We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Creatine (BMDB00064)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-28 10:46:23
Accession Number BMDB00064
Common Name Creatine
Description Creatine is an amino acid that occurs in vertebrate tissues and in urine. In muscle tissue, creatine generally occurs as phosphocreatine. Creatine is excreted as creatinine in the urine. Creatine functions as part of the cell's energy shuttle. The high energy phosphate group of ATP is transferred to creatine to form phosphocreatine in the following reaction: Cr + ATP <-> PCr + ADP. This reaction is reversibly catalyzed by creatine kinase. In the human body creatine is synthesized mainly in the liver by the use of parts from three different amino acids - arginine, glycine, and methionine. 95% of it is later stored in the skeletal muscles, with the rest in the brain, heart, testes.
Synonyms
  1. ((amino(imino)methyl)(methyl)amino)acetate
  2. ((amino(imino)methyl)(methyl)amino)acetic acid
  3. (alpha-Methylguanido)acetate
  4. (alpha-Methylguanido)acetic acid
  5. Cosmocair C 100
  6. Creatin
  7. Creatine
  8. Creatine hydrate
  9. Kreatin
  10. Krebiozon
  11. Methylguanidoacetate
  12. Methylguanidoacetic acid
  13. N-(Aminoiminomethyl)-N-Methyl-Glycine
  14. N-Methyl-N-guanylglycine
  15. Phosphagen
  16. [[Amino(imino)methyl](methyl)amino]acetate
  17. [[Amino(imino)methyl](methyl)amino]acetic acid
Chemical IUPAC Name 2-(carbamimidoyl-methyl-amino)acetic acid
Chemical Formula C4H9N3O2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Amino acids and Amino Acid conjugates
Class
  • Amino Acids
Sub Class
  • NA
Family
  • Mammalian_Metabolite
Species
  • carboxylic acid; guanidine
Biofunction
  • Component of Arginine and proline metabolism; Component of Glycine, serine and threonine metabolism
Application
Source
  • Endogenous
Average Molecular Weight 131.133
Monoisotopic Molecular Weight 131.069473
Isomeric SMILES CN(CC(O)=O)C(N)=N
Canonical SMILES CN(CC(O)=O)C(N)=N
KEGG Compound ID C00300 Link Image
BioCyc ID CREATINE Link Image
BiGG ID 34543 Link Image
Wikipedia Link Creatine Link Image
METLIN ID 7 Link Image
PubChem Compound 586 Link Image
PubChem Substance 10327145 Link Image
ChEBI ID 16919 Link Image
CAS Registry Number 57-00-1
InChI Identifier InChI=1/C4H9N3O2/c1-7(4(5)6)2-3(8)9/h2H2,1H3,(H3,5,6)(H,8,9)
Synthesis Reference Thalhammer, Franz; Gastner, Thomas. Preparation of creatine, creatine monohydrate and guanidinoacetic acid. Ger. Offen. (2007), 5pp.
