We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Cyclic AMP (BMDB00058)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-08-07 11:41:00
Accession Number BMDB00058
Common Name Cyclic AMP
Description Cyclic AMP is an adenine nucleotide containing one phosphate group which is esterified to both the 3'- and 5'-positions of the sugar moiety. It is a second messenger and a key intracellular regulator, functioning as a mediator of activity for a number of hormones, including epinephrine, glucagon, and ACTH. cAMP is synthesized from ATP by adenylate cyclase. Adenylate cyclase is located at the cell membranes. Adenylate cyclase is activated by the hormones glucagon and adrenaline and by G protein. Liver adenylate cyclase responds more strongly to glucagon, and muscle adenylate cyclase responds more strongly to adrenaline. cAMP decomposition into AMP is catalyzed by the enzyme phosphodiesterase.
Synonyms
  1. Cyclic AMP
  2. 3'5'-cyclic AMP
  3. 6-(6-Amino-9H-purin-9-yl)tetrahydro-4H-furo[3,2-d][1,3,2]dioxaphosphinine-2,7-diol 2-oxide
  4. Acrasin
  5. Adenosine 3',5'-cyclic monophosphate
  6. Adenosine 3',5'-cyclic phosphate
  7. Adenosine 3',5'-cyclophosphate
  8. Adenosine 3',5'-monophosphate
  9. Adenosine 3,5'-cyclic monophosphorate
  10. Adenosine 3,5'-cyclic monophosphoric acid
  11. Adenosine cyclic monophosphate
  12. Cyclic 3',5'-AMP
  13. Cyclic 3',5'-adenylate
  14. Cyclic 3',5'-adenylic acid
  15. Cyclic adenosine 3',5'-phosphate
  16. adenosine cyclic-monophosphate
  17. adenosine-cyclic-phosphate
  18. adenosine-cyclic-phosphoric-acid
  19. cAMP
Chemical IUPAC Name cyclic 3',5'-(hydrogen phosphate)Adenosine
Chemical Formula C10H12N5O6P
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Nucleosides and Nucleoside conjugates
Class
  • Nucleotides
Sub Class
  • Nucleotide monophosphates
Family
  • Mammalian_Metabolite
Species
  • secondary alcohol; primary amine; primary aromatic amine; phosphoric acid ester; aromatic compound; heterocyclic compound
Biofunction
  • Second messenger; Component of Purine metabolism
Application
Source
  • Endogenous
Average Molecular Weight 329.206
Monoisotopic Molecular Weight 329.052521
Isomeric SMILES NC1=NC=NC2=C1N=CN2[C@@H]1O[C@@H]2COP(O)(=O)O[C@H]2[C@H]1O
Canonical SMILES NC1=NC=NC2=C1N=CN2C1OC2COP(O)(=O)OC2C1O
KEGG Compound ID C00575 Link Image
BioCyc ID CAMP Link Image
BiGG ID 1484809 Link Image
Wikipedia Link Cyclic AMP Link Image
METLIN ID 5120 Link Image
PubChem Compound 6076 Link Image
PubChem Substance 820438 Link Image
ChEBI ID 17489 Link Image
CAS Registry Number 60-92-4
InChI Identifier InChI=1/C10H12N5O6P/c11-8-5-9(13-2-12-8)15(3-14-5)10-6(16)7-4(20-10)1-19-22(17,18)21-7/h2-4,6-7,10,16H,1H2,(H,17,18)(H2,11,12,13)/t4-,6-,7-,10-/m1/s1
Synthesis Reference Genieser, H. G.; Butt, E.; Bottin, U.; Dostmann, W.; Jastorff, B. Synthesis of the 3',5'-cyclic phosphates from unprotected nucleosides. Synthesis (1989), (1), 53-4.
Melting Point (Experimental) 219-220 oC
Experimental Water Solubility 4 mg/mL [HMP experimental] Source: PhysProp
Predicted Water Solubility 136.0 mg/mL [MEYLAN,WM et al. (1996)]; 3.58 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -1
State Solid
Experimental LogP/Hydrophobicity -2.96 [HANSCH,C ET AL. (1995)] Source: PhysProp
Predicted LogP/Hydrophobicity -2.29 [Predicted by ALOGPS]; -2.5 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Varian)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Show Image
Show Peaklist
BMRB Spectrum Show Image
Show Peaklist
Cellular Location
  • Cytoplasm
  • Extracellular
  • golgi apparatus
Biofluid Location Not Available
Tissue Location
Tissue References
All Tissues
Concentrations (Normal)
Biofluid Breast_Milk
Value NA NA
Age NA
Sex NA
Condition Normal
Comments Detected but not quantified in conventional whole milk
References
Concentrations (Abnormal) Not Available
Pathway Names
  • Purine Metabolism
HMDB Pathways
Name Purine Metabolism
Image Show Link Image
KEGG Pathways
Name Purine Metabolism
Image Show Link Image
SimCell Pathways
