We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Cholesterol (BMDB00067)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-07-02 10:39:17
Accession Number BMDB00067
Common Name Cholesterol
Description Cholesterol is a sterol (a combination steroid and alcohol) and a lipid found in the cell membranes of all body tissues, and transported in the blood plasma of all animals. The name originates from the Greek chole- (bile) and stereos (solid), and the chemical suffix -ol for an alcohol, as researchers first identified cholesterol (C27H45OH) in solid form in gallstones in 1784. Cholesterol is transported throughout the body via lipoprotein particles. The largest lipoproteins, which primarily transport fats from the intestinal mucosa to the liver, are called chylomicrons. They carry mostly triglyceride fats and cholesterol (that are from food and especially internal cholesterol secreted by the liver into the bile). In the liver, chylomicron particles give up triglycerides and some cholesterol, and are converted into low-density lipoprotein (LDL) particles, which carry triglycerides and cholesterol on to other body cells. In healthy individuals the LDL particles are large and relatively few in number. In contrast, large numbers of small LDL particles are strongly associated with promoting atheromatous disease within the arteries. (Lack of information on LDL particle number and size is one of the major problems of conventional lipid tests.). In conditions with elevated concentrations of oxidized LDL particles, especially small LDL particles, cholesterol promotes atheroma plaque deposits in the walls of arteries, a condition known as atherosclerosis, which is a major contributor to coronary heart disease and other forms of cardiovascular disease. (In contrast, HDL particles have been the only identified mechanism by which cholesterol can be removed from atheroma. Increased concentrations of large HDL particles, not total HDL particles, correlate with lower rates of atheroma progressions, even regression.). There is a world-wide trend to believe that lower total cholesterol levels tend to correlate with lower atherosclerosis event rates (though many studies refute this idea). Due to this reason, cholesterol has become a very large focus for scientific researchers trying to determine the proper amount of cholesterol needed in a healthy diet. However, the primary association of atherosclerosis with cholesterol has always been specifically with cholesterol transport patterns, not total cholesterol per se. For example, total cholesterol can be low, yet made up primarily of small LDL and small HDL particles and atheroma growth rates are high. In contrast, however, if LDL particle number is low (mostly large particles) and a large percentage of the HDL particles are large (HDL is actively reverse transporting cholesterol), then atheroma growth rates are usually low, even negative, for any given total cholesterol concentration. These effects are further complicated by the relative concentration of asymmetric dimethylarginin (ADMA) in the endothelium, since ADMA down-regulates production of nitric oxide, a relaxant of the endothelium. Thus, high levels of ADMA, associated with high oxidized levels of LDL pose a heightened risk factor for vascular disease. -- Wikipedia
Synonyms
  1. (+)-ent-Cholesterol
  2. (-)-Cholesterol
  3. (20bFH)-cholest-5-en-3b-ol
  4. (3b)-cholest-5-en-3-ol
  5. (3beta)-Cholest-5-en-3-ol
  6. 20-epi-cholesterol
  7. 20-iso-cholesterol
  8. 20bFH-cholest-5-en-3b-ol
  9. 3beta-Hydroxycholest-5-ene
  10. 5-Cholesten-3B-ol
  11. 5-Cholesten-3beta-ol
  12. 5:6-Cholesten-3-ol
  13. 5:6-Cholesten-3beta-ol
  14. Cholest-5-en-3-ol
  15. Cholest-5-en-3beta-ol
  16. Cholesterin
  17. Cholesterine
  18. Cholesterol
  19. Cholesterol base H
  20. Cholesteryl alcohol
  21. Cholestrin
  22. Cholestrol
  23. Cordulan
  24. Dastar
  25. Dusoline
  26. Dusoran
  27. Dythol
  28. Epicholesterol
  29. Fancol CH
  30. Hydrocerin
  31. Kathro
  32. Lanol
  33. Liquid crystal CN/9
  34. Nimco cholesterol base H
  35. Nimco cholesterol base No. 712
  36. Super hartolan
  37. Tegolan
  38. cholest-5-en-3b-ol
  39. epicholesterin
Chemical IUPAC Name 10,13-dimethyl-17-(6-methylheptan-2-yl)-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1H-cyclopenta[a]phenanthren-3-ol
Chemical Formula C27H46O
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Cholesterols and derivatives
Class
  • Steroids and Steroid Derivatives
Sub Class
  • Miscellaneous steroids
Family
  • Mammalian_Metabolite
Species
  • secondary alcohol; alkene
Biofunction
  • Component of Bile acid biosynthesis; Component of C21-Steroid hormone metabolism
Application
Source
  • Endogenous
Average Molecular Weight 386.654
Monoisotopic Molecular Weight 386.354858
Isomeric SMILES CC(C)CCC[C@@H](C)[C@H]1CC[C@H]2[C@@H]3CC=C4CC(O)CC[C@]4(C)[C@H]3CC[C@]12C
Canonical SMILES CC(C)CCCC(C)C1CCC2C3CC=C4CC(O)CCC4(C)C3CCC12C
KEGG Compound ID C00187 Link Image
BioCyc ID CHOLESTEROL Link Image
BiGG ID 34183 Link Image
Wikipedia Link Cholesterol Link Image
METLIN ID 163 Link Image
PubChem Compound 5997 Link Image
PubChem Substance 629186 Link Image
ChEBI ID 16113 Link Image
CAS Registry Number 57-88-5
InChI Identifier InChI=1/C27H46O/c1-18(2)7-6-8-19(3)23-11-12-24-22-10-9-20-17-21(28)13-15-26(20,4)25(22)14-16-27(23,24)5/h9,18-19,21-25,28H,6-8,10-17H2,1-5H3/t19-,21?,22+,23-,24+,25+,26+,27-/m1/s1
Synthesis Reference Zhu, Yongming; Qin, Liena; Liu, Rui. Simple method for synthesis cholesterol from Diosgenin. Faming Zhuanli Shenqing Gongkai Shuomingshu (2006), 9 pp.
Melting Point (Experimental) 148 oC
Experimental Water Solubility 9.5e-05 mg/mL [YALKOWSKY,SH & DANNENFELSER,RM (1992)] Source: PhysProp
Predicted Water Solubility 2.79e-05 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity 7.02 [Predicted by ALOGPS]; 8.2 [Predicted by PubChem via XLOGP]; 8.74 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID 1LRI Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Membrane
  • Cytoplasm
  • endoplasmic reticulum
  • Extracellular
  • golgi apparatus
  • lysosome
  • mitochondria
Biofluid Location
  • Breast_Milk
Tissue Location
Tissue References
All Tissues
Concentrations (Normal)
Biofluid Breast_Milk
Value 101.383 uM
Age N/A
Sex N/A
Condition Normal
Comments defatted milk/saponified.
References
Biofluid Breast_Milk
Value 51.726 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, Skim.
References
Biofluid Breast_Milk
Value 134.487 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, Partly Skimmed, 1% fat.
References
Biofluid Breast_Milk
Value 268.974 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, whole, 3.3% fat.
References
Biofluid Breast_Milk
Value 51.726 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, Skim.
References
Biofluid Breast_Milk
Value 129.315 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, fluid, partly skimmed, 1% milkfat.
References
Biofluid Breast_Milk
Value 206.903 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, fluid, partly skimmed, 2% milkfat.
References
Biofluid Breast_Milk
Value 258.629 uM
Age N/A
Sex N/A
Condition Normal
Comments Pasteurized. Milk, whole, pasteurized, homogenized, 3.3% milkfat.
References
Biofluid Breast_Milk
Value 362.0808 uM
Age N/A
Sex N/A
Condition Normal
Comments Milk, fluid, whole, producer, 3.7% milkfat.