Melting Point (Experimental) 303 oC
Experimental Water Solubility 13.3 mg/mL at 18 oC [YALKOWSKY,SH & DANNENFELSER,RM (1992)] Source: PhysProp
Predicted Water Solubility 4.11 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -0.2 [Predicted by PubChem via XLOGP]; -1.59 [Predicted by ALOGPS]; -3.72 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Show Image
Show Peaklist
Cellular Location
  • Cytoplasm
  • Extracellular
  • mitochondria
Biofluid Location Not Available
Tissue Location
Tissue References
Adipose Tissue
Bladder
Brain
Epidermis
Fibroblasts
Heart
Intestine
Kidney
Muscle
Myelin
Nerve Cells
Neuron
Placenta
Platelet
Prostate
Skeletal Muscle
Spleen
Testes
Concentrations (Normal)
Biofluid Breast_Milk
Value 478 +/- 43 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 2% milk
References
Biofluid Breast_Milk
Value 468 +/- 67 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in skim milk
References
Biofluid Breast_Milk
Value 496 +/- 38 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 1% milk
References
Biofluid Breast_Milk
Value 488 +/- 75 uM
Age N/A
Sex N/A
Condition Normal
Comments Quantified by NMR in 3.25% milk
References
Concentrations (Abnormal) Not Available
Pathway Names
  • Arginine and Proline Metabolism
  • Glycine, Serine and Threonine Metabolism
HMDB Pathways
Name Arginine and Proline Metabolism
Image Show Link Image
Name Glycine, Serine and Threonine Metabolism
Image Show Link Image
KEGG Pathways
Name Arginine and Proline Metabolism
Image Show Link Image
Name Glycine, Serine and Threonine Metabolism
Image Show Link Image
SimCell Pathways
Name Arginine and Proline Metabolism
Image Show Link Image
Graph
SBML
Name Glycine, Serine and Threonine Metabolism
Image Show Link Image
Graph Show Link Image
SBML Download (XML) Link Image
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Creatine kinase S-type, mitochondrial
  2. Creatine kinase B-type
  3. Creatine kinase U-type, mitochondrial
  4. Creatine kinase M-type
  5. Guanidinoacetate N-methyltransferase
  6. DNA-binding protein inhibitor ID-3
  7. Sodium- and chloride-dependent creatine transporter 1
Enzyme 1 [top]
Enzyme 1 ID 255
Enzyme 1 Name Creatine kinase S-type, mitochondrial
Enzyme 1 Synonyms
  1. Sarcomeric mitochondrial creatine kinase
  2. S-MtCK
  3. Basic-type mitochondrial creatine kinase
  4. Mib-CK
Enzyme 1 Gene Name CKMT2
Enzyme 1 Protein Sequence >Creatine kinase S-type, mitochondrial
MASTFSKLLTGRNASLLFATLGTGALTTGYLLNKQNVCAAAREQHKLFPPSADYPDLRKH
NNCMAECLTPAIYAKLRNKVTPSGYTLDQCIQTGVDNPGHPFIKTVGMVAGDEESYEVFA
DLFDPVIKLRHNGYDPRVMKHPTDLDASKITQGQFDERYVLSSRVRTGRSIRGLSLPPAC
SRAELREVENVAITALEGLKGDLAGRYYKLSEMTEQDQQRLIDDHFLFDKPVSPLLTCAG
MARDWPDARGIWHNYDKTFLIWINEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQE
RGWEFMWNERLGYILTCPSNLGTGLRAGVHVRIPKLSKDPRFSKILENLRLQKRGTGGVD
TAAVADVYDISNIDRIGRSEVELVQIVIDGVNYLVDCEKKLERGQDIKVPPPLPQFGKK
Enzyme 1 Number of Residues 419
Enzyme 1 Molecular Weight 47230.7
Enzyme 1 Theoretical pI 8.31
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Involved in ATP binding
Enzyme 1 Specific Function Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 73586811 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q3ZBP1 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name KCRS_BOVIN Link Image
Enzyme 1 PDB ID 1CRK Link Image
Enzyme 1 PDB File Show
Enzyme 1 3D Structure
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1260 bp
ATGGCCAGTACCTTCTCAAAGTTGCTGACTGGCCGCAATGCCTCTCTGTTATTTGCTACC
TTGGGCACCGGTGCCCTGACCACAGGGTACCTGCTGAATAAGCAGAATGTGTGTGCTGCG
GCCCGGGAGCAACACAAGCTATTCCCACCAAGCGCAGACTACCCTGACCTGCGCAAACAC
AACAACTGCATGGCCGAGTGCCTCACGCCGGCCATCTACGCCAAGCTCCGCAACAAGGTG
ACGCCCAGCGGCTATACCCTGGACCAGTGCATCCAGACCGGAGTGGACAACCCTGGCCAC
CCCTTCATAAAGACCGTGGGCATGGTGGCTGGCGACGAGGAGTCCTATGAGGTGTTTGCT
GACCTTTTTGACCCTGTCATTAAGCTGAGGCACAATGGCTATGACCCCAGGGTGATGAAG
CACCCCACGGATTTGGATGCATCCAAGATCACTCAGGGGCAGTTCGACGAGCGCTACGTG
CTGTCGTCTCGGGTGCGCACAGGCCGCAGCATCCGCGGGCTGAGCCTGCCGCCCGCCTGC
AGCCGGGCCGAGCTGAGGGAGGTGGAGAACGTGGCCATCACGGCACTGGAGGGTCTCAAG
GGGGACCTGGCCGGGCGCTACTACAAGCTGTCCGAGATGACGGAGCAGGACCAGCAGCGG
CTCATCGATGACCACTTTCTATTTGATAAGCCAGTATCCCCTTTACTAACTTGTGCTGGG
ATGGCCCGTGACTGGCCAGATGCCCGGGGAATCTGGCATAATTATGACAAGACATTTCTC
ATCTGGATTAATGAGGAAGACCACACCAGAGTAATCTCTATGGAGAAAGGAGGCAATATG
AAAAGAGTATTTGAGCGATTCTGTCGTGGACTTAAAGAGGTGGAACGCTTAATCCAAGAA
CGAGGCTGGGAGTTCATGTGGAATGAGCGCCTGGGGTACATTCTGACCTGCCCTTCAAAC
CTCGGCACGGGATTGCGAGCTGGTGTCCATGTCAGGATCCCAAAGCTCAGCAAGGATCCA
CGGTTTTCTAAGATCCTGGAGAACCTGAGACTGCAGAAGCGGGGCACAGGCGGTGTGGAC
ACTGCAGCGGTAGCAGACGTGTACGACATTTCCAACATAGATCGAATTGGCCGATCGGAG
GTCGAGCTTGTTCAGATAGTCATCGATGGAGTCAATTACCTGGTGGATTGTGAGAAGAAG
CTGGAGAGAGGCCAGGATATTAAGGTGCCACCTCCTCTACCTCAGTTTGGCAAGAAGTGA
Enzyme 1 GenBank Gene ID BC103190 Link Image
Enzyme 1 GeneCard ID CKMT2 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:5
Enzyme 1 Locus 5q13.3
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 256
Enzyme 2 Name Creatine kinase B-type
Enzyme 2 Synonyms
  1. Creatine kinase B chain
  2. B-CK
Enzyme 2 Gene Name CKB
Enzyme 2 Protein Sequence >Creatine kinase B-type
MPFSNSHNTLKLRFPAEDEFPDLSGHNNHMAKVLTPELYAELRAKSTPSGFTVDDVIQTG
VDNPGHPYIMTVGCVAGDEESYDVFKELFDPIIEDRHGGYKPTDEHKTDLNPDNLQGGDD
LDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMT
EAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISM
QKGGNMKEVFTRFCNGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLP
HLGKHEKFPEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLL
IEMEQRLEQGQAIDDLMPAQK
Enzyme 2 Number of Residues 381
