTGAACGGGGGCACCCAGCTCTCCATCCTGAGCAAGAGCAGCTCCCAG
ATCCGCATGTCTGGGCTTCCGGCCGACAACCTGGCCACCTGA
Enzyme 4 GenBank Gene ID D17290 Link Image
Enzyme 4 GeneCard ID ADCYAP1R1 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:7
Enzyme 4 Locus 7p14
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 2578
Enzyme 5 Name Beta-2 adrenergic receptor
Enzyme 5 Synonyms
  1. Beta-2 adrenoreceptor
  2. Beta-2 adrenoceptor
Enzyme 5 Gene Name ADRB2
Enzyme 5 Protein Sequence >Beta-2 adrenergic receptor
MGQPGNRSVFLLAPNASHAPDQNVTLERDEAWVVGMGILMSLIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGACHILMKMWTFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYLAITSPFKYQCLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRASHKE
AINCYAKETCCDFFTNQPYAIASSIVSFYLPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF
HAQNVSQVEQDGRSGLGQRRTSKFYLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIKD
NLIRKEIYILLNWLGYINSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGCSSNSND
RTDYTGEQSGYHLGEEKDSELLCEDPPGTENFVNQQGTVPSDSIDSQGRNCSTNDSLL
Enzyme 5 Number of Residues 418
Enzyme 5 Molecular Weight 47135.2
Enzyme 5 Theoretical pI 7.74
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Involved in beta2-adrenergic receptor activity
Enzyme 5 Specific Function Beta-adrenergic receptors mediate the catecholamine- induced activation of adenylate cyclase through the action of G proteins. The beta-2-adrenergic receptor binds epinephrine with an approximately 30-fold greater affinity than it does norepinephrine
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • 35-58 72-95 107-129 151-174 197-220 275-298 306-329
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 2266430 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID Q28044 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name ADRB2_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >1257 bp
ATGGGGCAGCCCGGGAACCGCAGCGTCTTTTTGCTGGCGCCCAACGCAAGCCACGCGCCG
GACCAAAACGTCACGCTGGAACGGGACGAGGCCTGGGTTGTGGGCATGGGCATCCTCATG
TCGCTTATTGTCCTGGCCATCGTGTTTGGAAACGTGCTAGTCATCACAGCCATTGCCAAG
TTTGAGCGTCTCCAGACGGTCACCAACTACTTCATCACCTCCCTGGCCTGTGCTGACCTG
GTCATGGGCCTGGCAGTGGTGCCCTTTGGGGCCTGCCACATCCTCATGAAAATGTGGACT
TTTGGCAACTTCTGGTGTGAGTTTTGGACTTCCATTGACGTGTTATGCGTCACGGCCAGC
ATTGAGACCTTGTGCGTGATCGCTGTGGATCGCTACTTAGCCATCACGTCACCCTTCAAG
TATCAGTGCCTGCTGACCAAGAATAAGGCCCGGGTGGTCATTTTGATGGTGTGGATCGTG
TCTGGCCTTACCTCCTTCTTACCCATTCAGATGCACTGGTACCGGGCCAGCCACAAGGAA
GCCATCAACTGCTATGCTAAGGAAACCTGCTGTGACTTCTTCACGAACCAACCCTATGCC
ATTGCCTCCTCCATTGTGTCCTTCTACCTTCCCCTGGTGGTCATGGTCTTCGTCTACTCC
AGGGTGTTCCAGGTGGCCAAAAGGCAGCTCCAGAAGATCGACAAATCTGAGGGCCGCTTC
CATGCCCAAAACGTCAGTCAAGTGGAGCAGGATGGGCGGAGCGGTCTAGGACAACGCAGG
ACCTCCAAGTTCTACTTGAAGGAACACAAAGCCCTCAAGACTTTAGGCATTATCATGGGC
ACTTTCACCCTGTGCTGGCTGCCCTTCTTCATTGTCAACATTGTGCACGTGATCAAGGAT
AACCTCATCCGTAAGGAAATATACATCCTTCTAAACTGGTTGGGCTACATCAACTCCGCT
TTCAATCCCCTTATCTACTGCCGGAGCCCAGATTTCAGGATTGCCTTCCAGGAGCTTCTC