Name Purine Metabolism
Image Show Link Image
Graph Show Link Image
SBML Download (XML) Link Image
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. cAMP-dependent protein kinase type II-alpha regulatory subunit
  2. cAMP-dependent protein kinase inhibitor alpha
  3. cAMP-dependent protein kinase type I-alpha regulatory subunit
  4. cAMP-dependent protein kinase type II-beta regulatory subunit
  5. Prostaglandin D2 receptor
  6. Cyclic AMP-responsive element-binding protein 1
  7. Cyclic AMP-responsive element-binding protein 3-like protein 3
  8. CAMP responsive element binding protein-like 1
  9. G-protein coupled bile acid receptor 1
  10. Cyclic AMP-dependent transcription factor ATF-1
  11. cAMP-responsive element modulator
  12. Cyclic nucleotide-gated olfactory channel
  13. Cyclic AMP-dependent transcription factor ATF-3
  14. Cyclic AMP-dependent transcription factor ATF-4
  15. Cyclic AMP-responsive element-binding protein 3
  16. Cyclic nucleotide-gated cation channel beta-1
  17. Cisplatin resistance-associated overexpressed protein
  18. Agouti-signaling protein
  19. CREB-regulated transcription coactivator 2
  20. cAMP responsive element binding protein 1 isoform A
Enzyme 1 [top]
Enzyme 1 ID 807
Enzyme 1 Name cAMP-dependent protein kinase type II-alpha regulatory subunit
Enzyme 1 Synonyms Not Available
Enzyme 1 Gene Name PRKAR2A
Enzyme 1 Protein Sequence >cAMP-dependent protein kinase type II-alpha regulatory subunit
MSHIQIPPGLTELLQGYTVEVLRQRPPDLVDFAVDYFTRLREARSRASTPPAAPPSGSQD
FDPGAGLVADAVADSESEDEEDLDVPIPGRFDRRVSVCAETYNPDEEEEDTDPRVIHPKT
DQQRCRLQEACKDILLFKNLDPEQLSQVLDAMFERTVKVDEHVIDQGDDGDNFYVIERGT
YDILVTKDNQTRSVGQYDNHGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVK
NNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKVYKDGERIITQGEKADSFYIIES
GEVSILIKSKTKVNKDGENQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMD
VQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSMDLIDPGQ
Enzyme 1 Number of Residues 401
Enzyme 1 Molecular Weight 45093.5
Enzyme 1 Theoretical pI 4.54
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Signal transduction mechanisms
Enzyme 1 Specific Function Not Available
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein Not Available
Enzyme 1 UniProtKB/Swiss-Prot ID P00515 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name KAP2_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence Not Available
Enzyme 1 GenBank Gene ID Not Available
Enzyme 1 GeneCard ID PRKAR2A Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:3
Enzyme 1 Locus 3p21.3-p21.2
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 808
Enzyme 2 Name cAMP-dependent protein kinase inhibitor alpha
Enzyme 2 Synonyms
  1. PKI-alpha
Enzyme 2 Gene Name PKIA
Enzyme 2 Protein Sequence >cAMP-dependent protein kinase inhibitor alpha
MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRNS
TEQSGEAQGEAAKSES
Enzyme 2 Number of Residues 76
Enzyme 2 Molecular Weight 8015.5
Enzyme 2 Theoretical pI 4.18
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Not Available
Enzyme 2 Specific Function Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 74356485 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q3SX13 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name IPKA_BOVIN Link Image
Enzyme 2 PDB ID 1CMK Link Image
Enzyme 2 PDB File Show
Enzyme 2 3D Structure
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >231 bp
ATGACTGATGTGGAAACTACATATGCAGATTTTATTGCTTCAGGAAGAACGGGTAGAAGA
AATGCAATACATGATATCCTGGTTTCCTCTGCAAGTGGCAACAGCAATGAATTAGCCTTG
AAATTAGCAGGTCTTGATATCAACAAGACAGAAGGGGAAGAAGATGCACAGCGAAATTCA
ACAGAACAAAGTGGGGAAGCCCAGGGAGAAGCAGCAAAATCTGAAAGTTAA
Enzyme 2 GenBank Gene ID BC104561 Link Image
Enzyme 2 GeneCard ID PKIA Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:8
Enzyme 2 Locus 8q21.12
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References Not Available
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 809
Enzyme 3 Name cAMP-dependent protein kinase type I-alpha regulatory subunit
Enzyme 3 Synonyms Not Available
