We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Adenosine 3',5'-diphosphate (BMDB00061)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-05 20:57:39
Accession Number BMDB00061
Common Name Adenosine 3',5'-diphosphate
Description Adenosine 3', 5'-diphosphate or PAP is a nucleotide that is closely related to ADP. It has two phosphate groups attached to the 5' and 3' positions of the pentose sugar ribose (instead of pyrophosphoric acid at the 5' position, as found in ADP), and the nucleobase adenine. PAP is converted to PAPS by Sulfotransferase and then back to PAP after the sulfotransferase reaction. Sulfotransferase (STs) catalyze the transfer reaction of the sulfate group from the ubiquitous donor 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to an acceptor group of numerous substrates. This reaction, often referred to as sulfuryl transfer, sulfation, or sulfonation, is widely observed from bacteria to humans and plays a key role in various biological processes such as cell communication, growth and development, and defense. PAP also appears to a role in bipolar depression. Phosphatases converting 3'-phosphoadenosine 5'-phosphate (PAP) into adenosine 5'-phosphate are of fundamental importance in living cells as the accumulation of PAP is toxic to several cellular systems. These enzymes are lithium-sensitive and we have characterized a human PAP phosphatase as a potential target of lithium therapy.
Synonyms
  1. 3,5-Diphosphoadenosine
  2. 3,5-ADP
  3. 3-Phosphoadenosine 5-phosphate
  4. 3'-Phosphoryl-AMP
  5. 5-(dihydrogen phosphate) 3-Adenylate
  6. 5-(dihydrogen phosphate)3'-Adenylic acid
  7. Adenosine 3,5-bis
  8. Adenosine 3,5-bisphosphate
  9. Adenosine 3,5-diphosphic acid
  10. adenosine 3',5'-bisphosphate
Chemical IUPAC Name [5-(6-aminopurin-9-yl)-4-hydroxy-3-phosphonooxy-oxolan-2-yl]methoxyphosphonic acid
Chemical Formula C10H15N5O10P2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Nucleosides and Nucleoside conjugates
Class
  • Nucleotides
Sub Class
  • Nucleotide diphosphates
Family
  • Mammalian_Metabolite
Species
  • secondary alcohol; primary amine; primary aromatic amine; phosphoric acid ester; aromatic compound; heterocyclic compound
Biofunction
  • Component of Androgen and estrogen metabolism; Component of Chondroitin / Heparan sulfate biosynthesis; Component of Glycosphingolipid metabolism; Component of Sulfur metabolism
Application
Source
  • Endogenous
Average Molecular Weight 427.201
Monoisotopic Molecular Weight 427.029419
Isomeric SMILES NC1=NC=NC2=C1N=CN2[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](OP(O)(O)=O)[C@H]1O
Canonical SMILES NC1=NC=NC2=C1N=CN2C1OC(COP(O)(O)=O)C(OP(O)(O)=O)C1O
KEGG Compound ID C00054 Link Image
BioCyc ID 3-5-ADP Link Image
BiGG ID 33684 Link Image
Wikipedia Link Not Available
METLIN ID Not Available
PubChem Compound 159296 Link Image
PubChem Substance 836671 Link Image
ChEBI ID 17985 Link Image
CAS Registry Number 1053-73-2
InChI Identifier InChI=1/C10H15N5O10P2/c11-8-5-9(13-2-12-8)15(3-14-5)10-6(16)7(25-27(20,21)22)4(24-10)1-23-26(17,18)19/h2-4,6-7,10,16H,1H2,(H2,11,12,13)(H2,17,18,19)(H2,20,21,22)/t4-,6-,7-,10-/m1/s1
Synthesis Reference Tsunako, Mitsutomo; Kotone, Akira. Preparation of nucleoside-2',5'- and 3',5'-diphosphoric acids. Jpn. Kokai Tokkyo Koho (1991), 13 pp.