References
Biofluid Breast_Milk
Value 266.738 uM
Age NA
Sex NA
Condition Normal
Comments Cow reduced fat milk (2% fat) with added vitamin A
References
Biofluid Breast_Milk
Value 133.369 uM
Age NA
Sex NA
Condition Normal
Comments Cow reduced fat milk (1% fat) with added vitamin A
References
Biofluid Breast_Milk
Value 53.563 uM
Age NA
Sex NA
Condition Normal
Comments Cow skim milk with added vitamin A
References
Biofluid Breast_Milk
Value 266.738 uM
Age NA
Sex NA
Condition Normal
Comments Cow whole milk (3.25% fat)
References
Concentrations (Abnormal) Not Available
Pathway Names
  • Bile Acid Biosynthesis
  • C21 Steroid Hormone Metabolism
  • Steroid Biosynthesis
HMDB Pathways
Name Bile Acid Biosynthesis
Image Show Link Image
Name C21 Steroid Hormone Metabolism
Image Show Link Image
Name Steroid Biosynthesis
Image Show Link Image
KEGG Pathways
Name Bile Acid Biosynthesis
Image Show Link Image
Name C21 Steroid Hormone Metabolism
Image Show Link Image
Name Steroid Biosynthesis
Image Show Link Image
SimCell Pathways
Name Bile Acid Biosynthesis
Image Show Link Image
Graph
SBML
Name C21 Steroid Hormone Metabolism
Image Show Link Image
Graph
SBML
Name Steroid Biosynthesis
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Cholesterol side-chain cleavage enzyme, mitochondrial
  2. 7-dehydrocholesterol reductase
  3. Translocator protein
  4. Bile acid receptor
  5. Apolipoprotein A-I
  6. SCARB1 protein
  7. Cystic fibrosis transmembrane conductance regulator
  8. Sterol regulatory element-binding protein cleavage-activating protein
  9. StAR-related lipid transfer protein 5
  10. APOM protein
  11. Steroidogenic acute regulatory protein, mitochondrial
  12. Apolipoprotein E
  13. Apolipoprotein E
  14. Scavenger receptor class B member 1
  15. Na(+)/H(+) exchange regulatory cofactor NHE-RF3
Enzyme 1 [top]
Enzyme 1 ID 53
Enzyme 1 Name Cholesterol side-chain cleavage enzyme, mitochondrial
Enzyme 1 Synonyms
  1. Cytochrome P450 11A1
  2. CYPXIA1
  3. P450(scc)
  4. Cholesterol desmolase
Enzyme 1 Gene Name CYP11A1
Enzyme 1 Protein Sequence >Cholesterol side-chain cleavage enzyme, mitochondrial
MLARGLPLRSALVKACPPILSTVGEGWGHHRVGTGEGAGISTKTPRPYSEIPSPGDNGWL
NLYHFWREKGSQRIHFRHIENFQKYGPIYREKLGNLESVYIIHPEDVAHLFKFEGSYPER
YDIPPWLAYHRYYQKPIGVLFKKSGTWKKDRVVLNTEVMAPEAIKNFIPLLNPVSQDFVS
LLHKRIKQQGSGKFVGDIKEDLFHFAFESITNVMFGERLGMLEETVNPEAQKFIDAVYKM
FHTSVPLLNVPPELYRLFRTKTWRDHVAAWDTIFNKAEKYTEIFYQDLRRKTEFRNYPGI
LYCLLKSEKMLLEDVKANITEMLAGGVNTTSMTLQWHLYEMARSLNVQEMLREEVLNARR
QAEGDISKMLQMVPLLKASIKETLRLHPISVTLQRYPESDLVLQDYLIPAKTLVQVAIYA
MGRDPAFFSSPDKFDPTRWLSKDKDLIHFRNLGFGWGVRQCVGRRIAELEMTLFLIHILE
NFKVEMQHIGDVDTIFNLILTPDKPIFLVFRPFNQDPPQA
Enzyme 1 Number of Residues 520
Enzyme 1 Molecular Weight 60332.4
Enzyme 1 Theoretical pI 9.15
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Secondary metabolites biosynthesis, transport and catabolism
Enzyme 1 Specific Function Catalyzes the side-chain cleavage reaction of cholesterol to pregnenolone
Enzyme 1 Pathways
  • Lipid metabolism
  • C21-steroid hormone metabolism
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 162951 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID P00189 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name CP11A_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1563 bp
.AGCAGCAGCTGTGGGGGCAGCATGCTAGCAAGGGGGCTTCCCCTCCGCTCAGCCCTGGT
CAAAGCCTGCCCACCCATCCTGAGCACAGTGGGGGAGGGCTGGGGCCACCACAGGGTGGG
CACTGGAGAGGGAGCTGGCATCTCCACAAAGACCCCTCGCCCCTACAGTGAGATCCCCTC
CCCTGGTGACAATGGCTGGCTTAACCTCTACCATTTCTGGAGGGAGAAGGGCTCACAGAG
AATCCACTTTCGCCACATCGAGAACTTCCAGAAGTATGGCCCCATTTACAGGGAGAAGCT
TGGCAATTTGGAGTCAGTTTATATCATTCACCCTGAAGACGTGGCCCATCTCTTCAAGTT
CGAGGGATCCTACCCAGAGAGATATGACATCCCGCCCTGGCTGGCCTATCACCGATATTA
TCAGAAACCCATTGGAGTCCTGTTTAAGAAGTCAGGAACCTGGAAGAAAGACCGGGTGGT
CCTGAACACGGAGGTGATGGCTCCAGAGGCAATAAAGAACTTCATCCCACTGCTGAATCC
AGTGTCTCAGGACTTCGTCAGCCTCCTGCACAAGCGCATCAAGCAGCAGGGCTCCGGAAA
GTTTGTAGGGGACATCAAGGAAGACCTGTTTCACTTTGCCTTTGAGTCCATCACCAATGT
CATGTTTGGGGAGCGCCTGGGGATGCTGGAGGAGACAGTGAACCCCGAGGCCCAGAAGTT
CATTGATGCCGTCTACAAGATGTTCCACACCAGTGTCCCTCTGCTCAACGTCCCTCCAGA
ACTGTACCGTCTATTCAGAACCAAGACTTGGAGGGACCATGTAGCCGCATGGGACACAAT
TTTCAATAAAGCTGAAAAATACACTGAGATCTTCTACCAGGACCTGAGACGGAAAACAGA
ATTTAGGAATTACCCAGGCATCCTCTACTGCCTCCTGAAAAGTGAGAAGATGCTCTTGGA
GGATGTCAAGGCCAATATTACGGAGATGCTGGCAGGGGGTGTGAACACGACATCCATGAC
ATTGCAATGGCACTTGTACGAGATGGCACGCAGCCTGAATGTGCAGGAGATGCTGCGGGA
GGAGGTTCTGAATGCCCGACGCCAGGCAGAGGGAGACATAAGCAAGATGCTGCAAATGGT
CCCACTTCTCAAAGCTAGCATCAAGGAGACGCTGAGACTCCACCCCATCTCCGTGACCCT
GCAGAGATACCCTGAAAGTGACTTGGTTCTTCAAGATTACCTGATTCCTGCCAAGACACT
GGTGCAAGTGGCCATCTATGCCATGGGCCGAGACCCTGCCTTCTTCTCCAGTCCGGACAA
GTTTGACCCAACCAGGTGGCTGAGTAAAGACAAAGACCTCATCCACTTCCGGAACCTGGG
CTTTGGCTGGGGAGTGCGGCAGTGCGTGGGCCGGCGGATCGCCGAGCTGGAGATGACCCT
CTTCCTCATCCACATTCTGGAGAACTTCAAGGTTGAAATGCAGCATATCGGTGACGTGGA
CACCATATTCAACCTCATCCTGACGCCGGACAAGCCCATCTTCCTTGTCTTCCGCCCCTT
CAA
Enzyme 1 GenBank Gene ID K02130 Link Image
Enzyme 1 GeneCard ID CYP11A1 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:1
Enzyme 1 Locus 15q23-q24
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 910
Enzyme 2 Name 7-dehydrocholesterol reductase
Enzyme 2 Synonyms
  1. 7-DHC reductase
  2. Sterol Delta(7)-reductase
Enzyme 2 Gene Name DHCR7
Enzyme 2 Protein Sequence >7-dehydrocholesterol reductase
MAAKSQPSAPKTKSTSGLTNGNAAAQGQWGRAWEVDWFSLASVIFLLLFAPFIVYYFIMA
CDQYGCSLTVPVADLATGRARLADIWARTPPVTAKAAQIYTAWVTLQVLLYMLLPDFCHK
FLPGYVGGVQEGAVTPAGAVNKYEINGLQAWLLTHLLWFANAHLLGWFSPTIIFDNWIPL
LWCANILGYTVSTFAMVKGYLFPTDARECKFTGNFFYNYMMGVEFNPRIGKWFDFKLFFN
GRPGIVAWTLINLSFAAKQQELYGHVTNSMVLVNILQAIYVLDFFWNETWYLKTIDICHD
HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLPTYYALGVLLLGLLGYYIFRMTNHQKDL
FRRTDGRCLIWGRKPKAIECSYTSADGQRHHSKLLVSGFWGVARHFNYTGDLMGSLAYCL
ACGGGHLLPYFYIIFMAILLTHRCLRDEHRCANKYGRDWEHYTAAVPYRLLPGIF
Enzyme 2 Number of Residues 475
Enzyme 2 Molecular Weight 54270.7
Enzyme 2 Theoretical pI 8.53
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Involved in 7-dehydrocholesterol reductase activity
Enzyme 2 Specific Function Production of cholesterol by reduction of C7-C8 double bond of 7-dehydrocholesterol (7-DHC)
Enzyme 2 Pathways
  • Steroid biosynthesis
  • cholesterol biosynthesis
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • 40-60 151-173 178-200 266-286 306-326 331-351 420-440
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 59858215 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q5E9J5 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name DHCR7_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1428 bp
ATGGCTGCGAAGTCCCAGCCCAGCGCCCCTAAAACCAAGAGCACCAGCGGCCTCACCAAC