Enzyme 2 Molecular Weight 42719.1
Enzyme 2 Theoretical pI 5.57
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Involved in ATP binding
Enzyme 2 Specific Function Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 59857781 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q5EA61 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name KCRB_BOVIN Link Image
Enzyme 2 PDB ID 1G0W Link Image
Enzyme 2 PDB File Show
Enzyme 2 3D Structure
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1146 bp
ATGCCCTTCTCCAATAGCCACAACACGCTGAAGCTGCGCTTCCCGGCCGAAGATGAGTTC
CCCGACCTCAGCGGCCACAACAACCACATGGCCAAGGTGCTGACCCCCGAGCTGTACGCC
GAGCTGCGCGCTAAGAGCACTCCGAGCGGCTTCACGGTGGACGACGTCATCCAGACCGGC
GTGGACAACCCAGGCCACCCCTATATCATGACCGTGGGCTGTGTGGCCGGCGATGAGGAG
TCGTACGACGTGTTCAAAGAGCTCTTTGACCCCATCATCGAGGACCGGCACGGAGGCTAT
AAGCCCACCGACGAGCACAAGACCGACCTCAACCCCGACAACCTGCAGGGCGGCGACGAC
CTGGATCCCAACTACGTGCTGAGCTCGCGGGTGCGCACGGGCCGCAGCATCCGCGGCTTC
TGCCTCCCCCCGCACTGCAGCCGTGGGGAGCGCCGCGCCATCGAGAAGCTCGCCGTCGAA
GCCCTGTCGAGCCTGGACGGTGACCTGGCGGGGAGGTACTATGCGCTCAAAAGCATGACG
GAGGCGGAGCAGCAGCAGCTTATCGACGACCACTTCCTTTTCGATAAGCCCGTGTCGCCC
CTGCTGCTGGCTTCGGGCATGGCCCGCGACTGGCCCGACGCCCGCGGCATCTGGCATAAC
GACAATAAGACCTTCCTGGTGTGGATCAACGAGGAGGACCATCTGCGGGTCATCTCCATG
CAAAAGGGTGGCAACATGAAGGAGGTGTTCACACGCTTCTGCAACGGCCTCACCCAGATT
GAAACGCTCTTCAAGTCTAAGAACTACGAGTTCATGTGGAACCCTCACCTGGGCTACATC
CTCACCTGCCCGTCCAACCTGGGCACGGGGCTCCGGGCCGGGGTGCACATCAAGCTGCCC
CACCTGGGCAAGCACGAGAAGTTCCCCGAGGTGCTCAAGCGGCTGCGGCTTCAGAAGCGA
GGCACAGGCGGTGTGGACACGGCCGCCGTGGGCGGGGTCTTCGACGTCTCAAATGCCGAT
CGCCTGGGCTTCTCGGAGGTGGAGCTGGTGCAGATGGTGGTGGACGGTGTGAAGCTGCTC
ATCGAGATGGAGCAGCGGCTGGAGCAGGGCCAGGCCATCGATGACCTCATGCCGGCCCAG
AAGTGA
Enzyme 2 GenBank Gene ID BT020708 Link Image
Enzyme 2 GeneCard ID CKB Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 14q32
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 257
Enzyme 3 Name Creatine kinase U-type, mitochondrial
Enzyme 3 Synonyms
  1. Ubiquitous mitochondrial creatine kinase
  2. U-MtCK
  3. Acidic-type mitochondrial creatine kinase
  4. Mia-CK
Enzyme 3 Gene Name CKMT1
Enzyme 3 Protein Sequence >Creatine kinase U-type, mitochondrial
MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRSEPVRAASERRRLYPPSAEYPDLRKHN
NCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFAE
LFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACT
RAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGM
ARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKKVFERFCRGLKEVERLIQER
GWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDT
AATGSVFDISNLDRLGKSEVELVQLVIDGVNFLIDCERRLERGQDIRIPPPLPNKH
Enzyme 3 Number of Residues 416
Enzyme 3 Molecular Weight 46896.1
Enzyme 3 Theoretical pI 8.47
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Involved in ATP binding