Melting Point (Experimental) Not Available
Experimental Water Solubility 614.5 mg/mL [HMP experimental] Source: PhysProp
Predicted Water Solubility 3.33 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -4
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -1.63 [Predicted by ALOGPS]; -4.7 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm (Predicted from LogP)
  • golgi apparatus
Biofluid Location Not Available
Tissue Location
Tissue References
Brain
Liver
Concentrations (Normal) Not Available
Concentrations (Abnormal) Not Available
Pathway Names
  • Sulfate and Sulfite Metabolism
HMDB Pathways
Name Sulfate and Sulfite Metabolism
Image Show Link Image
KEGG Pathways
Name Sulfate and Sulfite Metabolism
Image Show Link Image
SimCell Pathways
Name Sulfate and Sulfite Metabolism
Image Show Link Image
Graph
SBML
General References Not Available
Metabolic Enzymes
  1. Galactosylceramide sulfotransferase
  2. 3'(2'),5'-bisphosphate nucleotidase 1
  3. Protein-tyrosine sulfotransferase 2
  4. Sulfotransferase 1A1
  5. Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2
  6. Estrogen sulfotransferase
Enzyme 1 [top]
Enzyme 1 ID 80
Enzyme 1 Name Galactosylceramide sulfotransferase
Enzyme 1 Synonyms
  1. GalCer sulfotransferase
  2. Cerebroside sulfotransferase
  3. 3'-phosphoadenylylsulfate:galactosylceramide 3'-sulfotransferase
  4. 3'-phosphoadenosine-5'-phosphosulfate:GalCer sulfotransferase
Enzyme 1 Gene Name GAL3ST1
Enzyme 1 Protein Sequence >Galactosylceramide sulfotransferase
MPLPQKKRWESMAKGLVLGALFTSFLLLLYSYAVPPLYTGLASTTPEGAAPCSPAPREPE
APTSANGSAGGCQPRRDIVFMKTHKTASSTLLNILFRFGQKHGLKFAFPNGRNDFDYPAF
FARSLVQDYRPGACFNIICNHMRFHYDEVRGLVAPNATFITVLRDPARLFESSFHYFGSV
VPFTWKLSGRDKLAEFLQDPDRYYDARGYNAHYLRNLLFFDLGYDSDLDPSSPQVQEHIL
EVERHFHLVLLQEYFDESLVLLKDLLCWELEDVLYFKLNARRASAVPRLSGELYRRATAW
NVLDARLYRHFNASFWRKVEAFGRERMAREVAALRRANERMRRICIDGGRAVDAAAIEDS
AMQPWQPLGAKSILGYNLKKSIGQRHAQLCRRMLTPEIQYLMDLGANLWITKLWKFIRDF
LRW
Enzyme 1 Number of Residues 423
Enzyme 1 Molecular Weight 48753.6
Enzyme 1 Theoretical pI 9.53
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Involved in galactosylceramide sulfotransferase activity
Enzyme 1 Specific Function Catalyzes the sulfation of membrane glycolipids. Seems to prefer beta-glycosides at the non-reducing termini of sugar chains attached to a lipid moiety. Catalyzes the synthesis of HSO3-3-galactosylceramide (sulfatide), a major lipid component of the myelin sheath and of HSO3-3-monogalactosylalkylacylglycerol (seminolipid), present in spermatocytes. Also acts on lactosylceramide, galactosyl 1-alkyl-2-sn-glycerol and galactosyl diacylglycerol (in vitro)
Enzyme 1 Pathways
  • Lipid metabolism
  • sphingolipid metabolism