Enzyme 3 Gene Name PRKAR1A
Enzyme 3 Protein Sequence >cAMP-dependent protein kinase type I-alpha regulatory subunit
MASGTTASEEERSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEE
AKQIQNLQKAGSRADSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKD
YKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGE
MDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLR
KRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAA
VLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGP
CSDILKRNIQQYNSFVSLSV
Enzyme 3 Number of Residues 380
Enzyme 3 Molecular Weight 42892.3
Enzyme 3 Theoretical pI 5.00
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Signal transduction mechanisms
Enzyme 3 Specific Function Not Available
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 146231876 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID P00514 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name KAP0_BOVIN Link Image
Enzyme 3 PDB ID 1RL3 Link Image
Enzyme 3 PDB File Show
Enzyme 3 3D Structure
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1143 bp
ATGGCTTCCGGCACCACCGCCAGCGAGGAGGAGCGCAGCCTCCGGGAATGCGAGCTCTAT
GTCCAGAAGCACAACATCCAGGCGCTGCTCAAGGACTCCATCGTGCAGCTGTGCACCGCA
CGGCCCGAGAGGCCCATGGCCTTCCTCAGGGAATACTTCGAGAAGCTGGAGAAGGAGGAG
GCAAAGCAGATCCAGAACCTGCAGAAAGCAGGCAGCCGTGCAGACTCTCGGGAGGATGAA
ATCTCCCCGCCGCCCCCTAACCCGGTGGTGAAGGGCCGGCGGCGACGCGGGGCCATCAGC
GCTGAGGTCTACACCGAGGAGGATGCCGCGTCCTATGTTCGGAAGGTTATACCGAAAGAT
TATAAGACAATGGCTGCTTTAGCTAAAGCCATTGAAAAGAACGTACTGTTTTCACATCTT
GATGATAACGAGAGAAGTGACATTTTTGACGCCATGTTCCCGGTTTCCTTTATTGCTGGA
GAGACTGTTATTCAGCAGGGTGACGAAGGGGATAACTTCTACGTGATTGACCAAGGAGAG
ATGGACGTCTATGTCAACAATGAATGGGCAACCAGTGTTGGGGAAGGAGGGAGCTTCGGG
GAGCTTGCTCTGATTTACGGGACTCCTCGAGCGGCCACTGTCAAGGCCAAGACGAACGTG
AAACTGTGGGGCATTGACCGGGACAGCTACAGAAGGATCCTCATGGGAAGCACGCTGAGA
AAGCGGAAGATGTATGAGGAGTTTCTTAGTAAAGTGTCTATTTTAGAATCTCTGGACAAG
TGGGAGCGTCTCACGGTAGCTGATGCATTGGAACCAGTCCAGTTTGAAGACGGGCAGAAG
ATTGTGGTACAGGGGGAGCCGGGTGATGAATTCTTCATTATTTTAGAGGGCTCAGCCGCG
GTGCTGCAGCGGCGCTCAGAGAACGAAGAGTTTGTGGAAGTGGGAAGGTTGGGGCCTTCA
GACTACTTCGGTGAGATCGCTCTGCTGATGAACCGGCCCCGTGCAGCCACCGTGGTGGCC
CGTGGCCCGCTGAAGTGCGTCAAGCTGGACCGGCCGCGGTTCGAGCGCGTTCTCGGCCCG
TGCTCCGACATCCTCAAGCGCAACATCCAGCAGTACAACAGCTTCGTGTCCCTGTCTGTC
TGA
Enzyme 3 GenBank Gene ID BT030573 Link Image
Enzyme 3 GeneCard ID PRKAR1A Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 17q23-q24
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 810
Enzyme 4 Name cAMP-dependent protein kinase type II-beta regulatory subunit
Enzyme 4 Synonyms Not Available
Enzyme 4 Gene Name PRKAR2B
Enzyme 4 Protein Sequence >cAMP-dependent protein kinase type II-beta regulatory subunit
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQEENERKGTARFGHEGRTWGD
AGAAGGGGTPSKGVNFAEEPRHSDSENGEEEEEEAADAGAFNAPVINRFTRRASVCAEAY
NPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEH
VIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATS
PGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDG
EQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKP
RAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
Enzyme 4 Number of Residues 418
Enzyme 4 Molecular Weight 46335.6
Enzyme 4 Theoretical pI 4.58
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Signal transduction mechanisms
Enzyme 4 Specific Function Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • None
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 163670 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID P31322 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name KAP3_BOVIN Link Image
Enzyme 4 PDB ID 1CX4 Link Image
Enzyme 4 PDB File Show
Enzyme 4 3D Structure
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >1257 bp
ATGAGCATCGAGATCCCAGCGGGACTGACGGAGCTGCTGCAGGGCTTCACCGTGGAGGTC
CTGAGGCACCAGCCCGCGGACCTGCTGGAGTTCGCGCTGCAGCACTTCACACGCCTGCAG
GAGGAGAACGAGCGCAAAGGCACCGCGCGCTTCGGCCATGAAGGCAGGACCTGGGGGGAC
GCGGGCGCCGCCGGCGGGGGCGGCACCCCCAGCAAGGGGGTCAACTTCGCCGAGGAGCCC
AGGCACAGCGATTCGGAGAACGGCGAGGAGGAGGAGGAAGAGGCCGCGGATGCAGGGGCA