Enzyme 3 Specific Function Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 6594314 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q9TTK8 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name KCRU_BOVIN Link Image
Enzyme 3 PDB ID 1QK1 Link Image
Enzyme 3 PDB File Show
Enzyme 3 3D Structure
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1251 bp
ATGGCTGGTCCCTTCTCTCGTCTGCTGTCTGCCCGCCCCGGGCTCAGGCTCCTGGCTTTG
GCTGGAGCTGGTTCTCTCGCCGCTGGGTTTCTACTCCGATCGGAACCTGTTCGAGCCGCC
AGTGAACGGCGGAGGCTGTATCCCCCGAGTGCTGAGTACCCAGACCTCCGAAAGCACAAC
AACTGCATGGCCAGTCACCTGACCCCAGCAGTCTATGCCCGGCTCTGCGACAAGACCACA
CCCACTGGCTGGACGCTAGATCAGTGTATCCAGACTGGCGTGGACAACCCTGGCCACCCC
TTCATCAAGACTGTGGGCATGGTAGCTGGTGATGAGGAGACCTATGAGGTATTTGCTGAG
CTGTTTGACCCTGTGATCCAAGAGCGACACAATGGATATGACCCCCGAACGATGAAACAT
ACCACCGACCTGGATGCCAGCAAGATCCGTTCTGGCTACTTTGATGAGAGGTATGTATTG
TCCTCAAGAGTCAGAACTGGTCGGAGTATCCGGGGACTCAGCCTGCCTCCAGCCTGTACT
CGGGCAGAGCGACGAGAGGTGGAACGTGTGGTCGTGGATGCGCTGAGTGGCCTGAAGGGT
GACCTGGCTGGACGCTACTATCGGCTCAGTGAGATGACAGAGGCTGAGCAGCAGCAGCTA
ATTGATGACCACTTCCTGTTTGATAAGCCTGTATCTCCATTATTGACCGCAGCAGGAATG
GCTCGAGACTGGCCGGATGCACGCGGAATCTGGCACAACAATGAAAAGAGCTTCTTGATC
TGGGTGAATGAGGAGGATCATACACGGGTCATCTCCATGGAGAAGGGTGGCAACATGAAG
AAAGTGTTTGAAAGATTCTGCAGAGGCCTCAAAGAGGTGGAGCGGCTGATCCAGGAGCGT
GGCTGGGAGTTCATGTGGAATGAGCGTCTGGGATACATCTTGACCTGTCCGTCTAACCTG
GGCACTGGACTTCGGGCAGGAGTGCACATCAAACTGCCCCTGCTGAGCAAAGATAGCCGC
TTCCCAAAGATCCTCGAGAACCTAAGGCTCCAAAAACGTGGAACTGGAGGAGTAGACACA
GCTGCCACAGGCAGTGTCTTTGATATCTCTAATTTGGACCGACTGGGCAAGTCAGAGGTG
GAGCTGGTGCAGCTGGTCATCGATGGAGTAAACTTCCTGATTGACTGTGAACGGCGTCTG
GAGAGAGGCCAGGATATCCGCATCCCTCCACCTCTCCCCAACAAGCATTAA
Enzyme 3 GenBank Gene ID AB003307 Link Image
Enzyme 3 GeneCard ID CKMT1 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Not Available
Enzyme 3 Locus Not Available
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 258
Enzyme 4 Name Creatine kinase M-type
Enzyme 4 Synonyms
  1. Creatine kinase M chain
  2. M-CK
Enzyme 4 Gene Name CKM
Enzyme 4 Protein Sequence >Creatine kinase M-type
MPFGNTHNKHKLNFKAEEEYPDLSKHNNHMAKALTLEIYKKLRDKETPSGFTLDDVIQTG
VDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGFKPTDKHKTDLNHENLKGGDD
LDPNYVLSSRVRTGRSIKGYALPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMT
EQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISM
EKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLA
HLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLM
VEMEKKLEKGQSIDDMIPAQK
Enzyme 4 Number of Residues 381
Enzyme 4 Molecular Weight 42988.7
Enzyme 4 Theoretical pI 7.14
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in ATP binding
Enzyme 4 Specific Function Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 4838363 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q9XSC6 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name KCRM_BOVIN Link Image