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • 15-35
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 151553575 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID A6QNK1 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name G3ST1_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1272 bp
ATGCCGCTGCCACAGAAGAAGCGCTGGGAGTCCATGGCCAAGGGGCTGGTGCTGGGAGCG
CTCTTCACCAGCTTCCTGCTACTGCTGTACTCCTATGCTGTCCCCCCACTGTACACTGGC
CTGGCTTCCACGACCCCCGAGGGCGCGGCACCCTGCTCTCCGGCCCCGAGGGAGCCAGAG
GCTCCCACCTCGGCCAACGGCTCGGCGGGAGGCTGCCAGCCGCGGCGGGACATCGTGTTC
ATGAAGACGCACAAGACGGCCAGCAGCACGCTGCTCAACATCCTGTTCCGCTTCGGCCAG
AAGCACGGGCTCAAGTTCGCCTTCCCCAACGGCCGCAACGACTTCGACTACCCCGCCTTC
TTCGCGCGCAGCCTGGTGCAGGACTACCGGCCCGGGGCCTGCTTCAACATCATCTGCAAC
CACATGCGCTTCCACTACGACGAGGTGCGGGGCCTGGTGGCGCCCAACGCCACCTTCATC
ACCGTGCTGCGCGACCCCGCCCGCCTCTTCGAGTCCTCCTTCCACTACTTCGGCTCCGTG
GTGCCCTTCACGTGGAAGCTCTCGGGCCGCGACAAGCTGGCCGAGTTCCTGCAGGACCCC
GACCGCTACTACGACGCCCGCGGCTACAACGCCCACTACCTCCGCAACCTGCTCTTCTTC
GACCTGGGCTACGACAGCGACCTGGACCCCAGCAGCCCGCAGGTGCAGGAGCACATCCTG
GAGGTGGAGCGCCACTTCCACCTGGTGCTGCTGCAGGAGTACTTCGACGAGTCGCTCGTG
CTGCTCAAGGACCTGCTGTGCTGGGAGCTGGAGGACGTGCTCTACTTCAAGCTCAACGCC
CGCCGCGCCTCGGCCGTGCCGCGCCTCTCGGGCGAGCTGTACCGGCGCGCCACGGCCTGG
AACGTGCTGGACGCGCGCCTCTACCGCCACTTCAACGCCAGCTTCTGGCGCAAGGTGGAG
GCCTTCGGGCGCGAGCGCATGGCCCGCGAGGTGGCCGCCCTGCGGCGCGCCAACGAGCGC
ATGCGCCGCATCTGCATCGACGGCGGCCGCGCGGTGGACGCGGCGGCCATCGAGGACTCG
GCCATGCAGCCCTGGCAGCCGCTGGGCGCCAAGTCCATCCTGGGCTACAACCTCAAGAAG
AGCATCGGGCAGCGGCATGCGCAGCTCTGCCGGCGCATGCTCACGCCGGAGATCCAGTAC
CTGATGGACCTGGGCGCCAACCTGTGGATCACCAAGCTCTGGAAGTTCATCCGGGACTTC
CTGCGGTGGTGA
Enzyme 1 GenBank Gene ID BC148870 Link Image
Enzyme 1 GeneCard ID GAL3ST1 Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:2
Enzyme 1 Locus 22q12.2
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 195
Enzyme 2 Name 3'(2'),5'-bisphosphate nucleotidase 1
Enzyme 2 Synonyms
  1. Bisphosphate 3'-nucleotidase 1
Enzyme 2 Gene Name BPNT1
Enzyme 2 Protein Sequence >3'(2'),5'-bisphosphate nucleotidase 1
MASSPTVLMRLVASAYSIAQKAGTIVRRVIAEGDLGIIEKTCATDLQTKADRLVQVSICS
SLARKFPKLTIIGEEDLPPEDVDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLD
GTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYQAGPDAVLGRTIWGVLGLGAFGF
QLKEAPAGKHIITTTRSHNSQLVTDCITAMNPDDVLRVGGAGNKIIQLIEGKASAYVFAS
PGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLATLRNYDYYASRVPQ
SVKNALVP
Enzyme 2 Number of Residues 308
Enzyme 2 Molecular Weight 33327.9
Enzyme 2 Theoretical pI 5.19
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Carbohydrate transport and metabolism
Enzyme 2 Specific Function Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4- trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 152941250 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q3ZCK3 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name BPNT1_BOVIN Link Image