GGCAACGCTGCAGCCCAAGGCCAGTGGGGCCGAGCCTGGGAGGTGGACTGGTTTTCCCTG
GCGAGCGTCATCTTCCTGCTGCTGTTTGCGCCCTTCATCGTGTACTACTTCATCATGGCC
TGCGACCAGTACGGCTGCTCCCTGACAGTGCCCGTGGCGGACCTCGCCACTGGGCGGGCT
CGGCTCGCCGACATCTGGGCCAGGACGCCGCCCGTGACCGCAAAGGCGGCCCAGATCTAC
ACAGCATGGGTCACGCTCCAGGTGCTTCTGTACATGCTGCTTCCTGACTTCTGCCACAAG
TTTCTTCCGGGCTACGTGGGGGGCGTTCAGGAGGGCGCCGTGACTCCCGCAGGAGCCGTC
AACAAGTATGAGATCAACGGCCTGCAGGCCTGGCTCCTCACGCACCTCCTGTGGTTCGCC
AACGCCCACCTCCTCGGCTGGTTCTCCCCCACCATCATTTTCGACAACTGGATCCCGCTG
CTCTGGTGTGCCAACATCCTGGGCTACACCGTCTCCACCTTCGCCATGGTCAAGGGCTAC
CTCTTCCCCACTGACGCCCGGGAATGCAAATTCACGGGCAATTTCTTTTACAACTACATG
ATGGGCGTTGAGTTTAACCCCCGAATTGGGAAGTGGTTTGACTTCAAGCTCTTCTTCAAT
GGACGCCCCGGGATCGTCGCCTGGACCCTCATCAACCTGTCCTTTGCAGCCAAGCAGCAG
GAGCTCTACGGCCACGTGACCAACTCCATGGTCTTGGTCAACATCCTGCAGGCCATCTAC
GTGCTGGACTTCTTCTGGAACGAAACCTGGTACCTGAAAACCATCGACATCTGCCACGAC
CACTTTGGGTGGTACCTGGGCTGGGGGGACTGCGTCTGGCTGCCATACCTGTACACGCTG
CAGGGCCTGTACCTGGTGTACCACCCCGTGCAGCTGCCCACCTACTACGCGCTGGGCGTC
CTGCTCCTGGGCCTGCTCGGCTACTACATCTTCCGGATGACCAACCACCAGAAGGACCTC
TTCCGCCGCACGGACGGGCGCTGCCTGATCTGGGGCAGGAAGCCCAAGGCCATCGAGTGC
TCCTACACATCAGCCGACGGGCAGAGACACCACAGCAAGCTGCTGGTCTCGGGCTTCTGG
GGCGTGGCCCGCCACTTCAACTACACGGGTGACCTGATGGGCAGCCTGGCGTACTGCCTG
GCCTGCGGCGGCGGCCACCTCCTGCCCTACTTCTACATCATCTTCATGGCCATCCTGCTG
ACCCACCGCTGCCTCCGGGACGAGCACCGCTGTGCCAACAAGTACGGCCGCGACTGGGAG
CACTACACGGCCGCCGTGCCGTACCGCCTGCTCCCTGGCATCTTCTAG
Enzyme 2 GenBank Gene ID BT020925 Link Image
Enzyme 2 GeneCard ID DHCR7 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 11q13.2-q13.5
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 1500
Enzyme 3 Name Translocator protein
Enzyme 3 Synonyms
  1. Peripheral-type benzodiazepine receptor
  2. PBR
  3. PKBS
  4. Isoquinoline-binding protein
  5. IBP
Enzyme 3 Gene Name TSPO
Enzyme 3 Protein Sequence >Translocator protein
MAPPWVPAVGFTLLPSLGGFLGAQYTRGEGFRWYASLQKPPWHPPRWILAPIWGTLYSAM
GYGSYMIWKELGGFSKEAVVPLGLYAGQLALNWAWPPLFFGTRQMGWALVDLLLTGGMAA
ATAMAWHQVSPPAACLLYPYLAWLAFAGMLNYRMWQDNQVRRSGRRLSE
Enzyme 3 Number of Residues 169
Enzyme 3 Molecular Weight 18927.0
Enzyme 3 Theoretical pI 9.94
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Signal transduction mechanisms
Enzyme 3 Specific Function Responsible for the manifestation of peripheral-type benzodiazepine recognition sites and is most likely to comprise binding domains for benzodiazepines and isoquinoline carboxamides. May play a role in the transport of porphyrins and heme. Plays a role in the transport of cholesterol across mitochondrial membranes in steroidogenic cells (By similarity)
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • 6-26 47-67 80-100 106-126 135-155
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 163489 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID P30535 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name TSPO_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >510 bp
ATGGCCCCACCCTGGGTGCCTGCCGTGGGCTTCACGCTGTTGCCCAGTCTGGGGGGCTTC
CTGGGTGCCCAGTACACCCGCGGAGAGGGTTTCCGCTGGTACGCCAGCCTGCAGAAGCCC
CCGTGGCACCCGCCCCGCTGGATTCTGGCTCCCATCTGGGGCACACTCTACTCGGCCATG
GGGTATGGTTCCTACATGATCTGGAAAGAGCTGGGGGGCTTCTCGAAGGAGGCGGTGGTT
CCCCTGGGCCTCTACGCTGGGCAGCTGGCTCTGAACTGGGCATGGCCTCCCCTCTTCTTC
GGCACTCGACAAATGGGCTGGGCCTTGGTGGATCTCCTGCTGACTGGCGGCATGGCAGCA
GCCACGGCCATGGCCTGGCACCAGGTGAGCCCGCCGGCTGCCTGCCTGCTGTACCCGTAC
CTGGCCTGGCTGGCCTTTGCCGGCATGCTCAACTACCGCATGTGGCAGGACAACCAGGTC
CGGAGGAGTGGCCGGCGGCTCTCGGAATGA
Enzyme 3 GenBank Gene ID M64520 Link Image
Enzyme 3 GeneCard ID TSPO Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:2
Enzyme 3 Locus 22q13.31
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 1586
Enzyme 4 Name Bile acid receptor
Enzyme 4 Synonyms
  1. Farnesoid X-activated receptor
  2. Farnesol receptor HRR-1
  3. Nuclear receptor subfamily 1 group H member 4
Enzyme 4 Gene Name NR1H4
Enzyme 4 Protein Sequence >Bile acid receptor
MVMQFQELENPVQISPCHSHTSSGFDMEVMSMKPAKGVLTEQVAGPLGQNLEVEPYSQYN
NVQFPQVQPQISSSSYYSNVGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVVEIPITK
KARLGASAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCV
MDMYMRRKCQECRLRKCKEMGMLAECLLTEIQCKSKRLRKNVKQHADQAIHEDSEGRDLR
QVTSTTKSCREKTELTPDQQNLLHYIMDSYSKQRMPQEITNKFLKEEFSAEENFIILTEM
ATSHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFSKKLPAGHTDLLEE
RIRKSGISDEYITPMFSFYKSVAELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEP
LLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHADMLMSWRVNDHKFTPLLCEIWD
VQ
Enzyme 4 Number of Residues 482
Enzyme 4 Molecular Weight 55459.2
Enzyme 4 Theoretical pI 6.77
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in sequence-specific DNA binding
Enzyme 4 Specific Function Receptor for bile acids such as chenodeoxycholic acid, lithocholic acid and deoxycholic acid. Represses the transcription of the cholesterol 7-alpha-hydroxylase gene (CYP7A1) and activates the intestinal bile acid-binding protein (IBABP). Activates the transcription of bile salt export pump ABCB11 by directly recruiting histone methyltransferase CARM1 within its gene locus
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 74267703 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q3SZL0 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name NR1H4_BOVIN Link Image
Enzyme 4 PDB ID 1OSH Link Image
Enzyme 4 PDB File Show
Enzyme 4 3D Structure
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >1449 bp
ATGGTAATGCAGTTTCAGGAGTTAGAAAATCCAGTTCAAATCAGTCCTTGTCACAGCCAC
ACATCCTCAGGATTTGACATGGAAGTGATGAGCATGAAGCCCGCTAAAGGTGTACTAACA
GAGCAAGTGGCAGGTCCTCTGGGACAGAATCTGGAAGTGGAACCGTACTCACAATACAAC
AACGTTCAGTTTCCCCAAGTTCAACCACAGATTTCCTCTTCTTCCTATTATTCCAATGTG
GGTTTCTATCCCCAGCAGCCTGAAGAGTGGTACTCTCCTGGAATATATGAACTCAGGCGA
ATGCCTGCTGAGACTCTCTATCAGGGAGAGACTGAGGTAGTGGAGATTCCTATAACCAAG
AAGGCCCGACTGGGAGCATCAGCAGGGAGAATCAAAGGGGATGAGCTATGTGTTGTCTGT
GGAGACCGAGCATCTGGATATCACTATAACGCCCTGACCTGTGAGGGATGCAAAGGTTTC
TTCAGAAGAAGCATTACCAAAAACGCTGTGTACAAGTGTAAAAACGGGGGCAACTGTGTG
ATGGACATGTACATGCGAAGGAAGTGCCAAGAGTGTCGACTAAGGAAATGCAAAGAAATG
GGAATGTTGGCTGAATGCTTGTTAACTGAAATTCAGTGTAAATCTAAACGACTGAGAAAA
AACGTGAAGCAGCATGCAGATCAGGCCATCCATGAAGACAGTGAAGGACGTGACCTGCGA
CAAGTGACCTCGACAACTAAGTCATGCAGGGAGAAAACTGAACTCACCCCAGATCAACAG
AATCTTCTTCATTATATTATGGATTCATATAGCAAGCAGAGGATGCCTCAGGAAATAACA
AATAAATTTTTAAAAGAAGAATTCAGCGCAGAAGAAAATTTTATCATTTTAACTGAAATG
GCTACCAGTCATGTACAGGTTCTTGTAGAATTCACAAAAAAACTTCCAGGATTTCAGACA
TTGGACCATGAAGATCAGATTGCCTTGCTGAAAGGGTCTGCAGTTGAAGCGATGTTTCTC
CGTTCAGCTGAGATTTTCAGTAAGAAACTTCCAGCTGGACATACTGACCTACTGGAAGAA
AGAATTCGAAAGAGTGGTATCTCTGATGAATATATAACACCTATGTTTAGCTTTTATAAA
AGTGTTGCTGAATTGAAAATGACTCAAGAAGAGTATGCTCTGCTTACAGCTATTGTTATC