TTCAACGCTCCAGTAATAAACCGATTTACAAGGCGTGCCTCAGTATGTGCAGAAGCTTAT
AATCCTGATGAAGAAGAAGATGATGCTGAATCCAGGATTATACATCCCAAAACTGACGAT
CAAAGAAATCGATTGCAAGAGGCTTGCAAAGACATCCTGCTATTTAAGAACCTGGATCCG
GAGCAGATGTCTCAAGTATTAGATGCCATGTTTGAAAAATTGGTTAAAGAAGGGGAACAT
GTAATTGATCAAGGTGATGATGGCGACAACTTTTATGTAATTGATAGAGGAACGTTTGAT
ATTTATGTGAAATGCGATGGTGTTGGACGGTGTGTTGGCAACTATGACAATCGTGGGAGT
TTTGGCGAACTGGCCTTAATGTACAACACACCCAGAGCAGCTACAATCACTGCTACCTCT
CCTGGTGCTCTGTGGGGTTTGGACAGGGTAACCTTCAGGAGGATAATTGTAAAAAATAAT
GCCAAAAAGAGAAAAATGTATGAAAGCTTTATTGAGTCACTGCCATTCCTTAAATCTTTG
GAAGTTTCTGAACGCCTGAAAGTGGTAGACGTGATAGGCACCAAAGTATACAACGATGGA
GAACAAATCATTGCTCAGGGAGATTCGGCTGATTCTTTTTTCATTGTAGAATCGGGAGAA
GTGAAAATTACTATGAAAAGGAAGGGTAAGTCAGAGGTGGAGGAGAACGGTGCAGTTGAA
ATCGCTCGGTGTTCTCGAGGGCAGTACTTCGGCGAACTGGCTCTGGTAACGAACAAGCCC
CGAGCCGCTTCCGCACACGCCATCGGGACCGTCAAATGTTTAGCCATGGATGTGCAAGCA
TTTGAAAGGCTTTTGGGACCTTGCATGGAAATTATGAAAAGGAACATCGCTACCTATGAA
GAGCAATTAGTTGCCCTGTTTGGAACAAACATGGATATTGTTGAACCCACTGCATGA
Enzyme 4 GenBank Gene ID J05692 Link Image
Enzyme 4 GeneCard ID PRKAR2B Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:7
Enzyme 4 Locus 7q22
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References
  1. [PubMed Link Image]
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 1335
Enzyme 5 Name Prostaglandin D2 receptor
Enzyme 5 Synonyms
  1. Prostanoid DP receptor
  2. PGD receptor
Enzyme 5 Gene Name PTGDR
Enzyme 5 Protein Sequence >Prostaglandin D2 receptor
MRPLFYRCHNTTSVEKGNSATMGGVLFSTGLVGNLLALGLLARSGLGSCPPRSPRPPPSV
FYVLVFGLTITDLLGKCLVSPFVLSAYAQNRSLRELVPGSDSSLCQAFAFIMSFFGLAST
LQLLAMALECWLSLGHPFFHRRHLTPRRGAMVAPVVGAFCLAFCALPLVGFGKFVQYCPG
TWCFFQMVHEERSLSVLSYSVLYASLMLLLVLAIVLCNLSAMRNLYAMHLRLRGLLRPGS
RERAEPGAGEREATPLHLEELDHLLLLALMTVLFTMCSLPLIYRAYYGAFKAVPEQNGTT
EETEDLRALRFLSVISIVDPWIFIIFRTSVFRMFFRKIFIRPLIYRNWHSNSCQTNMESS
L
Enzyme 5 Number of Residues 361
Enzyme 5 Molecular Weight 40371.2
Enzyme 5 Theoretical pI 9.04
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Involved in G-protein coupled receptor protein signalin
Enzyme 5 Specific Function Receptor for prostaglandin D2 (PGD2). The activity of this receptor is mainly mediated by G(s) proteins that stimulate adenylate cyclase, resulting in an elevation of intracellular cAMP. A mobilization of calcium is also observed, but without formation of inositol 1,4,5-trisphosphate
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • 22-42 59-79 108-128 151-171 196-216 263-283 311-331
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 146186994 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID A5D7K8 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name PD2R_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence >1086 bp
ATGAGGCCGCTGTTTTACCGCTGCCACAATACCACGTCGGTGGAGAAGGGCAATTCGGCG
ACGATGGGCGGGGTGCTCTTCAGCACGGGCCTCGTGGGCAACCTGCTGGCCCTGGGACTC
CTGGCGCGCTCCGGTCTGGGGTCGTGCCCGCCGCGCTCGCCGCGCCCGCCGCCCTCCGTC
TTCTACGTGCTGGTGTTCGGCCTGACGATCACAGACCTCCTGGGCAAGTGTCTAGTGAGC
CCCTTCGTGCTGTCCGCCTACGCGCAGAACCGAAGCCTGCGGGAGCTGGTGCCCGGATCG
GACAGCTCTCTGTGCCAAGCCTTCGCCTTCATCATGTCCTTCTTCGGGCTCGCCTCGACG
CTGCAGCTGCTGGCCATGGCCCTGGAGTGCTGGCTCTCCCTGGGGCACCCCTTCTTCCAT
CGACGGCACCTCACCCCGCGCCGGGGTGCAATGGTGGCGCCGGTGGTGGGCGCCTTCTGC
CTCGCTTTCTGCGCGCTGCCCTTGGTGGGCTTTGGGAAGTTTGTGCAGTACTGCCCTGGC
ACCTGGTGCTTCTTCCAGATGGTCCACGAGGAGCGCTCGCTGTCGGTGCTGAGCTACTCG
GTGCTCTACGCCAGCCTCATGCTGCTGCTGGTGCTCGCCATCGTGCTGTGCAACCTGAGC
GCCATGCGCAACCTCTATGCCATGCACCTGCGGCTGCGGGGACTCCTGCGCCCTGGCTCC
AGGGAACGCGCCGAGCCGGGCGCCGGCGAGAGGGAGGCGACCCCGCTGCACCTGGAGGAG
CTGGATCACCTCCTGCTGCTAGCCCTCATGACGGTGCTCTTCACCATGTGCTCCCTGCCT
TTAATTTATCGTGCTTACTATGGAGCGTTTAAAGCTGTTCCTGAGCAAAATGGAACCACT
GAAGAAACTGAAGACCTCCGAGCCTTGCGCTTTCTCTCTGTGATCTCAATTGTGGACCCT
TGGATTTTCATCATTTTCAGAACATCAGTGTTTCGAATGTTTTTTCGCAAGATTTTCATA
AGGCCCCTTATATATAGAAATTGGCACAGCAATTCTTGCCAAACTAACATGGAATCCAGT
CTATAA
Enzyme 5 GenBank Gene ID BC140594 Link Image
Enzyme 5 GeneCard ID PTGDR Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:1
Enzyme 5 Locus 14q22.1
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References Not Available