Enzyme 2 PDB ID 1JP4 Link Image
Enzyme 2 PDB File Show
Enzyme 2 3D Structure
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >927 bp
ATGGCATCCAGTCCCACTGTGTTGATGCGGTTGGTGGCTTCAGCATATTCTATTGCTCAA
AAGGCAGGAACGATAGTCAGGCGTGTTATCGCCGAAGGAGACCTGGGTATCATTGAGAAG
ACCTGTGCAACAGACCTGCAGACCAAGGCTGACCGATTAGTTCAAGTGAGCATATGTTCT
TCATTGGCACGGAAGTTCCCCAAACTAACAATTATAGGGGAAGAGGATCTGCCTCCTGAA
GACGTGGATCAAGAGCTGATTGAAGATGGTCAGTGGGAGGAGATACTGAAGCAGCCGTGC
CCATCACAGTACAGTGCTATCAAGGAGGAAGATCTTGTGGTCTGGGTTGATCCTCTGGAT
GGGACCAAGGAATATACTGAAGGTCTTCTTGACAATGTAACAGTACTTATTGGAATTGCT
TATGAAGGAAAAGCCATAGCAGGAGTTATTAACCAGCCATATTACAACTACCAGGCAGGA
CCAGATGCTGTGCTGGGGAGAACTATCTGGGGAGTTTTGGGTTTAGGTGCCTTCGGGTTT
CAGCTGAAAGAAGCGCCCGCCGGCAAACACATCATCACAACAACCCGGTCCCATAACAGC
CAGTTGGTTACGGACTGCATCACTGCTATGAACCCTGATGATGTGCTGAGAGTGGGAGGA
GCAGGAAATAAGATAATTCAGCTGATTGAAGGCAAAGCCTCTGCTTATGTATTTGCAAGT
CCAGGATGCAAGAAGTGGGACACCTGTGCTCCAGAAGTCATTTTACATGCTGTCGGAGGC
AAGTTAACCGATATCCATGGAAATGCTCTTCAGTATAACAAGGAAGTGAAGCACATGAAC
TCGGCCGGAGTCCTGGCCACACTGAGGAATTATGACTATTATGCAAGTCGAGTCCCCCAG
TCTGTTAAAAATGCCCTTGTTCCTTGA
Enzyme 2 GenBank Gene ID BT030746 Link Image
Enzyme 2 GeneCard ID BPNT1 Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 1q41
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 375
Enzyme 3 Name Protein-tyrosine sulfotransferase 2
Enzyme 3 Synonyms
  1. Tyrosylprotein sulfotransferase-2
  2. TPST-2
Enzyme 3 Gene Name TPST2
Enzyme 3 Protein Sequence >Protein-tyrosine sulfotransferase 2
MRLSMRRALLAAGLALALVLAVHLGQRVLECQAVLGGPRGPRRTMRPEQEDLMMVGADHV
EYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREK
LRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLL
MVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGRDKCLPVYYEQ
LVLHPRRSLKVILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSK
WTGHIPGDVLRDMAQIAPMLARLGYDPYANPPNYGNPDPIVINNTHRVLKGDYKTPANLK
GYFQVNLNSTSSHLGSS
Enzyme 3 Number of Residues 377
Enzyme 3 Molecular Weight 41966.5
Enzyme 3 Theoretical pI 9.66
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Involved in protein-tyrosine sulfotransferase activity
Enzyme 3 Specific Function Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function Not Available
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • 9-25
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 74353892 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q3SYY2 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name TPST2_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1134 bp
ATGCGCCTGTCGATGCGGAGGGCGCTGCTGGCAGCCGGCCTGGCCCTGGCCCTGGTGCTG