CTCTCTCCAGATAGACAATACATAAAGGACAGAGAGGCAGTAGAGAAGCTTCAGGAACCA
CTGCTTGATGTGCTACAAAAGTTATGTAAGATTCATCAGCCTGAGAATCCTCAACATTTT
GCCTGTCTTCTGGGTCGCCTGACTGAGTTGAGGACATTCAACCATCACCACGCAGACATG
CTTATGTCATGGAGAGTGAATGACCACAAGTTTACCCCACTTCTCTGTGAAATCTGGGAT
GTGCAGTGA
Enzyme 4 GenBank Gene ID BC102805 Link Image
Enzyme 4 GeneCard ID NR1H4 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 12q23.1
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References Not Available
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 2125
Enzyme 5 Name Apolipoprotein A-I
Enzyme 5 Synonyms
  1. Apo-AI
  2. ApoA-I
Enzyme 5 Gene Name APOA1
Enzyme 5 Protein Sequence >Apolipoprotein A-I
MKAVVLTLAVLFLTGSQARHFWQQDDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASA
LGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKV
QPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVE
TLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGL
LPVLESLKVSILAAIDEASKKLNAQ
Enzyme 5 Number of Residues 265
Enzyme 5 Molecular Weight 30276.1
Enzyme 5 Theoretical pI 5.77
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Cell cycle control, cell division, chromosome partitioning
Enzyme 5 Specific Function Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • 1-18
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 162678 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID P15497 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name APOA1_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >798 bp
ATGAAAGCCGTGGTGCTGACCTTGGCTGTGCTCTTCCTGACGGGGAGCCAGGCTCGGCAT
TTCTGGCAGCAAGATGACCCCCAGTCATCCTGGGATCGGGTGAAGGATTTTGCCACCGTG
TATGTGGAAGCAATCAAGGATAGTGGCAGAGACTATGTGGCCCAATTCGAAGCCTCCGCT
TTGGGAAAACAGCTCAACCTGAAACTCCTGGACAACTGGGACACCCTGGCCAGCACGTTG
TCCAAAGTGCGTGAACAGCTGGGCCCAGTGACCCAGGAGTTCTGGGACAACCTGGAAAAG
GAGACCGCGTCGCTGAGGCAGGAGATGCACAAGGACCTGGAGGAGGTGAAGCAGAAGGTG
CAGCCCTACCTGGACGAGTTCCAGAAGAAGTGGCACGAGGAGGTGGAGATCTACCGCCAG
AAGGTGGCGCCGCTGGGCGAGGAGTTTCGCGAGGGCGCGCGCCAGAAGGTGCAGGAGCTG
CAGGACAAGCTGAGCCCTCTGGCCCAGGAGCTCCGCGACCGCGCGCGCGCCCACGTGGAG
ACGCTGCGGCAGCACGTGGCGCCCTACAGCGACGACCTGCGCCAGCGGCTGACCGCGCGC
CTGGAGGCGCTCAAGGAGGGCGGCGGCAGCCTGGCCGAGTACCACGCCAAGGCCAGCGAG
CAGCTGAAGGCGCTGGGCGAGAAGGCCAAGCCGGTGCTGGAGGACCTCCGCCAGGGCCTG
CTGCCCGTGCTGGAGAGCCTCAAGGTCAGCATCCTGGCCGCCATAGACGAGGCCTCCAAG
AAGCTGAACGCCCAGTGA
Enzyme 5 GenBank Gene ID M35870 Link Image
Enzyme 5 GeneCard ID APOA1 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:1
Enzyme 5 Locus 11q23-q24
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References
  1. [PubMed Link Image]
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 2126
Enzyme 6 Name SCARB1 protein
Enzyme 6 Synonyms Not Available
Enzyme 6 Gene Name SCARB1
Enzyme 6 Protein Sequence >SCARB1 protein
MGNLSRARRVTAALGFIGLLFAVLGIIMIVMVPSIIKQQVLKNVRIDPNSLSFNMWKEIP
VPFYLSVYFFNIVNPEGIIQGQKPQVQEHGPYVYREFRHKSNITFNNNDTVSFLEYRSYQ
FQPDKSRGQESDYIVMPNILVLSASMMMENRPGLLKLMMTLAFSTLGQRAFMNRTVGEIM
WGYDDPLIHLINQYFPNSLPFKGKFGLFAELNNSDSGLFTVFTGVKNFSRIHLVDKWNGV
SKVNYWHSDQCNMINGTSGQMWAPFMTPESSLEFYSPEACRSMKLVYKEQGVFGGIPTFR
FVAPSTLFANGSVYPPNEGFCPCRESGIQNVSTCRFNAPLFLSHPHFYNADPVLAEAVSG
LHPNPKEHSLFLDIHPVTGIPMNCSVKLQLSLFVKSVKGIGQTGNIQPVVLPLMWFEESG
AMEGETLETFYIQLVLMPKVLHYAQYVLLALGCVLLLIPIIYQIRSQGSKDAISQPCLAT
QPDQLPSPYTPLLQDSLRGQPTSPKV
Enzyme 6 Number of Residues 506
Enzyme 6 Molecular Weight 56915.7
Enzyme 6 Theoretical pI 8.20
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Involved in high-density lipoprotein binding
Enzyme 6 Specific Function Not Available
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 134025123 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID A4IFC6 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name A4IFC6_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >1521 bp
ATGGGCAACCTCTCTAGAGCGCGCCGGGTGACCGCGGCGCTGGGTTTCATCGGGCTCCTC
TTCGCCGTGCTGGGCATTATCATGATCGTGATGGTGCCCTCAATCATCAAGCAGCAGGTC
CTCAAGAATGTGCGCATCGACCCCAACAGCCTGTCTTTCAACATGTGGAAGGAAATCCCT
GTCCCCTTCTACCTCTCTGTCTACTTTTTCAACATCGTCAACCCTGAGGGGATCATCCAA
GGCCAGAAGCCACAGGTGCAGGAGCACGGGCCTTATGTGTACAGGGAGTTCAGGCACAAG
AGCAACATCACCTTCAACAACAATGACACGGTGTCCTTCCTGGAGTACCGCAGCTACCAG
TTCCAGCCGGATAAGTCCCGCGGCCAGGAGAGCGACTACATCGTCATGCCCAACATCCTG
GTCTTGAGTGCGTCAATGATGATGGAGAACAGGCCCGGGCTCTTGAAGCTGATGATGACC
TTGGCGTTCAGCACGCTTGGCCAGCGTGCCTTCATGAACCGCACTGTTGGCGAGATCATG
TGGGGCTATGATGACCCCTTAATCCACCTCATCAATCAGTACTTCCCAAACTCGCTCCCC
TTCAAGGGCAAGTTCGGCTTATTTGCTGAGCTCAACAACTCCGATTCTGGCCTCTTCACC
GTGTTCACAGGGGTCAAAAACTTCAGCAGGATCCATCTCGTGGACAAGTGGAATGGAGTC
AGCAAGGTCAACTATTGGCATTCCGATCAGTGCAACATGATTAACGGAACTTCCGGGCAG
ATGTGGGCACCATTTATGACCCCTGAATCCTCGCTGGAATTTTACAGCCCTGAGGCCTGC
CGGTCCATGAAGCTCGTCTACAAGGAGCAGGGGGTGTTTGGAGGCATCCCCACCTTTCGC
TTCGTGGCTCCCAGCACCTTATTTGCCAACGGGTCCGTCTACCCGCCCAACGAGGGCTTC
TGCCCCTGCCGGGAGTCCGGAATCCAAAACGTCAGCACCTGCAGGTTCAATGCGCCCTTG
TTTCTCTCCCATCCTCACTTCTACAACGCTGACCCAGTCCTGGCAGAGGCAGTGTCTGGC
CTCCATCCTAACCCAAAAGAACATTCCTTGTTCCTGGACATCCACCCGGTCACCGGAATC
CCCATGAACTGCTCTGTGAAACTGCAGCTGAGCCTCTTCGTTAAGTCTGTGAAAGGCATC
GGACAAACTGGGAACATCCAGCCAGTGGTCCTGCCGCTAATGTGGTTCGAAGAGAGTGGA
GCAATGGAGGGTGAGACCCTTGAGACGTTCTATATCCAGCTGGTGTTGATGCCCAAAGTG
CTACACTATGCCCAGTATGTGCTCCTTGCCCTGGGCTGCGTCCTACTGCTCATCCCCATC
ATCTACCAAATCCGGAGCCAAGGTTCCAAAGATGCCATCAGCCAGCCCTGTCTGGCCACT
CAGCCAGACCAACTTCCCAGCCCCTACACCCCGCTTCTTCAGGACTCGCTCCGTGGACAG
CCCACCAGTCCCAAAGTCTGA
Enzyme 6 GenBank Gene ID BC134513 Link Image
Enzyme 6 GeneCard ID SCARB1 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:1
Enzyme 6 Locus 12q24.31
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References Not Available
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 2127
Enzyme 7 Name Cystic fibrosis transmembrane conductance regulator
Enzyme 7 Synonyms Not Available
Enzyme 7 Gene Name CFTR
Enzyme 7 Protein Sequence >Cystic fibrosis transmembrane conductance regulator
LMCLARSVLSKAKILLLDEPSAHLDPITYQIIRRTLKQAFANCTVILS
Enzyme 7 Number of Residues 48
Enzyme 7 Molecular Weight 5369.4
Enzyme 7 Theoretical pI 9.46
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Involved in chloride channel activity
Enzyme 7 Specific Function Not Available
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function Not Available
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • None
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 6635455 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q9TSX2 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name Q9TSX2_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence Not Available
Enzyme 7 GenBank Gene ID AF201742 Link Image
Enzyme 7 GeneCard ID CFTR Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:7