Enzyme 5 Metabolite References Not Available
Enzyme 6 [top]
Enzyme 6 ID 1589
Enzyme 6 Name Cyclic AMP-responsive element-binding protein 1
Enzyme 6 Synonyms
  1. cAMP-responsive element-binding protein 1
  2. CREB-1
  3. Cyclic AMP-responsive DNA-binding protein
Enzyme 6 Gene Name CREB1
Enzyme 6 Protein Sequence >Cyclic AMP-responsive element-binding protein 1
MESGAENQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQ
TVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSYRK
ILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLANN
GTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRT
APTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENRVA
VLENQNKTLIEELKALKDLYCHKSD
Enzyme 6 Number of Residues 325
Enzyme 6 Molecular Weight 34876.8
Enzyme 6 Theoretical pI 4.93
Enzyme 6 GO Classification
Function
Process
Component
Enzyme 6 General Function Involved in protein dimerization activity
Enzyme 6 Specific Function This protein binds the cAMP response element (CRE), a sequence present in many viral and cellular promoters. CREB stimulates transcription on binding to the CRE. Transciption activation is enhanced by the TORC coactivators which act independently of Ser-117 phosphorylation. Implicated in synchronization of circadian rhythmicity
Enzyme 6 Pathways Not Available
Enzyme 6 Reactions Not Available
Enzyme 6 Pfam Domain Function
Enzyme 6 Signals
  • None
Enzyme 6 Transmembrane Regions
  • None
Enzyme 6 Essentiality Not Available
Enzyme 6 GenBank ID Protein 286 Link Image
Enzyme 6 UniProtKB/Swiss-Prot ID P27925 Link Image
Enzyme 6 UniProtKB/Swiss-Prot Entry Name CREB1_BOVIN Link Image
Enzyme 6 PDB ID Not Available
Enzyme 6 Cellular Location Not Available
Enzyme 6 Gene Sequence >978 bp
ATGGAATCTGGAGCAGAGAACCAGCAGAGTGGAGATGCAGCTGTAACAGAAGCTGAAAGC
CAGCAAATGACAGTTCAAGCCCAGCCACAGATTGCCACATTAGCCCAGGTATCTATGCCA
GCAGCTCACGCAACATCATCTGCTCCCACCGTAACTTTAGTACAGCTGCCCAATGGGACC
AAGGTTCAAGTCCATGGAGTTATTCAGGCGGCCCAGCCATCAGTTATTCAGTCTCCACAA
GTCCAGACAGTTCAGATTTCAACTATTGCAGAAAGTGAAGATTCACAGGAGTCAGTGGAT
AGTGTAACCGATTCCCAAAAACGAAGAGAGATTCTTTCAAGGAGGCCTTCCTACAGGAAA
ATTTTGAATGACTTATCTTCTGATGCACCAGGAGTGCCAAGGATTGAAGAAGAGAAATCT
GAAGAGGAGACTTCAGCACCTGCCATCACCACTGTCACGGTGCCAACTCCGATTTATCAG
ACTAGCAGTGGACAGTATATTGCCATTACCCAAGGAGGAGCAATACAACTGGCTAACAAT
GGTACTGATGGGGTACAGGGCCTGCAGACATTAACCATGACCAATGCAGCTGCCACTCAG
CCAGGTACTACCATCCTGCAGTATGCACAGACCACTGATGGACAGCAAATCCTAGTGCCC
AGCAACCAAGTTGTTGTTCAAGCTGCCTCTGGAGATGTACAGACATACCAGATTCGCACA
GCGCCCACTAGCACCATTGCCCCTGGAGTTGTTATGGCGTCTTCCCCAGCACTTCCTACA
CAGCCTGCTGAAGAAGCGGCGCGAAAGAGAGAGGTTCGCCTCATGAAGAACAGGGAAGCA
GCACGAGAGTGTCGTAGAAAGAAGAAAGAATATGTGAAATGTCTAGAAAACAGAGTGGCA
GTGCTTGAAAATCAAAACAAGACACTGATTGAGGAGCTAAAAGCACTTAAGGACCTTTAC
TGCCACAAATCAGATTAA
Enzyme 6 GenBank Gene ID X57031 Link Image
Enzyme 6 GeneCard ID CREB1 Link Image
Enzyme 6 GenAtlas ID Not Available
Enzyme 6 HGNC ID Not Available
Enzyme 6 Chromosome Location Chromosome:2
Enzyme 6 Locus 2q34
Enzyme 6 SNPs SNPJam Report Link Image
Enzyme 6 General References
  1. [PubMed Link Image]
Enzyme 6 Metabolite References Not Available
Enzyme 7 [top]
Enzyme 7 ID 1986
Enzyme 7 Name Cyclic AMP-responsive element-binding protein 3-like protein 3
Enzyme 7 Synonyms
  1. cAMP-responsive element-binding protein 3-like protein 3
  2. Processed cyclic AMP-responsive element-binding protein 3-like protein 3
Enzyme 7 Gene Name CREB3L3
Enzyme 7 Protein Sequence >Cyclic AMP-responsive element-binding protein 3-like protein 3
MDGDLAIGKMASSTSPMGPIDSLELLDLLFDRQDGVLRHVELGEDWGHGEDQVLPGADSD
DFLNSILGSGDSDSPTWSPAASDSGISEDLPSDTQDTPPHGGVPATPAGCHSVESGKGPC
PSYHPGPTCPARHLGPVAPRLETSVAIDLEMWSPGVYAEEQTDLADSPSRYNLTVKDLLL
SSSSGDLQQHHLAAPHLLRPGTGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYEERMLK
KIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLLEQLKK
LQAIVVQSTSKSAQTGTCIAVLLFSFALIVLPSISPFASNRAESPGDFAPVRVFSRTLHN
DAASRVAPDTAPGSEAPGPGPNTGALQERSPGSPPGEWESQDTRALDNSTEDLDNSTLVQ
GNSVKELDQATLLDCAPPEPAVSPGHVGLEAAGGEL
Enzyme 7 Number of Residues 456
Enzyme 7 Molecular Weight 48688.8
Enzyme 7 Theoretical pI 4.65