Enzyme 4 PDB ID 1I0E Link Image
Enzyme 4 PDB File Show
Enzyme 4 3D Structure
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence Not Available
Enzyme 4 GenBank Gene ID AF120106 Link Image
Enzyme 4 GeneCard ID CKM Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 19q13.2-q13.3
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 412
Enzyme 5 Name Guanidinoacetate N-methyltransferase
Enzyme 5 Synonyms Not Available
Enzyme 5 Gene Name GAMT
Enzyme 5 Protein Sequence >Guanidinoacetate N-methyltransferase
MSAPAATPIFAPGENCSPAWRAAPAAYDASDTHLQILGKPVMERWETPYMHALAAAAASR
GGRVLEVGFGMAIAATKVQEAPIEEHWIIECNEGVFQRLQDWALQQPHKVVPLKGLWEEV
APTLPDSHFDGILYDTYPLSEETWHTHQFNFIRDHAFRLLKPGGVLTYCNLTSWGELMKT
KYSDITTMFEETQVPALLEAGFRRDNIRTQVMELVPPANCRYYAFPRMITPLVTKH
Enzyme 5 Number of Residues 236
Enzyme 5 Molecular Weight 26610.2
Enzyme 5 Theoretical pI 6.03
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Involved in guanidinoacetate N-methyltransferase activity
Enzyme 5 Specific Function S-adenosyl-L-methionine + guanidinoacetate = S-adenosyl-L-homocysteine + creatine
Enzyme 5 Pathways
  • Amine and polyamine biosynthesis
  • creatine biosynthesis
  • creatine from L-arginine and glycine:step 2/2
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function Not Available
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 83638578 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID Q2TBQ3 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name GAMT_BOVIN Link Image
Enzyme 5 PDB ID 1XCL Link Image
Enzyme 5 PDB File Show
Enzyme 5 3D Structure
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >711 bp
ATGAGCGCACCCGCCGCGACCCCAATCTTCGCGCCCGGCGAGAACTGCAGCCCCGCATGG
CGGGCTGCGCCCGCGGCCTACGACGCGTCGGACACGCACCTGCAGATCCTGGGCAAGCCG
GTGATGGAGCGCTGGGAGACCCCCTACATGCACGCGCTGGCGGCCGCCGCCGCCTCCAGA
GGGGGCCGGGTGCTAGAAGTGGGCTTCGGCATGGCCATCGCAGCCACAAAGGTGCAGGAG
GCTCCCATCGAGGAGCACTGGATTATTGAGTGCAACGAGGGCGTCTTCCAGCGGCTCCAG
GATTGGGCCCTGCAGCAGCCACACAAGGTGGTTCCCTTGAAAGGCCTGTGGGAGGAGGTG
GCACCCACCCTGCCAGACAGTCACTTTGATGGGATCCTGTACGATACATACCCGCTGTCG
GAGGAGACCTGGCACACTCACCAGTTCAACTTCATTCGGGACCATGCCTTCCGCCTGCTG
AAGCCAGGGGGTGTCCTCACCTACTGTAACCTCACCTCCTGGGGAGAGCTAATGAAGACC
AAGTATTCAGACATCACCACCATGTTTGAGGAGACCCAGGTGCCGGCCCTGCTGGAGGCG
GGCTTCCGGCGGGATAACATCCGCACACAGGTCATGGAGCTGGTCCCACCAGCCAACTGC
CGCTACTACGCCTTCCCGCGGATGATCACGCCCCTGGTCACCAAGCACTGA
Enzyme 5 GenBank Gene ID BC109825 Link Image
Enzyme 5 GeneCard ID GAMT Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:1
Enzyme 5 Locus 19p13.3
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References Not Available
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 1895