GCCGTCCACCTGGGGCAGCGGGTGCTGGAGTGCCAGGCGGTGCTAGGGGGCCCACGGGGC
CCCCGGCGGACCATGCGGCCCGAGCAGGAGGACCTGATGATGGTGGGCGCAGACCACGTG
GAGTACCGCTACGGGAAGGCCATGCCGCTCATCTTCGTCGGGGGCGTGCCCCGGAGCGGC
ACCACGCTGATGCGGGCCATGCTGGACGCGCACCCCGAGGTGCGCTGCGGCGAGGAGACC
CGCATCATCCCACGCGTGCTGGCCATGCGCCAGGCCTGGTCCAAGTCGGGCCGGGAGAAG
CTGCGGCTGGACGAGGCGGGCGTGACGGACGAGGTGCTGGACGCCGCCATGCAGGCCTTC
ATCCTGGAGGTGATCGCCAAGCACGGCGAGCCGGCCCGTGTGCTCTGCAACAAGGACCCC
TTCACGCTCAAGTCCTCCGTCTACCTGTCGCGCCTCTTCCCCAACTCTAAGTTCCTGCTC
ATGGTGCGCGACGGCCGGGCCTCAGTGCACTCCATGATCACCCGCAAGGTCACCATCGCT
GGCTTCGACCTCAGCAGCTACCGCGACTGCCTCACCAAGTGGAACAAGGCCATCGAGGTG
ATGTACGCGCAGTGCATGGAGGTGGGCAGGGACAAGTGCCTGCCCGTGTACTACGAGCAG
CTGGTGCTACACCCCCGGCGCTCCCTCAAGGTCATCCTCGACTTCCTGGGCATCGCCTGG
AGCGACGCTGTCCTGCACCACGAGGACCTCATCGGCAAGCCGGGCGGCGTCTCCCTGTCC
AAGATTGAACGATCCACAGACCAGGTCATCAAGCCCGTGAACCTAGAAGCTCTCTCCAAG
TGGACTGGCCACATCCCTGGGGACGTGTTGAGGGACATGGCCCAGATCGCCCCCATGCTG
GCCCGGCTCGGCTATGACCCCTATGCAAACCCGCCCAACTACGGCAACCCCGACCCCATT
GTCATCAACAACACACACCGGGTCTTGAAAGGGGACTATAAAACACCAGCCAATCTGAAA
GGCTATTTTCAGGTGAACCTGAACAGCACCTCCTCCCACCTAGGAAGCTCATGA
Enzyme 3 GenBank Gene ID BC103334 Link Image
Enzyme 3 GeneCard ID TPST2 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:2
Enzyme 3 Locus 22q12.1
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 376
Enzyme 4 Name Sulfotransferase 1A1
Enzyme 4 Synonyms
  1. Aryl sulfotransferase
  2. Phenol sulfotransferase
  3. Phenol-sulfating phenol sulfotransferase
  4. P-PST
Enzyme 4 Gene Name SULT1A1
Enzyme 4 Protein Sequence >Sulfotransferase 1A1
MELIQDTSRPPAKYVKGIPLIKYFAEALGPLESFEAWPDDLLISTYPKSGTTWVSEILDL
IYQEGDLEKCQRAPVFLRVPFLEFSAPGVPTGVELLKDTPAPRLLKTHLPLALLPKTLLD
QKVKVIYIARNAKDVAVSYYHFYRMAKVHPDPGTWDSFLEKFMAGEVCYGSWYQHVQEWW
ELSHTHPVLYLFYEDIKEDPKREIQKILEFIGRSLPEETVDHIVQRTSFKEMKKNPMTNY
STIPTAVMDHSISAFMRKGITGDWKSTFTVAQNELFEAHYAKKMAGCKLRFRWEL
Enzyme 4 Number of Residues 295
Enzyme 4 Molecular Weight 34183.3
Enzyme 4 Theoretical pI 7.02
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in aryl sulfotransferase activity
Enzyme 4 Specific Function Catalyzes the sulfate conjugation of catecholamines and of phenolic drugs
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 1006837 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID P50227 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name ST1A1_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >885 bp
ATGGAACTGATCCAGGATACCTCCCGCCCTCCAGCAAAGTATGTGAAGGGCATCCCTCTC
ATCAAGTACTTTGCAGAGGCCCTGGGGCCACTGGAGAGCTTTGAAGCCTGGCCTGATGAC
TTGCTCATCAGCACCTACCCCAAGTCGGGCACCACCTGGGTAAGCGAGATCCTGGACCTG
ATCTACCAGGAGGGTGACCTGGAGAAGTGTCAGAGAGCCCCTGTCTTCTTGCGGGTGCCC
TTCCTTGAGTTCAGCGCCCCTGGGGTTCCCACAGGTGTTGAGCTTCTGAAAGATACACCA
GCCCCACGGCTCCTCAAGACACACTTGCCTCTGGCCCTGCTTCCGAAGACCCTGCTGGAT