Enzyme 7 Locus 7q31.2
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References
  1. [PubMed Link Image]
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 2128
Enzyme 8 Name Sterol regulatory element-binding protein cleavage-activating protein
Enzyme 8 Synonyms
  1. SREBP cleavage-activating protein
  2. SCAP
Enzyme 8 Gene Name SCAP
Enzyme 8 Protein Sequence >Sterol regulatory element-binding protein cleavage-activating protein
MTLTERLREKISQAFYNHGLFCASYPIPIILFTGLCILACCYPLLKLPLPGTGPVEFTTP
VKDYSPPPLTSDHKPGEPNEQPEWYVGAPVAYIQQIFVKSSVSPWHKNLLAVDVFRSPLS
RAFQLVEEIRNHVLKDSSGTRSLEDVCLQVTDLLPGLRKLRNLLPEHGCLLLSPGNFWQN
DRERFHADPDIIRTIHQHEPKTLQTSATLKDLLFGVPGKYSGVSLYTRKRLVSYTITLVF
QHYHAKFLGSLRARLMLLHPSPNCSLRAESLVHVHFKEEIGIAELIPLVTTYIILFAYIY
FSTRKIDMVKSKWGLALAAVVTVLSSLLMSVGLCTLFGLTPTLNGGEIFPYLVVVIGLEN
VLVLTKSVVSTPVDLEVKLRIAQGLSSESWSIMKNMATELGIVLIGYFTLVPAIQEFCLF
AVVGLVSDFFLQMLFFTTVLSIDIRRMELADLNKRLPPEACLPPAKPVGRPTRFERQPTV
RPSMPHTITLQPSSFRNLRLPKRLRVIYFLARTRLAQRLIMAGTVVWIGILVYTDPAGLR
TYLAAQVTEQSPLGEGALAPLPVPSGVLPASHPDPAFSIFPPDASKLPENQTLPGEPPEP
GGLAEGVHDSPAPEVTWGPEDEELWRKLSFRHWPTLFSYYNITLAKRYVSLLPVIPVTLR
LNPREALEGRHPQDGRSAWPPPRPGQGGLWEAGPKGPGTAQAQRDLTLYKVAALGLASGI
VLVLLLLCLYRVLCPRNYGQPGAGPGRRRRGELPCDDYGYAPPETEIVPLVLRGHLMDIE
CLASDGMLLVSCCLAGHVCVWDAQTGDCLTRIPHPGQRRDSGVGSGLETQETWERLSDGG
KGGPEEPGDSPPLRHRPRGPPPPALFGDQPDLTCLIDTNFSARPQLPEPAQPEPRYRAGR
RAQDSAGYDFSRLVQRVYQEGGMAPVHTPALRPPSPGPTFPLAPEDEAGFPPEKSCPSLA
WAPSTDGSIWSLELQGSLIVVGRSSGRLEVWDAIEGTLRCSSEEVSSGITALVFLDRRIV
AARLNGSLDFFSLETHTALSPLQFRGAPGRGSSPASPACSSSDRVACHLTHTVPCAHQKP
ITALKAAAGRLVTGSQDHTLRVFRLEDSCCLFTLQGHSGAITTVYIDQTMVLASGGQDGA
ICLWDVLTGSRVSHMFAHRGDVTSLTCTTSCVISSGLDDLISIWDRSTGIKLYSIQQDLG
CGASLGVISDNLLVTGGQGCVSFWDLNYGDLLQTVYLGKNSEAQPARQILVLDNAAIVCN
FGSELSLVYVPSVLEKLD
Enzyme 8 Number of Residues 1278
Enzyme 8 Molecular Weight 139699.6
Enzyme 8 Theoretical pI 7.10
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Not Available
Enzyme 8 Specific Function Escort protein required for cholesterol as well as lipid homeostasis. Regulates export of the SCAP/SREBF complex from the ER upon low cholesterol. Formation of a ternary complex with INSIG at high sterol concentrations leads to masking of an ER-export signal in SCAP and retention of the complex in the ER. Low sterol concentrations trigger release of INSIG, a conformational change in the SSC domain of SCAP, unmasking of the ER export signal, recruitment into COPII-coated vesicles, transport to the Golgi complex, proteolytic cleavage of SREBF in the Golgi, release of the transcription factor fragment of SREBF from the membrane, its import into the nucleus and up-regulation of LDLR, INSIG1 and the mevalonate pathway
Enzyme 8 Pathways Not Available
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function
Enzyme 8 Signals
  • None
Enzyme 8 Transmembrane Regions
  • 19-39 280-300 313-333 345-365 402-422 424-444 519-539 708-728
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 151556356 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID A6QM06 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name SCAP_BOVIN Link Image
Enzyme 8 PDB ID Not Available
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence >3837 bp
ATGACCCTGACTGAAAGGCTGCGTGAGAAGATATCCCAGGCCTTCTACAACCATGGGCTG
TTCTGTGCGTCCTACCCCATCCCCATCATTCTCTTCACGGGGCTCTGCATCTTAGCCTGC
TGCTACCCACTGCTGAAGCTGCCCTTGCCAGGAACAGGACCTGTGGAATTCACCACTCCT
GTGAAAGATTACTCGCCCCCACCTCTGACCTCTGACCACAAGCCTGGAGAGCCCAATGAG
CAGCCAGAGTGGTACGTGGGGGCCCCGGTGGCTTATATCCAGCAGATATTTGTGAAATCT
TCCGTGTCTCCCTGGCACAAGAACCTCCTAGCAGTAGATGTGTTCCGCTCACCTCTGTCG
AGGGCATTCCAGCTGGTGGAGGAGATTCGGAACCACGTGCTGAAAGACAGCTCCGGGACC
AGGAGCCTGGAGGACGTGTGCCTGCAGGTGACTGACCTGCTGCCAGGCCTCAGGAAGCTC
CGCAACCTCCTGCCCGAGCATGGATGCCTGCTGCTCTCCCCCGGGAACTTCTGGCAGAAT
GACAGGGAGCGCTTCCACGCAGATCCCGACATCATCAGGACCATCCACCAGCACGAGCCC
AAAACCCTGCAGACCTCGGCCACACTCAAAGACCTGCTGTTTGGCGTCCCTGGGAAGTAC
AGCGGGGTGAGCCTGTACACCAGGAAGCGGCTGGTCTCATACACCATCACCCTGGTCTTC
CAGCACTACCACGCCAAGTTCCTGGGCAGCCTGCGGGCCCGCCTGATGCTCCTGCACCCC
AGCCCCAACTGCAGCCTCAGAGCAGAGAGCCTGGTCCATGTGCACTTCAAGGAGGAGATT
GGCATCGCTGAGCTCATCCCCCTGGTGACCACCTACATCATCCTGTTCGCCTACATCTAC
TTCTCCACACGCAAGATCGACATGGTCAAGTCCAAGTGGGGCCTGGCTCTGGCTGCCGTC
GTCACGGTGCTCAGCTCGCTGCTCATGTCTGTGGGGCTCTGCACACTCTTCGGCCTGACA
CCCACGCTCAATGGCGGGGAGATCTTCCCCTACCTGGTGGTGGTCATTGGGCTGGAGAAC
GTGCTGGTGCTCACCAAGTCCGTCGTCTCCACCCCGGTGGACCTCGAGGTGAAGCTGCGC
ATTGCCCAAGGCCTGAGCAGCGAGAGCTGGTCCATCATGAAGAACATGGCCACAGAGCTG
GGCATCGTCCTCATTGGCTACTTCACCCTAGTGCCTGCCATCCAGGAGTTCTGTCTTTTT
GCCGTCGTGGGGCTGGTGTCTGACTTTTTCCTTCAGATGCTGTTTTTCACCACTGTCCTG
TCCATTGACATTCGCCGGATGGAGCTGGCGGACCTGAACAAGCGGCTGCCCCCTGAGGCC
TGCCTGCCCCCAGCCAAGCCGGTGGGGCGGCCAACACGCTTTGAGCGGCAGCCGACTGTG
CGGCCATCCATGCCCCACACCATCACACTGCAGCCGTCCTCCTTCCGCAACCTGCGTCTC
CCCAAGCGGCTGCGTGTCATCTACTTCCTGGCCCGAACCCGCCTGGCACAGCGCCTCATC
ATGGCTGGCACGGTGGTGTGGATCGGCATCCTTGTGTACACGGACCCAGCTGGGCTGCGC
ACCTACCTGGCCGCCCAGGTAACGGAGCAGAGCCCGCTGGGCGAGGGTGCCCTGGCTCCT
CTGCCTGTGCCCAGTGGTGTGCTGCCTGCCAGCCACCCGGATCCTGCCTTTTCCATCTTC
CCGCCGGATGCCTCCAAGTTACCCGAGAACCAGACGTTGCCAGGGGAGCCGCCTGAGCCC
GGGGGTCTCGCCGAGGGCGTCCATGACAGCCCGGCCCCAGAGGTCACCTGGGGGCCCGAG
GACGAGGAGCTCTGGAGGAAACTGTCCTTCCGCCACTGGCCCACGCTCTTCAGCTATTAC
AACATCACACTGGCCAAGAGGTACGTCAGCCTGCTGCCTGTCATCCCCGTCACGCTCCGC
CTGAACCCGCGGGAGGCTCTGGAGGGCCGGCACCCTCAGGACGGCCGCAGCGCCTGGCCC
CCGCCCCGGCCCGGGCAGGGTGGGCTCTGGGAGGCCGGCCCCAAGGGGCCAGGCACGGCG
CAGGCGCAGAGAGACCTCACCCTGTACAAGGTGGCGGCACTTGGCCTGGCCTCAGGCATC
GTGCTTGTGCTGCTGCTGCTCTGCCTGTACCGTGTGCTCTGCCCGCGCAACTACGGGCAG
CCCGGCGCGGGGCCCGGCCGGCGGCGGCGGGGGGAGCTGCCCTGCGACGATTATGGCTAC
GCGCCCCCCGAGACGGAGATTGTGCCCCTGGTGCTGCGCGGGCACCTCATGGACATCGAG
TGTCTGGCCAGCGACGGGATGCTACTGGTGAGCTGTTGCCTGGCAGGCCACGTGTGTGTA
TGGGACGCGCAGACCGGAGACTGCCTCACCCGCATCCCGCACCCGGGGCAGCGGCGGGAC
AGCGGTGTTGGTAGCGGGCTGGAGACTCAGGAGACCTGGGAACGGCTGTCGGACGGCGGG
AAGGGTGGCCCGGAGGAGCCTGGGGACAGCCCTCCGCTGCGGCACCGGCCCCGGGGCCCT
CCACCCCCTGCCCTCTTTGGGGACCAGCCAGACCTCACCTGCTTGATTGACACCAACTTT
TCAGCGCGGCCACAGCTCCCCGAGCCGGCTCAGCCCGAGCCCCGGTACCGGGCGGGCCGC
CGTGCTCAAGACTCCGCAGGCTACGACTTCAGCCGCCTGGTGCAGCGCGTGTACCAGGAG
GGGGGCATGGCTCCCGTGCACACGCCAGCCCTGCGCCCACCCTCTCCCGGGCCCACGTTC
CCCCTGGCCCCTGAGGACGAGGCTGGCTTTCCTCCCGAGAAGAGCTGCCCGTCCCTCGCC
TGGGCCCCCAGCACAGATGGCTCCATCTGGAGTCTGGAGTTGCAGGGCAGCCTCATCGTG
GTGGGGCGGAGCAGTGGCCGGCTGGAGGTGTGGGACGCCATCGAGGGCACCCTGCGCTGC
AGCAGTGAGGAAGTGTCATCAGGCATCACGGCCCTCGTTTTCCTGGACAGAAGGATTGTG
GCCGCCCGACTCAATGGCTCCCTCGATTTCTTCTCTTTGGAGACCCACACTGCCCTCAGC
CCCCTGCAGTTCCGAGGGGCCCCGGGGCGGGGCAGTTCCCCTGCCTCCCCCGCGTGCAGC
AGCAGTGACAGGGTGGCTTGCCACCTGACCCACACCGTGCCCTGTGCACACCAGAAGCCC
ATCACAGCCCTGAAGGCCGCTGCCGGGCGCCTCGTGACTGGCAGCCAGGACCACACACTG
AGAGTGTTCCGCCTGGAGGATTCGTGCTGCCTCTTCACCCTGCAGGGCCACTCGGGGGCC