Enzyme 6 Name DNA-binding protein inhibitor ID-3
Enzyme 6 Synonyms
  1. Inhibitor of DNA binding 3
Enzyme 6 Gene Name ID3
Enzyme 6 Protein Sequence >DNA-binding protein inhibitor ID-3
MKALSPVRGCYEAVCCLSERSLAIARGRGKSPAAEEPLSLLDDMNHCYSRLRELVPGVPR
GTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDQRSFCH
Enzyme 6 Number of Residues 119
Enzyme 6 Molecular Weight 12998.8
Enzyme 6 Theoretical pI 5.13
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Involved in transcription regulator activity
Enzyme 6 Specific Function ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID-3 inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. May inhibit other transcription factors
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 59858443 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID Q5E981 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name ID3_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >360 bp
ATGAAGGCGCTCAGCCCGGTTCGCGGCTGCTACGAGGCGGTATGCTGCCTGTCGGAACGC
AGCCTGGCCATCGCGCGGGGCCGTGGCAAGAGCCCGGCCGCCGAGGAGCCGCTGAGCCTG
CTTGACGACATGAACCACTGCTACTCGCGACTGAGGGAACTGGTACCCGGAGTCCCGCGA
GGCACTCAGCTTAGCCAGGTGGAAATCCTGCAGCGCGTCATCGACTACATCCTCGACCTG
CAGGTGGTCCTGGCCGAGCCGGCCCCTGGGCCCCCAGACGGCCCGCATCTTCCCATCCAG
ACAGCTGAGCTCGCTCCGGAACTTGTGATCTCCAACGACCAAAGGAGCTTCTGCCACTGA
Enzyme 6 GenBank Gene ID BT021039 Link Image
Enzyme 6 GeneCard ID ID3 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:1
Enzyme 6 Locus 1p36.13-p36.12
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References
  1. [PubMed Link Image]
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 1896
Enzyme 7 Name Sodium- and chloride-dependent creatine transporter 1
Enzyme 7 Synonyms
  1. Creatine transporter 1
  2. CT1
  3. Solute carrier family 6 member 8
Enzyme 7 Gene Name SLC6A8
Enzyme 7 Protein Sequence >Sodium- and chloride-dependent creatine transporter 1
MANKSTENGIYSVSGEEKKGPLIAPGPDGAPAKGDGPAALGAPGSLLAVPPRETWTRQMD
FIMSCVGFAVGLGNVWRFPYLCYKNGGGVFLIPYILIALIGGIPIFFLEISLGQFMKAGS
INVWNICPLFKGLGYASMVIVFYCNTYYIMVLAWGFYYLVKSFTTTLPWATCGHTWNTPD
CVEIFRHEDCANATMANLTCDQLADRRSPVIEFWENKVLRLSEGLEVPGALNWEVTLCLL
TCWVLVYFCVWKGVKSTGKIVYFTATFPYVVLVVLLVRGVLLPGALDGIIYYLKPDWSKL
ASPQVWIDAGTQIFFSYAIGLGALTALGSYNRFNNNCYKDAIILALINSGTSFFAGFVVF
SILGFMATEQGVHISKVAESGPGLAFIAYPRAVTLMPVAPLWAALFFFMLLLLGLDSQFV
GVEGFITGLLDLLPASYYFRFQREISVALCCTICFVIDLSMVTDGGMYVFQLFDYYSASG
TTLLWQAFWECVVVAWVYGADRFMDDVACMIGYRPCPWMKWCWSFFTPLVCMGIFIFNVV
YHEPLVYNNTYVYPWWGEAVGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWG
LHHLEYRAQDSDVRGLTTLTPVSESSKVVVVESVM
Enzyme 7 Number of Residues 635
Enzyme 7 Molecular Weight 70675.2
Enzyme 7 Theoretical pI 5.88
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Involved in creatine:sodium symporter activity