CAGAAAGTCAAGGTGATCTACATCGCCCGCAACGCCAAGGATGTGGCCGTCTCCTATTAC
CACTTCTATCGCATGGCCAAGGTGCACCCTGACCCTGGCACCTGGGACAGCTTCCTGGAG
AAGTTCATGGCCGGGGAAGTGTGCTACGGGTCCTGGTACCAGCACGTGCAGGAGTGGTGG
GAGCTGAGTCACACCCACCCTGTTCTCTACCTCTTCTACGAGGACATAAAGGAGGACCCC
AAAAGGGAGATTCAGAAGATCCTGGAGTTTATAGGGCGCTCCCTGCCTGAGGAGACTGTG
GATCACATTGTCCAGCGCACATCTTTCAAAGAGATGAAGAAGAACCCCATGACCAACTAC
AGCACCATACCCACTGCAGTCATGGACCACAGCATCTCTGCCTTCATGAGGAAAGGCATC
ACTGGTGATTGGAAATCCACCTTCACTGTGGCCCAGAATGAGCTCTTTGAAGCCCACTAT
GCTAAGAAGATGCGGGCTGCAACTCCGCTTCGCTGGGAGCTGTGA
Enzyme 4 GenBank Gene ID U35253 Link Image
Enzyme 4 GeneCard ID SULT1A1 Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:1
Enzyme 4 Locus 16p12.1
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 377
Enzyme 5 Name Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2
Enzyme 5 Synonyms
  1. Glucosaminyl N-deacetylase/N-sulfotransferase 2
  2. NDST-2
  3. CCL44
  4. Heparan sulfate N-deacetylase 2
  5. Heparan sulfate N-sulfotransferase 2
Enzyme 5 Gene Name NDST2
Enzyme 5 Protein Sequence >Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2
MLKLWKVVRPARQLELHRLILLLIAFSLGSMGFLAYYVSTSPKAKEPLPLPLGDCSSSGA
AGGPGPVRPPVPPRPPRPPETARTEPVVLVFVESAYSQLGQEIVAILESSRFRYSTELAP
GRGDMPTLTDHTRGRYVLVIYENLLKYVNLDAWSRELLDRYCVEYGVGIIGFFRAHEHSL
LSAQLKGFPLFLHSNLGLRDYQVNPTAPLLHLTRPSRLEPGPLPGDDWTIFQSNHRTYEP
VLLGSLRPAEPPVPGPVARRARLPTVVQDLGVHDGIQRVLFGHGLSFWLHKLVFRDAGGY
LTGKGLLWDLDRYILVDIDDIFVGKEGTRMKVADVEALLTTQNKLRTLVPNFTFNLGFSG
KFYHTGTEEEDAGDDMLLNHRREFWWFPHMWSHMQPHLFHNRSVLADQMRLNKQFALEHG
IPTDLGYAVAPHHSGVYPIHTQLYEAWKSVWGIQVTSTEEYPHLRPARYRRGFIHNGIMV
LPRQTCGLFTHTIFYNEYPGGSRELDRSIRGGELFLTVLLNPISIFMTHLSNYGNDRLGL
YTFESLVRFLQCWTSLRLQTLPPVPLGRKYFDLFPQERSPLWQNPCDDKRHKDIWSKEKT
CDRLPKFLIVGPQKTGTTAIHFFLSLHPAVTSSFPSPSTFEEIQFFNGPNYHKGIDWYMD
FFPVPSNASTDFLFEKSATYFDSEVVPRRGAALLPRAKIITVLTNPADRAYSWYQHQRAH
GDPVALNYTFYQVITASSQDPPALRSLQNRCLVPGYYSTHLQRWLTYYPSGQLLIVDGQE
LRTNPAASMEIIQKFLGITPFLNYTRTLRFDEDKGFWCQGLEGGKTRCLGKSKGRKYPDM
DAESRLFLTDFFRNHNLELSKLLSRLGQPVPSWLREELQHSSSG
Enzyme 5 Number of Residues 884
Enzyme 5 Molecular Weight 100895.7
Enzyme 5 Theoretical pI 8.94
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Involved in [heparan sulfate]-glucosamine N-sulfotransf
Enzyme 5 Specific Function Essential bifunctional enzyme that catalyzes both the N- deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA dissacharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a role in determining the extent and pattern of sulfation of heparan sulfate
Enzyme 5 Pathways
  • Glycan metabolism
  • heparin biosynthesis
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • 19-39