Enzyme 7 GO Classification
Function
Process
Component
Enzyme 7 General Function Involved in protein dimerization activity
Enzyme 7 Specific Function Transcription factor that may act during endoplasmic reticulum stress by activating unfolded protein response target genes. Activated in response to cAMP stimulation. In vitro, binds the cAMP response element (CRE). Activates transcription through box-B element and CRE. Seems to function synergistically with ATF6. In acute inflammatory response, may activate expression of acute phase response (APR) genes. May be involved in growth suppression
Enzyme 7 Pathways Not Available
Enzyme 7 Reactions Not Available
Enzyme 7 Pfam Domain Function
Enzyme 7 Signals
  • None
Enzyme 7 Transmembrane Regions
  • 318-338
Enzyme 7 Essentiality Not Available
Enzyme 7 GenBank ID Protein 74353956 Link Image
Enzyme 7 UniProtKB/Swiss-Prot ID Q3SYZ3 Link Image
Enzyme 7 UniProtKB/Swiss-Prot Entry Name CR3L3_BOVIN Link Image
Enzyme 7 PDB ID Not Available
Enzyme 7 Cellular Location Not Available
Enzyme 7 Gene Sequence >1371 bp
ATGGATGGGGACTTAGCTATTGGAAAGATGGCTTCCTCCACCAGTCCCATGGGCCCTATC
GACAGCCTGGAACTCCTGGATCTACTGTTTGACCGGCAGGACGGCGTCCTGAGACACGTA
GAGCTGGGAGAGGACTGGGGCCATGGGGAGGACCAGGTCCTGCCAGGTGCGGACTCTGAT
GACTTCCTCAACTCCATCCTGGGTTCTGGAGATTCAGATTCCCCAACCTGGTCCCCCGCG
GCCAGTGACAGTGGCATCTCAGAAGATCTGCCCTCTGACACCCAGGACACACCTCCACAC
GGTGGGGTGCCTGCCACCCCTGCCGGCTGCCATAGTGTGGAGTCTGGCAAGGGGCCCTGC
CCCTCCTACCATCCTGGCCCCACCTGCCCTGCCAGGCACCTCGGGCCAGTGGCCCCAAGG
CTTGAGACTTCTGTTGCCATAGACCTGGAAATGTGGAGCCCAGGCGTCTATGCTGAGGAG
CAGACCGACCTGGCTGACTCGCCCTCACGCTACAACCTCACAGTCAAGGACCTCCTCCTC
TCCAGCAGCAGCGGGGACCTGCAGCAACATCACCTGGCAGCCCCCCACCTGTTGCGACCT
GGGACTGGGCACTGCCAGGAGCTGGTGCTGACGGAGGATGAGAAGAAGCTACTAGCCAAA
GAAGGCATCACTCTGCCCACTCAGCTGCCCCTTACCAAGTATGAGGAGCGAATGCTGAAA
AAGATCCGCCGGAAAATCCGAAACAAACAGTCAGCTCAAGAAAGCCGGAAAAAGAAGAAG
GAATACATTGATGGCCTGGAGACTCGGATGTCAGCTTGTACCGCCCAGAATCAGGAACTT
CAGAGGAAGGTCTTGCATCTCGAAAAGCAGAACCTGTCTCTCTTGGAACAGCTGAAGAAA
CTCCAGGCCATTGTGGTCCAGTCTACCAGCAAATCGGCACAGACGGGCACTTGCATAGCA
GTCCTGCTCTTCTCCTTCGCCCTCATCGTCCTCCCCTCCATCAGCCCTTTCGCCTCCAAC
AGAGCCGAGAGCCCCGGAGACTTCGCACCTGTGCGAGTTTTCTCCAGAACTCTACACAAC
GACGCGGCATCCCGGGTGGCTCCCGACACTGCACCAGGCTCTGAGGCCCCCGGACCCGGG
CCCAACACTGGTGCACTTCAGGAAAGGTCTCCAGGCAGCCCTCCGGGGGAATGGGAATCC
CAGGACACACGTGCTCTGGACAACTCGACAGAGGATCTGGACAACTCAACTCTGGTCCAG
GGCAACTCTGTGAAGGAACTGGACCAGGCCACCCTACTGGACTGTGCCCCACCTGAGCCA
GCAGTCAGCCCGGGCCACGTGGGGCTGGAGGCAGCAGGGGGGGAGCTGTGA
Enzyme 7 GenBank Gene ID BC103320 Link Image
Enzyme 7 GeneCard ID CREB3L3 Link Image
Enzyme 7 GenAtlas ID Not Available
Enzyme 7 HGNC ID Not Available
Enzyme 7 Chromosome Location Chromosome:1
Enzyme 7 Locus 19p13.3
Enzyme 7 SNPs SNPJam Report Link Image
Enzyme 7 General References Not Available
Enzyme 7 Metabolite References Not Available
Enzyme 8 [top]
Enzyme 8 ID 1987
Enzyme 8 Name CAMP responsive element binding protein-like 1
Enzyme 8 Synonyms Not Available
Enzyme 8 Gene Name CREBL1
Enzyme 8 Protein Sequence >CAMP responsive element binding protein-like 1
SRRKKKEYLQGLEARLQAVLADNQQLRRENAALRRRLEALLTENSELKLGSGNRKV
Enzyme 8 Number of Residues 56
Enzyme 8 Molecular Weight 6489.4
Enzyme 8 Theoretical pI 11.52
Enzyme 8 GO Classification
Function
Process
Component
Enzyme 8 General Function Involved in sequence-specific DNA binding
Enzyme 8 Specific Function Not Available
Enzyme 8 Pathways Not Available
Enzyme 8 Reactions Not Available
Enzyme 8 Pfam Domain Function Not Available
Enzyme 8 Signals
  • None
Enzyme 8 Transmembrane Regions
  • None
Enzyme 8 Essentiality Not Available
Enzyme 8 GenBank ID Protein 66866265 Link Image
Enzyme 8 UniProtKB/Swiss-Prot ID Q3KUS1 Link Image
Enzyme 8 UniProtKB/Swiss-Prot Entry Name Q3KUS1_BOVIN Link Image
Enzyme 8 PDB ID Not Available
Enzyme 8 Cellular Location Not Available
Enzyme 8 Gene Sequence Not Available
Enzyme 8 GenBank Gene ID AY881701 Link Image
Enzyme 8 GeneCard ID CREBL1 Link Image
Enzyme 8 GenAtlas ID Not Available
Enzyme 8 HGNC ID Not Available
Enzyme 8 Chromosome Location Chromosome:6
Enzyme 8 Locus 6p21.3