ATCACGACCGTGTATATTGACCAGACCATGGTGCTGGCCAGCGGAGGCCAAGACGGGGCC
ATCTGCCTGTGGGACGTGCTGACCGGCAGCCGGGTCAGCCACATGTTCGCTCACCGTGGG
GATGTCACCTCCCTCACCTGCACCACCTCGTGCGTCATCAGCAGTGGCCTGGACGACCTC
ATCAGCATCTGGGACCGCAGCACGGGCATCAAGCTCTACTCCATCCAGCAGGACCTGGGC
TGTGGCGCGAGCCTGGGTGTCATCTCAGACAACCTGCTGGTGACCGGCGGCCAGGGCTGT
GTTTCCTTTTGGGACCTGAACTACGGGGACCTGTTACAGACAGTCTACCTGGGCAAGAAC
AGCGAGGCCCAGCCGGCCCGCCAGATCCTGGTGCTGGACAACGCTGCCATTGTCTGCAAC
TTTGGCAGCGAGCTCAGCCTGGTGTACGTGCCCTCTGTGCTGGAGAAGCTGGACTGA
Enzyme 8 GenBank Gene ID BC148152 Link Image
Enzyme 8 GeneCard ID SCAP Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:3
Enzyme 8 Locus 3p21.31
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References Not Available
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 2129
Enzyme 9 Name StAR-related lipid transfer protein 5
Enzyme 9 Synonyms
  1. START domain-containing protein 5
  2. StARD5
Enzyme 9 Gene Name STARD5
Enzyme 9 Protein Sequence >StAR-related lipid transfer protein 5
MDLATAAQVSEAVAEKMLQYRRDKSGWKICREGNGVSVSWRPSVEFPGNLYKGEGIVNGT
PEQVWDCVKPLAGTLRAQWDENVNSFEIIESLTDTLLFSRTTTPSAVMKLISPRDFVDLI
LVRTYEDGTISSNAANVEHPSCPPNPAYVRGFNHPCGCFCEPLPGEPNKTSLVTFFQTDL
SGYLPQSVVDSFFPRSMAGFYANLEKAVKKFFG
Enzyme 9 Number of Residues 213
Enzyme 9 Molecular Weight 23572.5
Enzyme 9 Theoretical pI 5.06
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Not Available
Enzyme 9 Specific Function May be involved in the intracellular transport of sterols or other lipids. May bind cholesterol or other sterols
Enzyme 9 Pathways Not Available
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • None
Enzyme 9 Transmembrane Regions
  • None
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 119224061 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID A1A4M6 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name STAR5_BOVIN Link Image
Enzyme 9 PDB ID Not Available
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence >642 bp
ATGGACCTGGCGACGGCCGCGCAGGTGAGCGAGGCGGTGGCGGAGAAGATGCTCCAGTAC
CGGCGAGACAAGTCAGGCTGGAAGATTTGCCGGGAAGGCAACGGAGTTTCAGTTTCCTGG
AGGCCATCTGTGGAGTTTCCAGGGAACCTGTACAAAGGAGAAGGCATTGTGAATGGGACA
CCAGAGCAGGTGTGGGACTGCGTGAAGCCACTTGCTGGGACTTTACGAGCTCAGTGGGAT
GAGAATGTGAACAGTTTTGAAATTATTGAAAGCCTCACTGATACCCTGCTCTTCAGCAGA
ACCACTACCCCCTCGGCCGTCATGAAGCTTATTTCCCCCAGAGACTTTGTGGACCTGATA
CTGGTCAGGACGTACGAGGACGGCACCATCAGTTCCAATGCTGCCAATGTGGAGCATCCA
TCTTGTCCCCCAAATCCAGCTTACGTGAGAGGATTTAACCATCCCTGTGGTTGTTTCTGT
GAACCTCTGCCAGGGGAGCCAAACAAAACCAGCTTGGTCACGTTCTTCCAGACTGACCTC
AGTGGTTACCTCCCACAGAGCGTCGTGGACTCCTTCTTCCCCCGCAGCATGGCTGGGTTC
TACGCCAACCTTGAGAAAGCAGTGAAGAAATTCTTTGGTTGA
Enzyme 9 GenBank Gene ID BC126727 Link Image
Enzyme 9 GeneCard ID STARD5 Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Chromosome:1
Enzyme 9 Locus 15q26
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References Not Available
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 2130
Enzyme 10 Name APOM protein
Enzyme 10 Synonyms Not Available
Enzyme 10 Gene Name APOM
Enzyme 10 Protein Sequence >APOM protein
MAVGSAPMQLQLRATIRTKNGLCVPRKWIYHLSDGSTDLRTEGRPDMKTKLFSSACPGGI
MLKETGQGYQRFLLYNRSPHPPEKCVEEFQSLTSCLDFKAFLLTPRNQDACELSSN
Enzyme 10 Number of Residues 116
Enzyme 10 Molecular Weight 13026.9
Enzyme 10 Theoretical pI 8.76
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Involved in lipoprotein metabolic process
Enzyme 10 Specific Function Not Available
Enzyme 10 Pathways Not Available
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function Not Available
Enzyme 10 Signals
  • None
Enzyme 10 Transmembrane Regions
  • None
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 73587088 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID Q3ZBQ9 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name Q3ZBQ9_BOVIN Link Image
Enzyme 10 PDB ID Not Available
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >351 bp
ATGGCTGTGGGCTCTGCCCCCATGCAGCTCCAGCTTCGAGCGACCATCCGCACGAAAAAC
GGGCTTTGCGTGCCCCGGAAATGGATCTACCACCTGTCTGATGGGAGCACAGATCTCAGA
ACTGAAGGCCGCCCTGACATGAAGACCAAGCTCTTCTCCAGTGCATGCCCAGGTGGAATC
ATGCTGAAAGAGACAGGCCAGGGTTACCAGCGCTTCCTCCTCTACAATCGCTCACCCCAC
CCTCCTGAGAAGTGTGTGGAGGAATTCCAGTCCCTGACCTCCTGCCTGGACTTTAAGGCC
TTCTTACTGACTCCCAGGAATCAAGACGCCTGTGAGCTGTCCAGTAACTGA
Enzyme 10 GenBank Gene ID BC103165 Link Image
Enzyme 10 GeneCard ID APOM Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:6
Enzyme 10 Locus 6p21.33
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References Not Available
Enzyme 10 Metabolite References Not Available
Enzyme 11 [top]
Enzyme 11 ID 2131
Enzyme 11 Name Steroidogenic acute regulatory protein, mitochondrial
Enzyme 11 Synonyms
  1. StAR
  2. START domain-containing protein 1
  3. StARD1
Enzyme 11 Gene Name STAR
Enzyme 11 Protein Sequence >Steroidogenic acute regulatory protein, mitochondrial
MLLATFKLCAGSSYRHVRSMKGLQQQAVLAIGQELNRRALGGPAPAAWINQVRRRGSLLG
SQLEDPLYSDQELAYIQQGEEAMQRALGILKDQEGWKKESRQANGDEVLSKVIPDVGKVF
RLEVVVDQPMERLYEELVERMEAMGEWNPNVKEIKVLQKIGKDTVITHELAAEVAGNLVG
PRDFVSVRCTKRRGSMCVLAGMATLYEEMPQQKGVIRAEHGPTCMVLRPLAGSPSRTKLT
WLLSIDLKGWLPKTIINQVLSQTQVDFANHLRKRLESCPALEARC
Enzyme 11 Number of Residues 285
Enzyme 11 Molecular Weight 31870.8
Enzyme 11 Theoretical pI 9.02
Enzyme 11 GO Classification
Function
Process
Component
Enzyme 11 General Function Involved in cholesterol binding
Enzyme 11 Specific Function Plays a key role in steroid hormone synthesis by enhancing the metabolism of cholesterol into pregnenolone. Mediates the transfer of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane where it is cleaved to pregnenolone
Enzyme 11 Pathways
  • Steroid metabolism
  • cholesterol metabolism
Enzyme 11 Reactions Not Available
Enzyme 11 Pfam Domain Function
Enzyme 11 Signals
  • None
Enzyme 11 Transmembrane Regions
  • None
Enzyme 11 Essentiality Not Available
Enzyme 11 GenBank ID Protein 3129956 Link Image
Enzyme 11 UniProtKB/Swiss-Prot ID Q28918 Link Image
Enzyme 11 UniProtKB/Swiss-Prot Entry Name STAR_BOVIN Link Image
Enzyme 11 PDB ID Not Available
Enzyme 11 Cellular Location Not Available
Enzyme 11 Gene Sequence >858 bp
ATGCTGCTCGCGACGTTTAAGCTGTGTGCCGGAAGCTCCTACAGACATGTGCGCAGCATG
AAGGGGCTGCAGCAGCAGGCTGTGCTGGCCATCGGCCAGGAGCTGAACCGGAGGGCCCTA
GGGGGCCCGGCCCCAGCTGCGTGGATTAACCAGGTTCGGCGTCGCGGCTCTCTCCTAGGT
TCTCAGCTGGAAGACCCTCTCTACAGCGACCAAGAGCTGGCCCATATCCAGCAGGGAGAG
GAGGCCATGCAGTGGGCCCTGGGCATCCTCAAAGACCAGGAGGGCTGGAAGAAGGAGAGC
CGGCAGGCCAATGGGGACGAGGTGCTGAGTAAAGTGATCCCTGACGTGGGCAAGGTGTTC
CGGTTGGAGGTGGTGGTGGACCAGCCCATGGAGAGGCTTTATGAAGAGCTTGTGGAGCGC
ATGGAGGCCATGGGCGAGTGGAATCCCAATGTCAAGGAGATCAAGGTCCTGCAGAAGATT
GGAAAAGACACGGTCATCACTCACGAGTTGGCTGCAGAGGCGGCAGGAAACCTCGTGGGG