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 3885496 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID O97583 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name NDST2_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >2655 bp
ATGCTCAAGCTGTGGAAGGTGGTACGCCCAGCTCGGCAGTTGGAACTGCACCGCCTCATA
CTGCTGCTGATTGCTTTCAGTCTGGGCTCCATGGGCTTCTTGGCTTACTACGTATCCACC
AGCCCCAAGGCCAAGGAACCGTTGCCVCTCCCCTTGGGAGACTGCAGCAGTAGTGGCGCA
GCGGGTGGTCCTGGCCCGGTTCGGCCTCCAGTCCCACCACGCCCCCCCAGGCCTCCAGAG
ACAGCGCGAACTGAACCCGTGGTCCTTGTGTTTGTGGAGAGTGCATACTCGCAGCTGGGG
CAGGAGATCGTGGCCATCTTGGAGTCTAGCCGTTTTCGTTACAGCACTGAGCTGGCACCT
GGCCGAGGGGACATGCCCACACTGACGGATCATACCCGGGGCCGGTATGTCTTGGTCATT
TATGAGAACCTGCTCAAGTACGTCAACCTGGATGCCTGGAGTCGGGAACTGCTAGACCGG
TACTGTGTGGAGTACGGTGTAGGCATCATTGGCTTTTTTCGAGCCCATGAGCACAGCCTA
CTGAGTGCCCAGCTCAAGGGCTTTCCCCTTTTTCTCCATTCAAACTTGGGGCTTCGGGAC
TACCAAGTGAATCCTACAGCTCCACTCCTACATCTCACACGTCCCAGCCGCCTGGAGCCT
GGGCCACTACCCGGTGATGACTGGACCATCTTCCAATCCAACCACAGGACCTATGAACCA
GTGCTTCTTGGCAGCCTTCGGCCGGCTGAGCCCCCTGTGCCAGGACCAGTGGCTCGGCGG
GCCCGGCTTCCCACTGTGGTGCAGGACCTGGGGGTTCACGATGGAATCCAGAGGGTGCTG
TTTGGGCACGGGCTCTCCTTCTGGCTCCACAAACTAGTTTTCCGCGATGCCGGTGGGTAC
CTCACTGGCAAGGGGCTCTTGTGGGACTTGGACCGTTACATCTTGGTAGACATCGATGAC
ATCTTTGTGGGCAAGGAAGGTACCCGCATGAAGGTGGCTGATGTTGAGGCCCTGTTGACC
ACGCAGAACAAACTCAGGACCTTAGTCCCCAACTTCACCTTCAACTTGGGCTTCTCGGGC
AAGTTCTATCATACTGGGACAGAGGAGGAGGATGCTGGGGACGACATGCTGCTGAATCAC
CGCCGAGAGTTCTGGTGGTTCCCCCACATGTGGAGCCACATGCAGCCACATCTGTTCCAC
AATCGCTCCGTGCTGGCTGACCAGATGAGGCTCAACAAACAGTTTGCTCTGGAACATGGG
ATTCCCACGGATCTGGGGTATGCTGTGGCCCCCCACCACTCCGGCGTGTACCCCATCCAC
ACACAGCTCTATGAAGCCTGGAAATCTGTGTGGGGCATCCAGGTGACCAGCACTGAGGAG
TACCCCCACCTCCGCCCTGCCCGCTACCGCCGCGGCTTCATTCACAATGGCATTATGGTG
CTGCCGCGGCAGACATGTGGCCTCTTCACTCACACAATCTTCTATAATGAGTATCCAGGA
GGCTCTCGTGAACTCGACCGGAGTATCCGAGGTGGAGAACTCTTTCTGACAGTGCTGCTT
AATCCGATCAGCATCTTTATGACTCATCTGTCGAACTATGGAAATGATCGCCTGGGTCTG
TACACCTTTGAGAGCCTGGTGCGCTTTCTCCAGTGCTGGACGAGCCTGCGCCTACAGACC
CTTCCTCCTGTCCCTCTTGGGCGAAAGTACTTTGACCTCTTCCCTCAAGAGCGAAGCCCC
CTTTGGCAGAATCCCTGTGACGACAAGAGGCACAAAGATATCTGGTCCAAGGAGAAAACC
TGTGATCGCCTCCCCAAGTTCCTCATTGTGGGACCCCAGAAGACAGGGACCACAGCTATT
CACTTCTTCCTGAGCCTGCATCCAGCTGTGACTAGCAGTTTTCCTAGCCCCAGCACCTTT
GAGGAGATTCAGTTCTTCAACGGCCCTAATTACCACAAGGGCATTGACTGGTACATGGAT
TTCTTCCCTGTCCCTTCCAATGCCAGCACTGATTTCCTATTTGAAAAAAGTGCCACGTAC
TTTGACTCAGAGGTTGTACCACGGCGGGGAGCTGCCCTCCTGCCACGAGCCAAGATCATC
ACTGTGCTCACCAACCCTGCTGACAGGGCATACTCCTGGTACCAGCATCAGCGAGCACAT
GGAGACCCAGTTGCTCTGAACTACACCTTCTACCAGGTGATTACAGCCTCCTCCCAGGAC
CCTCCAGCACTTCGCTCCCTACAAAACCGTTGTCTTGTCCCCGGCTACTATTCCACTCAC
TTACAACGCTGGCTGACTTACTACCCCTCTGGACAGTTGCTGATTGTGGATGGGCAAGAG
CTGCGTACCAACCCAGCTGCCTCAATGGAGATCATCCAGAAGTTCCTGGGTATCACACCC
TTTCTGAACTACACACGGACCCTCAGGTTCGATGAAGATAAGGGATTCTGGTGCCAGGGA