Enzyme 8 SNPs SNPJam Report Link Image
Enzyme 8 General References
  1. [PubMed Link Image]
Enzyme 8 Metabolite References Not Available
Enzyme 9 [top]
Enzyme 9 ID 1988
Enzyme 9 Name G-protein coupled bile acid receptor 1
Enzyme 9 Synonyms Not Available
Enzyme 9 Gene Name GPBAR1
Enzyme 9 Protein Sequence >G-protein coupled bile acid receptor 1
MTSNSTREVPSPVPAGALGLSLALASLIVAANLLLAVGIAGDRRLRSPPAGCFFLSLLLA
GLLTGLALPALPVLWSQSRRGYWSCLFLYLAPNFCFLSLLANLLLVHGERYMAVLRPLRP
RGSMRLALLLTWAAPLLFASLPALGWNHWAPGGNCSSQAVFPAPYLYLEIYGLLLPAVGA
AALLSVRVLVTAHRQLQDIRRLERAVCRGAPSALARALTWRQARAQAGATLLFGLCWGPY
VATLLLSVLAFEQRPPLGPGTLLSLISLGSASAAAVPVAMGLGDQRYTGPWRVAAQKWLR
MLRGRPQSSPGPSTAYHTSSQSSVDLDLN
Enzyme 9 Number of Residues 329
Enzyme 9 Molecular Weight 35103.8
Enzyme 9 Theoretical pI 11.14
Enzyme 9 GO Classification
Function
Process
Component
Enzyme 9 General Function Involved in G-protein coupled receptor activity
Enzyme 9 Specific Function Receptor for bile acid. Bile acid-binding induces its internalization, activation of extracellular signal-regulated kinase and intracellular cAMP production. May be involved in the suppression of macrophage functions by bile acids. Involved in bile acid promoted GLP1R secretion
Enzyme 9 Pathways Not Available
Enzyme 9 Reactions Not Available
Enzyme 9 Pfam Domain Function
Enzyme 9 Signals
  • None
Enzyme 9 Transmembrane Regions
  • 20-40 53-73 86-106 126-146 166-186 231-251 262-282
Enzyme 9 Essentiality Not Available
Enzyme 9 GenBank ID Protein 27807551 Link Image
Enzyme 9 UniProtKB/Swiss-Prot ID Q862A9 Link Image
Enzyme 9 UniProtKB/Swiss-Prot Entry Name GPBAR_BOVIN Link Image
Enzyme 9 PDB ID Not Available
Enzyme 9 Cellular Location Not Available
Enzyme 9 Gene Sequence Not Available
Enzyme 9 GenBank Gene ID AB089306 Link Image
Enzyme 9 GeneCard ID GPBAR1 Link Image
Enzyme 9 GenAtlas ID Not Available
Enzyme 9 HGNC ID Not Available
Enzyme 9 Chromosome Location Chromosome:2
Enzyme 9 Locus 2q35
Enzyme 9 SNPs SNPJam Report Link Image
Enzyme 9 General References
  1. [PubMed Link Image]
Enzyme 9 Metabolite References Not Available
Enzyme 10 [top]
Enzyme 10 ID 1989
Enzyme 10 Name Cyclic AMP-dependent transcription factor ATF-1
Enzyme 10 Synonyms
  1. cAMP-dependent transcription factor ATF-1
  2. Activating transcription factor 1
Enzyme 10 Gene Name ATF1
Enzyme 10 Protein Sequence >Cyclic AMP-dependent transcription factor ATF-1
MEDSHKSNTSETAPQSGSTVQAAHISHIAQQVSSLSESEESQDSSDSIGSSQKTHGILAR
RPSYRKILKDLSSEDIRGRKGDGENPGVSAVTSMSVPTPIYQTSTGQYIAIAPNGALQLA
SPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQI
RTTPSATSLPQTVVMTSPVTLTSQTSKTDDPQLKREIRLMKNREAARECRRKKKEYVKCL
ENRVAVLENQNKTLIEELKTLKDLYSNKSV
Enzyme 10 Number of Residues 270
Enzyme 10 Molecular Weight 29260.4
Enzyme 10 Theoretical pI 8.64
Enzyme 10 GO Classification
Function
Process
Component
Enzyme 10 General Function Involved in protein dimerization activity
Enzyme 10 Specific Function This protein binds the cAMP response element (CRE) (consensus:5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Mediates PKA-induced stimulation of CRE-reporter genes
Enzyme 10 Pathways Not Available
Enzyme 10 Reactions Not Available
Enzyme 10 Pfam Domain Function
Enzyme 10 Signals
  • None
Enzyme 10 Transmembrane Regions
  • None
Enzyme 10 Essentiality Not Available
Enzyme 10 GenBank ID Protein 115305226 Link Image
Enzyme 10 UniProtKB/Swiss-Prot ID Q08DA8 Link Image
Enzyme 10 UniProtKB/Swiss-Prot Entry Name ATF1_BOVIN Link Image
Enzyme 10 PDB ID Not Available
Enzyme 10 Cellular Location Not Available
Enzyme 10 Gene Sequence >813 bp
ATGGAAGATTCTCACAAGAGTAACACTTCAGAGACAGCACCTCAATCTGGTTCCACAGTT
CAGGCAGCTCATATTTCTCATATTGCTCAACAGGTATCATCTTTATCAGAGAGTGAGGAG
TCTCAGGACTCATCTGACAGCATAGGCTCCTCACAGAAAACCCACGGGATCCTAGCACGG
CGCCCATCTTACAGAAAGATTTTGAAAGACCTATCTTCTGAAGATATACGGGGCAGAAAA
GGAGACGGAGAAAACCCTGGAGTCTCTGCTGTCACTTCTATGTCTGTTCCAACTCCCATC
TATCAGACCAGCACCGGACAGTACATTGCCATTGCCCCAAATGGAGCCTTACAGCTGGCC
AGTCCAGGCACAGATGGAGTACAGGGCCTTCAGACATTAACCATGACAAATTCAGGCAGT
ACTCAGCAAGGTACAACAATTCTCCAGTACGCACAGACTTCTGATGGACAACAAATACTT