CCCCGAGACTTTGTGAGCGTACGCTGTACCAAGCGCCGGGGCTCCATGTGTGTGCTGGCT
GGCATGGCCACACTCTATGAGGAGATGCCCCAGCAGAAGGGTGTCATCAGAGCGGAGCAC
GGCCCCACCTGCATGGTGCTCCGCCCCTTGGCTGGAAGTCCCTCAAGGACCAAACTCACC
TGGCTGCTCAGCATTGACCTCAAGGGATGGCTGCCGAAGACCATCATCAACCAGGTCCTC
TCGCAGACCCAGGTGGATTTTGCCAATCACCTGCGCAAGCGCCTGGAGTCCTGCCCTGCT
CTTGAAGCTAGGTGTTGA
Enzyme 11 GenBank Gene ID Y17259 Link Image
Enzyme 11 GeneCard ID STAR Link Image
Enzyme 11 GenAtlas ID Not Available
Enzyme 11 HGNC ID Not Available
Enzyme 11 Chromosome Location Chromosome:8
Enzyme 11 Locus 8p11.2
Enzyme 11 SNPs SNPJam Report Link Image
Enzyme 11 General References
  1. [PubMed Link Image]
Enzyme 11 Metabolite References Not Available
Enzyme 12 [top]
Enzyme 12 ID 2132
Enzyme 12 Name Apolipoprotein E
Enzyme 12 Synonyms Not Available
Enzyme 12 Gene Name Not Available
Enzyme 12 Protein Sequence >Apolipoprotein E
LMEETMKEVKAYKEELEGQLGPMAQETQARVSKELQAAQARLGSDMEDLRNRLAQYRSEV
QAMLGQSTEELRARMASHLRKLRKRLLRDADDLKKRLAVYQAGASEGAERSLSAIRERFG
PLVEQGQSRAATLSTLAGQPLLERAEAWRQKLHGRLEEVGVRAQDRLDKIRQQLEEVHAK
VEEQGNQMRLQAEAFQARLRSWFEPLVEDMQRQWAGLVEKVQLALRPSPTSPPSENH
Enzyme 12 Number of Residues 237
Enzyme 12 Molecular Weight 27073.5
Enzyme 12 Theoretical pI 9.47
Enzyme 12 GO Classification
Function
Process
Component
Enzyme 12 General Function Cell cycle control, cell division, chromosome partitioning
Enzyme 12 Specific Function Not Available
Enzyme 12 Pathways Not Available
Enzyme 12 Reactions Not Available
Enzyme 12 Pfam Domain Function
Enzyme 12 Signals
  • None
Enzyme 12 Transmembrane Regions
  • None
Enzyme 12 Essentiality Not Available
Enzyme 12 GenBank ID Protein 110225417 Link Image
Enzyme 12 UniProtKB/Swiss-Prot ID Q0ZCB4 Link Image
Enzyme 12 UniProtKB/Swiss-Prot Entry Name Q0ZCB4_BOVIN Link Image
Enzyme 12 PDB ID Not Available
Enzyme 12 Cellular Location Not Available
Enzyme 12 Gene Sequence Not Available
Enzyme 12 GenBank Gene ID DQ538523 Link Image
Enzyme 12 GeneCard ID Not Available
Enzyme 12 GenAtlas ID Not Available
Enzyme 12 HGNC ID Not Available
Enzyme 12 Chromosome Location Not Available
Enzyme 12 Locus Not Available
Enzyme 12 SNPs SNPJam Report Link Image
Enzyme 12 General References Not Available
Enzyme 12 Metabolite References Not Available
Enzyme 13 [top]
Enzyme 13 ID 2133
Enzyme 13 Name Apolipoprotein E
Enzyme 13 Synonyms Not Available
Enzyme 13 Gene Name APOE
Enzyme 13 Protein Sequence >Apolipoprotein E
MKVLWVAVVVALLAGCQADMEGELGPEEPLTTQQPRGKDSQPWEQALGRFWDYLRWVQTL
SDQVQEELLNTQVIQELTALMEETMKEVKAYKEELEGQLGPMAQETQARVSKELQAAQAR
LGSDMEDLRNRLAQYRSEVQAMLGQSTEELRARMASHLRKLRKRLLRDADDLKKRLAVYQ
AGASEGAERSLSAIRERFGPLVEQGQSRASTLSTLAGQPLLERAEAWRQKLHGRLEEVGV
RAQDRMDKIRQQLEEVHAKVEEQGNQMRLQAEAFQARLRSWFEPLVEDMQRQWAGLVEKV
QLALRPSPTSPPSENH
Enzyme 13 Number of Residues 316
Enzyme 13 Molecular Weight 36072.7
Enzyme 13 Theoretical pI 5.58
Enzyme 13 GO Classification
Function
Process
Component
Enzyme 13 General Function Cell cycle control, cell division, chromosome partitioning
Enzyme 13 Specific Function Not Available
Enzyme 13 Pathways Not Available
Enzyme 13 Reactions Not Available
Enzyme 13 Pfam Domain Function
Enzyme 13 Signals
  • None
Enzyme 13 Transmembrane Regions
  • None
Enzyme 13 Essentiality Not Available
Enzyme 13 GenBank ID Protein 157279088 Link Image
Enzyme 13 UniProtKB/Swiss-Prot ID A7YWR0 Link Image
Enzyme 13 UniProtKB/Swiss-Prot Entry Name A7YWR0_BOVIN Link Image
Enzyme 13 PDB ID Not Available
Enzyme 13 Cellular Location Not Available
Enzyme 13 Gene Sequence >951 bp
ATGAAGGTTCTGTGGGTTGCCGTGGTGGTCGCGCTTCTGGCAGGATGCCAGGCGGATATG
GAGGGAGAGCTGGGGCCCGAGGAGCCCCTGACTACGCAGCAGCCCCGGGGGAAGGACAGC
CAGCCTTGGGAGCAGGCGCTGGGCCGCTTCTGGGATTACCTGCGCTGGGTGCAGACCCTG
TCTGACCAGGTGCAGGAGGAGCTGCTCAACACCCAGGTCATTCAGGAACTGACGGCGCTG
ATGGAGGAGACCATGAAGGAGGTGAAGGCCTACAAGGAGGAGCTGGAGGGACAGCTAGGC
CCCATGGCCCAGGAGACACAGGCCCGCGTGTCCAAGGAGCTGCAGGCAGCCCAGGCCCGG
CTAGGCTCCGACATGGAGGACTTGCGGAACCGCCTGGCACAGTACCGAAGCGAGGTGCAG
GCCATGCTGGGCCAGTCTACCGAGGAGCTGCGGGCCCGCATGGCCTCCCACCTGCGCAAG
CTGCGCAAGCGGCTGCTCCGCGACGCTGACGACCTGAAGAAGCGCCTGGCCGTCTACCAA
GCTGGGGCCAGCGAGGGTGCCGAGCGCAGCTTGAGCGCCATCCGCGAGCGCTTCGGGCCC
CTGGTGGAGCAGGGCCAATCGCGGGCATCCACCCTGAGCACCCTGGCCGGCCAGCCGCTG
CTGGAGCGTGCCGAGGCCTGGCGCCAGAAGCTGCACGGGCGCCTGGAGGAGGTGGGCGTC
CGGGCCCAGGACCGCATGGATAAGATACGCCAGCAGCTAGAGGAGGTGCACGCCAAGGTC
GAGGAGCAGGGCAACCAGATGCGCCTGCAGGCCGAGGCATTCCAGGCCCGCCTCAGGAGC
TGGTTCGAGCCCCTGGTGGAAGACATGCAGCGCCAGTGGGCTGGGCTGGTGGAGAAGGTG
CAGTTGGCTCTGCGCCCCAGCCCCACCTCTCCGCCCAGTGAGAATCATTGA
Enzyme 13 GenBank Gene ID BC134729 Link Image
Enzyme 13 GeneCard ID APOE Link Image
Enzyme 13 GenAtlas ID Not Available
Enzyme 13 HGNC ID Not Available
Enzyme 13 Chromosome Location Chromosome:1
Enzyme 13 Locus 19q13.2
Enzyme 13 SNPs SNPJam Report Link Image
Enzyme 13 General References Not Available
Enzyme 13 Metabolite References Not Available
Enzyme 14 [top]
Enzyme 14 ID 2134
Enzyme 14 Name Scavenger receptor class B member 1
Enzyme 14 Synonyms
  1. SRB1
  2. SR-BI
Enzyme 14 Gene Name SCARB1
Enzyme 14 Protein Sequence >Scavenger receptor class B member 1
MGNLSRARRVTAALGFIGLLFAVLGIIMIVMVPSIIKQQVLKNVRIDPNSLSFNMWKEIP
VPFYLSVYFFNIVNPEGIIQGQKPQVQEHGPYVYREFRHKSNITFNNNDTVSFLEYRSYQ
FQPDKSRGQESDYIVMPNILVLSASMMMENRPGLLKLMMTLAFSTLGQRAFMNRTVGEIM
WGYDDPLIHLINQYFPNSLPFKGKFGLFAELNNSDSGLFTVFTGVKNFSRIHLVDKWNGV
SKVNYWHSDQCNMINGTSGQMWAPFMTPESSLEFYSPEACRSMKLVYKEQGVFGGIPTFR
FVAPSTLFANGSVYPPNEGFCPCRESGIQNVSTCRFNAPLFLSHPHFYNADPVLAEAVSG
LHPNPKEHSLFLDIHPVTGIPMNCSVKLQLSLFVKSVKGIGQTGNIQPVVLPLMWFEESG
AMEGETLETFYIQLVLMPKVLHYAQYVLLALGCVLLLIPIIYQIRSQEKCYLFWISFKKG
SKDKEAVQAYSEFLMTSAPKGTVLQEARL
Enzyme 14 Number of Residues 509
Enzyme 14 Molecular Weight 57609.6
Enzyme 14 Theoretical pI 8.51
Enzyme 14 GO Classification
Function
Process
Component
Enzyme 14 General Function Involved in receptor activity
Enzyme 14 Specific Function Receptor for different ligands such as phospholipids, cholesterol ester, lipoproteins, phosphatidylserine and apoptotic cells. Probable receptor for HDL, located in particular region of the plasma membrane, called caveolae. Facilitates the flux of free and esterified cholesterol between the cell surface and extracellular donors and acceptors, such as HDL and to a lesser extent, apoB-containing lipoproteins and modified lipoproteins. Probably involved in the phagocytosis of apoptotic cells, via its phosphatidylserine binding activity
Enzyme 14 Pathways Not Available
Enzyme 14 Reactions Not Available
Enzyme 14 Pfam Domain Function
Enzyme 14 Signals
  • None
Enzyme 14 Transmembrane Regions
  • 12-32 441-461
Enzyme 14 Essentiality Not Available
Enzyme 14 GenBank ID Protein 2429348 Link Image