CTTGAAGGTGGCAAGACTCGTTGTCTAGGAAAGAGCAAAGGTCGGAAGTACCCAGATATG
GACGCTGAGTCCCGCCTTTTCCTTACGGATTTTTTCCGGAACCACAATTTGGAGCTGTCA
AAGCTGCTGAGCCGGCTTGGACAGCCAGTGCCCTCATGGCTTCGAGAAGAACTGCAGCAT
TCCAGTTCGGGCTGA
Enzyme 5 GenBank Gene ID AF064825 Link Image
Enzyme 5 GeneCard ID NDST2 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:1
Enzyme 5 Locus 10q22
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References
  1. [PubMed Link Image]
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 378
Enzyme 6 Name Estrogen sulfotransferase
Enzyme 6 Synonyms
  1. Sulfotransferase, estrogen-preferring
  2. ST1E1
Enzyme 6 Gene Name SULT1E1
Enzyme 6 Protein Sequence >Estrogen sulfotransferase
MSSSKPSFSDYFGKLGGIPMYKKFIEQFHNVEEFEARPDDLVIVTYPKSGTTWLSEIICM
IYNNGDVEKCKEDVIFNRVPYLECSTEHVMKGVKQLNEMASPRIVKSHLPVKLLPVSFWE
KNCKIIYLSRNAKDVVVSYYFLILMVTAIPDPDSFQDFVEKFMDGEVPYGSWFEHTKSWW
EKSKNPQVLFLFYEDMKENIRKEVMKLLEFLGRKASDELVDKIIKHTSFQEMKNNPSTNY
TTLPDEVMNQKVSPFMRKGDVGDWKNHFTVALNEKFDMHYEQQMKGSTLKFRTKI
Enzyme 6 Number of Residues 295
Enzyme 6 Molecular Weight 34639.8
Enzyme 6 Theoretical pI 7.18
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Involved in estrone sulfotransferase activity
Enzyme 6 Specific Function May control the level of the estrogen receptor by sulfurylating free estradiol
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 163463 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID P19217 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name ST1E1_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >888 bp
ATGAGTTCTTCCAAACCATCCTTTTCAGATTACTTTGGCAAACTTGGTGGAATACCAATG
TATAAAAAATTTATCGAGCAGTTTCATAACGTGGAGGAATTTGAGGCAAGACCAGATGAC
CTTGTCATTGTCACCTATCCCAAATCTGGTACAACATGGCTTAGTGAAATTATATGCATG
ATTTATAATAACGGTGATGTGGAAAAGTGCAAAGAAGACGTCATTTTTAATAGAGTTCCT
TACCTGGAATGTAGCACTGAACACGTGATGAAAGGAGTGAAACAATTAAATGAGATGGCA
TCTCCTAGAATAGTGAAGTCTCACCTGCCTGTGAAGCTTCTTCCAGTCTCATTTTGGGAA
AAGAACTGTAAGATCATCTATCTTTCCCGGAATGCCAAGGATGTGGTTGTTTCTTATTAT
TTTTTAATTTTAATGGTGACTGCTATTCCAGATCCTGACTCTTTTCAAGATTTTGTGGAG
AAATTCATGGATGGAGAAGTTCCTTATGGTTCCTGGTTTGAACATACAAAATCTTGGTGG
GAAAAGAGCAAGAATCCGCAAGTGCTATTTCTTTTCTATGAAGACATGAAGGAGAATATC
AGAAAAGAGGTGATGAAATTGTTAGAATTTCTGGGAAGGAAGGCATCAGATGAGCTTGTG
GACAAGATTATAAAACACACTTCATTCCAGGAGATGAAGAACAATCCATCTACCAATTAT
ACAACATTGCCGGATGAAGTCATGAACCAAAAAGTATCTCCCTTCATGAGAAAAGGAGAT
GTAGGAGACTGGAAGAATCACTTTACAGTAGCCCTGAATGAGAAATTTGACATGCACTAT
GAGCAGCAAATGAAGGGGTCTACCCTGAAGTTCCGAACTAAGATCTAG
Enzyme 6 GenBank Gene ID M54942 Link Image
Enzyme 6 GeneCard ID SULT1E1 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:4
Enzyme 6 Locus 4q13.1
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References
  1. [PubMed Link Image]
Enzyme 6 Metabolite References Not Available