TGCCTGCGCAGGTCTTCATTGAAGGCCTATGGGAATGGCTGCTCCAGCAACAGCAATGAC
AGGACTGACTACACAGGGGAACAGAGTGGATATCACCTGGGGGAGGAGAAAGACAGTGAA
CTTCTGTGTGAAGACCCCCCAGGCACCGAAAACTTTGTGAACCAGCAAGGTACTGTGCCC
AGTGATAGCATTGATTCACAAGGGAGGAATTGTAGTACAAATGACTCACTGCTGTAA
Enzyme 5 GenBank Gene ID Z86037 Link Image
Enzyme 5 GeneCard ID ADRB2 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:5
Enzyme 5 Locus 5q31-q32
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References
  1. [PubMed Link Image]
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 2579
Enzyme 6 Name Beta-1 adrenergic receptor
Enzyme 6 Synonyms
  1. Beta-1 adrenoreceptor
  2. Beta-1 adrenoceptor
Enzyme 6 Gene Name ADRB1
Enzyme 6 Protein Sequence >Beta-1 adrenergic receptor
MGAGVLALGASEPCNLSSAAPVPDGAATAARLLVPASPPASLLTSASEGPPLPSQQWTAG
MGLLMAFIVLLIVVGNVLVLVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARALVC
TVWAISALVSFLPIFMQWWGDKDAKASRCYNDPECCDFIINEGYAITSSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLSGPARLPSPAPSPGPPLPAATVANGRANKRRPPR
LVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFNWLGYANSAFN
PIIYCRSPDFRKAFQRLLCCARRAACGSHAAAGDPPRALGCLAVARPSPSPGAASDDDDD
DDEDDVGAAPPVRLLEPWAGYNGGAAANSDSSPDEPSRAGCASESKV
Enzyme 6 Number of Residues 467
Enzyme 6 Molecular Weight 50136.5
Enzyme 6 Theoretical pI 7.96
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Not Available
Enzyme 6 Specific Function Beta-adrenergic receptors mediate the catecholamine- induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • 56-84 94-120 133-154 173-196 223-248 307-336 342-364
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 6649232 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID Q9TT96 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name ADRB1_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence Not Available
Enzyme 6 GenBank Gene ID AF188187 Link Image
Enzyme 6 GeneCard ID ADRB1 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:1
Enzyme 6 Locus 10q24-q26
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References Not Available
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 2675
Enzyme 7 Name Steroidogenic factor 1
Enzyme 7 Synonyms
  1. STF-1
  2. SF-1
  3. Nuclear receptor subfamily 5 group A member 1
  4. Adrenal 4-binding protein
  5. Steroid hormone receptor Ad4BP
  6. Fushi tarazu factor homolog 1
Enzyme 7 Gene Name NR5A1
Enzyme 7 Protein Sequence >Steroidogenic factor 1
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKT
QRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL
ETGPPVGVPPPPPPPPDYMLPHGLHASEPKGLASGPPAGPLGDFGAPALPMAVPSAHGPL
AGYLYPAFPGRAIKSEYPEPYASPPQPGPPYGYPEPFSGGPGVPELILQLLQLEPDEDQV
RARIVGCLQEPAKGRPDQPAPFSLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQN
CWSELLVFDHIYRQIQHGKEGSILLVTGQEVELTTVAAQAGSLLHSLVLRAQELVLQLHA
LQLDRQEFVCLKFLILFSLDVKFLNNHSLVKEAQEKANAALLDYTLCHYPHCGDKFQQLL
LCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
Enzyme 7 Number of Residues 461
Enzyme 7 Molecular Weight 51612.3