Enzyme 7 Specific Function Required for the uptake of creatine. Plays an important role in supplying creatine to the brain via the blood-brain barrier
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • 61-81 88-108 139-159 231-251 270-290 305-325 342-362 395-415 445-465 480-500 521-541 561-581
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 2598962 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID O18875 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name SC6A8_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >1908 bp
ATGGCCAACAAGAGCACGGAGAACGGCATCTACAGCGTGTCCGGCGAGGAGAAGAAGGGC
CCCCTAATCGCGCCCGGGCCCGACGGAGCCCCGGCCAAGGGCGACGGCCCCGCAGCCCTG
GGGGCGCCCGGCAGCCTCCTGGCCGTTCCGCCGCGCGAGACCTGGACGCGCCAGATGGAC
TTCATCATGTCGTGCGTGGGCTTTGCCGTGGGCCTGGGCAACGTGTGGCGCTTCCCCTAC
CTGTGCTACAAGAACGGCGGAGGTGTGTTCCTTATTCCCTACATCCTGATCGCCCTGATT
GGAGGAATCCCCATCTTCTTCTTGGAGATCTCGCTGGGCCAGTTCATGAAGGCCGGCAGC
ATCAACGTCTGGAATATCTGCCCCCTGTTCAAAGGCCTGGGCTACGCCTCCATGGTGATC
GTCTTCTACTGCAACACCTATTACATCATGGTGCTGGCCTGGGGCTTCTATTATCTGGTG
AAGTCCTTCACCACCACGCTGCCCTGGGCCACGTGTGGCCACACGTGGAACACTCCCGAT
TGCGTGGAGATCTTCCGCCACGAAGACTGTGCCAATGCCACCATGGCCAACCTCACATGT
GACCAGCTTGCTGACCGCCGGTCCCCGGTCATCGAGTTCTGGGAGAACAAAGTCTTGCGG
CTCTCTGAAGGGCTGGAGGTGCCAGGGGCCCTCAACTGGGAGGTGACCCTGTGTCTGCTG
ACCTGCTGGGTGCTGGTCTACTTCTGTGTCTGGAAGGGGGTCAAGTCAACAGGCAAGATC
GTGTATTTCACCGCTACATTCCCCTATGTGGTCCTCGTTGTGCTGCTGGTGCGCGGAGTG
CTGCTACCTGGCGCTTTGGATGGCATCATCTACTATCTCAAGCCTGACTGGTCAAAGCTG
GCATCCCCTCAGGTATGGATCGACGCAGGGACACAGATCTTCTTCTCTTACGCCATCGGC
TTGGGGGCCCTCACCGCCCTGGGCAGCTACAATCGCTTCAACAACAACTGCTACAAGGAT
GCCATCATACTCGCCCTCATCAACAGCGGGACCAGCTTCTTTGCAGGCTTCGTGGTGTTC
TCCATCCTGGGCTTCATGGCCACAGAACAGGGCGTGCACATCTCCAAGGTAGCAGAATCA
GGGCCTGGCCTGGCTTTCATCGCCTATCCGCGGGCCGTCACGCTGATGCCCGTGGCCCCA
CTCTGGGCAGCTCTGTTCTTCTTCATGCTGTTGCTGCTTGGTCTGGACAGCCAGTTTGTA
GGTGTCGAAGGCTTCATCACTGGCTTGCTGGACCTCCTCCCAGCCTCCTACTACTTCCGA
TTCCAAAGGGAGATCTCCGTGGCCCTCTGTTGCACCATCTGCTTTGTCATCGACCTCTCC
ATGGTGACTGATGGCGGGATGTATGTCTTCCAGCTGTTTGACTACTACTCAGCCAGTGGC
ACCACACTGCTCTGGCAGGCCTTCTGGGAGTGTGTGGTGGTCGCCTGGGTGTACGGAGCT
GATCGCTTCATGGATGATGTGGCCTGCATGATCGGGTACCGACCTTGCCCCTGGATGAAA
TGGTGCTGGTCTTTCTTCACCCCACTGGTGTGCATGGGCATCTTCATCTTCAATGTGGTC
TACCATGAGCCGCTGGTCTACAACAATACCTACGTGTACCCGTGGTGGGGCGAGGCCGTG
GGCTGGGCCTTTGCGCTCTCCTCCATGCTATGTGTGCCCCTCCACCTCCTGGGCTGCCTC
CTCAGGGCCAAGGGGACCATGGCTGAGCGCTGGCAGCACCTGACGCAGCCCATCTGGGGC
CTCCACCACCTGGAATACAGAGCTCAAGACTCGGATGTCAGGGGCCTGACCACCCTGACC
CCAGTGTCTGAGAGCAGCAAGGTGGTGGTGGTGGAAAGCGTCATGTGA
Enzyme 7 GenBank Gene ID AF027197 Link Image
Enzyme 7 GeneCard ID SLC6A8 Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Not Available
Enzyme 7 Locus Xq28
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References Not Available
Enzyme 7 Metabolite References Not Available