Enzyme 14 UniProtKB/Swiss-Prot ID O18824 Link Image
Enzyme 14 UniProtKB/Swiss-Prot Entry Name SCRB1_BOVIN Link Image
Enzyme 14 PDB ID Not Available
Enzyme 14 Cellular Location Not Available
Enzyme 14 Gene Sequence >1530 bp
ATGGGCAACCTCTCTAGAGCGCGCCGGGTGACCGCGGCGCTGGGTTTCATCGGGCTCCTC
TTCGCCGTGCTGGGCATTATCATGATCGTGATGGTGCCCTCAATCATCAAGCAGCAGGTC
CTCAAGAATGTGCGCATCGACCCCAACAGCCTGTCTTTCAACATGTGGAAGGAAATCCCT
GTCCCCTTCTACCTCTCTGTCTACTTTTTCAACATCGTCAACCCTGAGGGGATCATCCAA
GGCCAGAAGCCACAGGTGCAGGAGCACGGGCCTTATGTGTACAGGGAGTTCAGGCACAAG
AGCAACATCACCTTCAACAACAATGACACGGTGTCCTTCCTGGAGTACCGCAGCTACCAG
TTCCAGCCGGATAAGTCCCGCGGCCAGGAGAGCGACTACATCGTCATGCCCAACATCCTG
GTCTTGAGTGCGTCAATGATGATGGAGAACAGGCCCGGGCTCTTGAAGCTGATGATGACC
TTGGCGTTCAGCACGCTTGGCCAGCGTGCCTTCATGAACCGCACTGTTGGCGAGATCATG
TGGGGCTATGATGACCCCTTAATCCACCTCATCAATCAGTACTTCCCAAACTCGCTCCCC
TTCAAGGGCAAGTTCGGCTTATTTGCTGAGCTCAACAACTCCGATTCTGGCCTCTTCACC
GTGTTCACAGGGGTCAAAAACTTCAGCAGGATCCATCTCGTGGACAAGTGGAATGGAGTC
AGCAAGGTCAACTATTGGCATTCCGATCAGTGCAACATGATTAACGGAACTTCCGGGCAG
ATGTGGGCACCATTTATGACCCCTGAATCCTCGCTGGAATTTTACAGCCCTGAGGCCTGC
CGGTCCATGAAGCTCGTCTACAAGGAGCAGGGGGTGTTTGGAGGCATCCCCACCTTTCGC
TTCGTGGCTCCCAGCACCTTATTTGCCAACGGGTCCGTCTACCCGCCCAACGAGGGCTTC
TGCCCCTGCCGGGAGTCCGGAATCCAAAACGTCAGCACCTGCAGGTTCAATGCGCCCTTG
TTTCTCTCCCATCCTCACTTCTACAACGCTGACCCAGTCCTGGCAGAGGCAGTGTCTGGC
CTCCATCCTAACCCAAAAGAACATTCCTTGTTCCTGGACATCCACCCGGTCACCGGAATC
CCCATGAACTGCTCTGTGAAACTGCAGCTGAGCCTCTTCGTTAAGTCTGTGAAAGGCATC
GGACAAACTGGGAACATCCAGCCAGTGGTCCTGCCGCTAATGTGGTTCGAAGAGAGTGGA
GCAATGGAGGGTGAGACCCTTGAGACGTTCTATATCCAGCTGGTGTTGATGCCCAAAGTG
CTACACTATGCCCAGTATGTGCTCCTTGCCCTGGGCTGCGTCCTACTGCTCATCCCCATC
ATCTACCAAATCCGGAGCCAAGAGAAATGCTATTTATTTTGGATTAGTTTTAAAAAGGGC
TCAAAGGATAAGGAGGCCGTTCAGGCCTATTCTGAATTCCTGATGACATCAGCTCCCAAG
GGAACTGTACTGCAAGAAGCAAGACTGTAG
Enzyme 14 GenBank Gene ID AF019384 Link Image
Enzyme 14 GeneCard ID SCARB1 Link Image
Enzyme 14 GenAtlas ID Not Available
Enzyme 14 HGNC ID Not Available
Enzyme 14 Chromosome Location Chromosome:1
Enzyme 14 Locus 12q24.31
Enzyme 14 SNPs SNPJam Report Link Image
Enzyme 14 General References
  1. [PubMed Link Image]
Enzyme 14 Metabolite References Not Available
Enzyme 15 [top]
Enzyme 15 ID 2135
Enzyme 15 Name Na(+)/H(+) exchange regulatory cofactor NHE-RF3
Enzyme 15 Synonyms
  1. NHERF-3
  2. Sodium-hydrogen exchanger regulatory factor 3
  3. Na(+)/H(+) exchanger regulatory factor 3
  4. PDZ domain-containing protein 1
Enzyme 15 Gene Name PDZK1
Enzyme 15 Protein Sequence >Na(+)/H(+) exchange regulatory cofactor NHE-RF3
MASTFNPRECKLTKQEGNSYGFFLRIEKDTDGHLVRVIEKGSPAEKAGLQDGDRVLRING
VFVDKEEHMQVVDLVRKSGNSVTLLVLDGDSYEKAMKKQVDLKALGQSQEPSLNDKKAPS
VMNGGAQMWMQPRLCYLVKEGGSYGFSLKTVQGKNGVYMTDIKPQGVAMKAGVLADDHLI
EVNGENVEDASHEEVVEKVKKSGSRVTFLLVDKETDKHHSEQKIKVKRETASLKLLPCQP
RVVEMKKGSNGYGFYLRESPEQKGQIIKDIDPKSPAEKAGLKNNDLVVAVNGKSVESLDH
DSVVEMIRKGGDQTSLLVVDKETDNIYKLAGFSPFFYYQSQELPNGSVKEVPAPTPAPLE
VSSPETTEEVGDHKPKLCRLARGEDGYGFHLNAVRGQPGSFVKEVQKGGPADLAGLEDED
VIIEVNGVNMLDESYEKVVDRIQSSGKTVTLLVCGKKAYDYFQAKKIPIVSSMADPLDDD
PDPDEGRLEGSEQNSHMAEERERAHSTASHSSSNSEDTEM
Enzyme 15 Number of Residues 520
Enzyme 15 Molecular Weight 57175.1
Enzyme 15 Theoretical pI 5.11
Enzyme 15 GO Classification
Function
Process
Component
Enzyme 15 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 15 Specific Function A scaffold protein that connects plasma membrane proteins and regulatory components, regulating their surface expression in epithelial cells apical domains. May be involved in the coordination of a diverse range of regulatory processes for ion transport and second messenger cascades. In complex with SLC9A3R1, may cluster proteins that are functionally dependent in a mutual fashion and modulate the trafficking and the activity of the associated membrane proteins. May play a role in the cellular mechanisms associated with multidrug resistance through its interaction with ABCC2 and PDZK1IP1. May potentiate the CFTR chloride channel activity. May function to connect SCARB1 with the cellular machineries for intracellular cholesterol transport and/or metabolism. May be involved in the regulation of proximal tubular Na(+)-dependent inorganic phosphate cotransport therefore playing an important role in tubule function
Enzyme 15 Pathways Not Available
Enzyme 15 Reactions Not Available
Enzyme 15 Pfam Domain Function
Enzyme 15 Signals
  • None
Enzyme 15 Transmembrane Regions
  • None
Enzyme 15 Essentiality Not Available
Enzyme 15 GenBank ID Protein 74353938 Link Image
Enzyme 15 UniProtKB/Swiss-Prot ID Q3T0X8 Link Image
Enzyme 15 UniProtKB/Swiss-Prot Entry Name NHRF3_BOVIN Link Image
Enzyme 15 PDB ID Not Available
Enzyme 15 Cellular Location Not Available
Enzyme 15 Gene Sequence >1563 bp
ATGGCCTCCACCTTCAACCCCCGAGAATGTAAGCTAACCAAACAGGAAGGGAATAGCTAT
GGCTTCTTCCTGCGAATTGAGAAGGACACTGACGGCCACCTGGTCCGGGTGATTGAGAAG
GGTAGCCCAGCAGAGAAGGCGGGTCTCCAGGATGGAGACAGAGTTCTTAGGATCAATGGT
GTCTTCGTGGACAAGGAAGAGCATATGCAGGTTGTGGATCTGGTCAGAAAGAGTGGGAAT
TCAGTGACTTTACTAGTTCTGGATGGGGATTCCTACGAGAAAGCCATGAAAAAGCAAGTA
GACTTGAAAGCGTTGGGTCAAAGTCAGGAGCCGAGTTTGAATGATAAGAAGGCGCCCTCT
GTGATGAACGGAGGAGCACAGATGTGGATGCAGCCACGGCTCTGCTACCTAGTGAAGGAG
GGGGGTAGCTATGGCTTCTCTCTGAAAACTGTCCAAGGTAAAAATGGAGTGTACATGACA
GATATAAAACCTCAAGGTGTGGCTATGAAAGCTGGAGTGCTGGCTGATGACCACTTGATT
GAAGTGAATGGAGAGAATGTAGAGGATGCCAGCCACGAGGAGGTGGTTGAAAAGGTGAAG
AAGTCTGGAAGCCGTGTCACATTCCTGCTTGTGGACAAGGAAACTGACAAGCACCATAGC
GAGCAGAAGATAAAAGTCAAGAGAGAAACAGCCAGTTTGAAACTGCTACCCTGCCAGCCC
CGTGTTGTAGAGATGAAGAAGGGAAGCAATGGCTATGGTTTCTACTTGAGGGAAAGCCCA
GAACAGAAAGGTCAAATCATCAAGGACATAGATCCCAAAAGTCCAGCAGAAAAGGCTGGC
TTGAAGAACAATGACCTGGTGGTTGCTGTCAATGGCAAGTCTGTGGAGTCCCTTGATCAT
GACAGTGTGGTGGAAATGATTAGAAAGGGTGGAGATCAGACCTCTCTGCTGGTGGTAGAC
AAAGAGACAGACAACATCTATAAACTGGCTGGCTTTTCTCCATTCTTCTACTATCAAAGC
CAAGAGCTGCCTAATGGTTCTGTCAAGGAGGTTCCAGCTCCTACTCCTGCTCCTCTGGAG
GTCTCAAGCCCAGAAACTACAGAGGAAGTAGGAGATCATAAGCCTAAACTCTGCAGGCTG
GCTAGAGGTGAAGATGGCTATGGCTTTCACTTAAACGCGGTTCGGGGTCAGCCAGGCTCA
TTCGTCAAAGAGGTGCAGAAGGGCGGCCCTGCTGATCTGGCTGGGCTGGAGGATGAGGAC
GTCATCATTGAGGTGAATGGAGTGAACATGCTGGATGAGTCCTATGAGAAGGTGGTGGAC
AGAATCCAGAGCAGTGGCAAGACTGTCACACTCTTAGTCTGTGGAAAGAAGGCCTATGAT
TATTTCCAGGCTAAGAAAATCCCTATCGTTTCCTCCATGGCTGATCCGCTGGATGATGAC
CCTGATCCTGATGAAGGAAGGCTGGAAGGATCAGAGCAAAACTCACACATGGCAGAAGAA
AGAGAACGAGCCCACAGTACAGCCTCTCATTCTTCTTCCAATTCTGAAGACACAGAGATG
TGA
Enzyme 15 GenBank Gene ID BC102213 Link Image
Enzyme 15 GeneCard ID PDZK1 Link Image
Enzyme 15 GenAtlas ID Not Available
Enzyme 15 HGNC ID Not Available
Enzyme 15 Chromosome Location Chromosome:1
Enzyme 15 Locus 1q21
Enzyme 15 SNPs SNPJam Report Link Image
Enzyme 15 General References Not Available
Enzyme 15 Metabolite References Not Available