Enzyme 7 Theoretical pI 7.74
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Cell cycle control, cell division, chromosome partitioning
Enzyme 7 Specific Function Transcriptional activator. Seems to be essential for sexual differentiation and formation of the primary steroidogenic tissues. Binds to the Ad4 site found in the promoter region of steroidogenic P-450 genes such as CYP11A, CYP11B and CYP21B. Also regulates the Muellerian inhibiting substance (AMH) gene as well as the AHCH and STAR genes. 5'-YCAAGGYC-3' and 5'-RRAGGTCA-3' are the consensus sequences for the recognition by FTZF1. The SFPQ- NONO-NR5A1/SF-1 complex binds to the CYP17 promoter and regulates basal and cAMP-dependent transcriptional avtivity. Binds phospholipids with a phosphatidylinositol (PI) headgroup, in particular PI(3,4)P2 and PI(3,4,5)P3
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • None
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 217432 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q04752 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name STF1_BOVIN Link Image
Enzyme 7 PDB ID 1YP0 Link Image
Enzyme 7 PDB File Show
Enzyme 7 3D Structure
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >1386 bp
ATGGACTATTCGTACGACGAGGACCTGGACGAGCTGTGCCCCGTGTGTGGGGACAAGGTG
TCCGGCTACCACTACGGGCTGCTCACATGCGAGAGCTGCAAGGGCTTCTTCAAGCGCACG
GTGCAGAACAACAAGCACTACACGTGCACCGAGAGCCAGAGCTGCAAGATCGACAAGACT
CAGCGCAAGCGCTGTCCCTTCTGCCGCTTCCAGAAGTGCCTGACGGTGGGGATGCGCCTG
GAAGCTGTGCGCGCTGACCGCATGCGAGGCGGCCGGAACAAGTTTGGGCCCATGTACAAG
CGGGACCGGGCCCTGAAGCAGCAGAAGAAGGCACAGATTCGAGCCAATGGCTTCAAGCTG
GAGACAGGCCCCCCAGTGGGGGTGCCCCCGCCGCCCCCTCCCCCACCGGACTACATGCTG
CCCCATGGCCTGCATGCATCTGAGCCCAAGGGCCTGGCCTCAGGTCCACCAGCTGGGCCA
CTGGGCGACTTTGGGGCCCCAGCGTTGCCTATGGCTGTGCCCAGCGCCCACGGGCCACTG
GCTGGCTACCTCTACCCTGCCTTCCCTGGCCGCGCCATCAAGTCTGAGTACCCAGAGCCC
TATGCCAGCCCCCCACAGCCCGGGCCACCCTACGGCTACCCAGAGCCCTTCTCGGGGGGG
CCTGGTGTGCCCGAGCTTATCCTCCAGCTGCTGCAGCTGGAGCCAGATGAGGACCAAGTG
CGGGCACGCATCGTGGGCTGCCTGCAGGAACCGGCCAAAGGCCGCCCCGACCAGCCTGCG
CCCTTCAGCCTCCTGTGCAGGATGGCCGACCAGACCTTCATCTCCATCGTGGACTGGGCA
CGCAGGTGCATGGTCTTCAAGGAGCTGGAGGTGGCCGACCAGATGACACTGCTGCAGAAC
TGCTGGAGCGAGCTGCTGGTTTTTGACCACATCTACCGTCAGATTCAGCATGGCAAGGAG
GGCAGCATCCTGCTGGTCACAGGGCAGGAGGTGGAGCTGACCACGGTGGCCGCCCAGGCG
GGCTCGCTGCTGCACAGCCTGGTGCTTCGGGCGCAGGAGTTGGTGCTGCAGCTGCACGCG
CTGCAGCTGGATCGCCAGGAGTTCGTCTGCCTCAAGTTCCTCATTCTCTTCAGCCTCGAT
GTGAAGTTCCTGAACAACCACAGCCTGGTGAAGGAGGCTCAGGAGAAGGCCAACGCCGCC
CTGCTTGACTACACCCTGTGCCACTACCCGCACTGTGGGGACAAGTTCCAGCAGCTGCTG
CTGTGCCTGGTGGAGGTGCGGGCGCTGAGCATGCAGGCCAAGGAGTACCTGTACCACAAG
CACCTGGGCAACGAGATGCCCCGAAACAACCTGCTCATCGAGATGCTGCAGGCCAAGCAG
ACTTGA
Enzyme 7 GenBank Gene ID D13569 Link Image
Enzyme 7 GeneCard ID NR5A1 Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:9
Enzyme 7 Locus 9q33
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References
  1. [PubMed Link Image]
Enzyme 7 Metabolite References Not Available