GTGCCCAGCAACCAGGTTGTTGTACAAACTGCGTCAGGAGATATGCAGACATATCAGATC
CGTACTACACCTTCAGCTACTTCACTACCACAGACTGTGGTGATGACATCTCCCGTGACC
CTTACATCTCAGACATCCAAGACAGATGACCCCCAACTGAAAAGAGAAATAAGGTTGATG
AAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTG
GAAAATCGAGTCGCAGTTCTGGAAAATCAAAACAAAACTCTAATAGAAGAGTTAAAAACT
TTGAAGGATCTTTATTCTAATAAAAGTGTTTGA
Enzyme 10 GenBank Gene ID BC123855 Link Image
Enzyme 10 GeneCard ID ATF1 Link Image
Enzyme 10 GenAtlas ID Not Available
Enzyme 10 HGNC ID Not Available
Enzyme 10 Chromosome Location Chromosome:1
Enzyme 10 Locus 12q13
Enzyme 10 SNPs SNPJam Report Link Image
Enzyme 10 General References Not Available
Enzyme 10 Metabolite References Not Available
Enzyme 11 [top]
Enzyme 11 ID 1990
Enzyme 11 Name cAMP-responsive element modulator
Enzyme 11 Synonyms Not Available
Enzyme 11 Gene Name CREM
Enzyme 11 Protein Sequence >cAMP-responsive element modulator
MSKCGRKKYMKTNLRQMTMETIDSQQDGSLPDSVAESESAHMQTQTGQNSIPTLAQVSVA
GSSTGRGSPAVTLVQLPSGQTVHVQGVIQTPQPSVIQSPQIQTVQVATIAETDESAESEG
VIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEEKSEEEGTPPNIAAMAVPTSIYQT
STGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFV
PGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQQLAEE
ATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTD
Enzyme 11 Number of Residues 360
Enzyme 11 Molecular Weight 38693.3
Enzyme 11 Theoretical pI 5.49
Enzyme 11 GO Classification
Function
Process
Component
Enzyme 11 General Function Involved in protein dimerization activity
Enzyme 11 Specific Function Transcriptional regulator that binds the cAMP response element (CRE), a sequence present in many viral and cellular promoters. Isoforms are either transcriptional activators or repressors. Isoform 1 and isoform 2 are transcriptional activators. Plays a role in spermatogenesis and is involved in spermatid maturation
Enzyme 11 Pathways Not Available
Enzyme 11 Reactions Not Available
Enzyme 11 Pfam Domain Function
Enzyme 11 Signals
  • None
Enzyme 11 Transmembrane Regions
  • None
Enzyme 11 Essentiality Not Available
Enzyme 11 GenBank ID Protein 74354671 Link Image
Enzyme 11 UniProtKB/Swiss-Prot ID Q1LZH5 Link Image
Enzyme 11 UniProtKB/Swiss-Prot Entry Name CREM_BOVIN Link Image
Enzyme 11 PDB ID Not Available
Enzyme 11 Cellular Location Not Available
Enzyme 11 Gene Sequence >918 bp
ATGGTTTCTGTAGCTGGATCCAGCACCGGAAGAGGCTCCCCAGCTGTAACTCTAGTACAG
TTACCTTCCGGCCAGACCGTCCATGTCCAGGGAGTAATTCAGACACCACAGCCATCCGTT
ATTCAGTCACCACAAATACAAACTGTTCAGGTAGCAACCATTGCAGAAACAGATGAGTCT
GCAGAATCAGAAGGTGTAATTGATTCTCATAAACGTAGAGAAATCCTTTCACGAAGACCC
TCTTACAGAAAAATACTGAATGAACTTTCCTCTGATGTGCCTGGTGTACCCAAGATTGAA
GAAGAAAAATCAGAGGAAGAGGGAACACCACCTAACATCGCTGCTATGGCAGTGCCGACT
AGCATATATCAGACTAGCACGGGGCAATACATTGCTATAGCCCAAGGTGGAACAATCCAG
ATTTCTAACCCAGGATCTGATGGTGTTCAGGGACTGCAGGCATTAACAATGACAAATTCA
GGAGCTCCTCCACCAGGTGCTACAATTGTGCAGTACGCAGCACAGTCAGCAGATGGCACA
CAGCAGTTCTTTGTCCCAGGCAGCCAGGTGGTGGTTCAAGGTGAGGAAACTGAACTTGCC
CCAAGTCACATGGCTGCTGCCACTGGCGACATGCCGACTTACCAGATCCGAGCTCCGACT
ACTGCTTTGCCACAGGGAGTGGTGATGGCTGCCTCCCCTGGAAGCCTGCACAGTCCCCAG
CAGCTAGCAGAGGAAGCGACACGCAAACGGGAGCTGAGGCTAATGAAAAACAGGGAAGCT
GCTAAAGAATGTCGACGTCGAAAGAAAGAATATGTCAAGTGTCTGGAGAGTCGAGTCGCG
GTGCTGGAAGTTCAAAACAAGAAGCTTATAGAGGAACTGGAAACCTTGAAAGACATTTGC
TCTCCCAAAACAGATTAG
Enzyme 11 GenBank Gene ID BC102677 Link Image
Enzyme 11 GeneCard ID CREM Link Image
Enzyme 11 GenAtlas ID Not Available
Enzyme 11 HGNC ID Not Available
Enzyme 11 Chromosome Location Chromosome:1
Enzyme 11 Locus 10p11.21
Enzyme 11 SNPs SNPJam Report Link Image
Enzyme 11 General References Not Available
Enzyme 11 Metabolite References Not Available
Enzyme 12 [top]
Enzyme 12 ID 1991
Enzyme 12 Name Cyclic nucleotide-gated olfactory channel
Enzyme 12 Synonyms
  1. Cyclic nucleotide-gated cation channel 2
  2. CNG channel alpha-2
  3. CNG-2
  4. CNG2
Enzyme 12 Gene Name CNGA2
Enzyme 12 Protein Sequence >Cyclic nucleotide-gated olfactory channel
MTEKANGVKSSPANNHNHHAPPAIKASGKDDHRASSRPQSAAADDTSSELQQLAEMDAPQ
QRRGGFRRIARLVGVLREWAYRNFREEEPRPDSFLERFRGPELHTVTTQQGDGKGDKDGE
GKGTKKKFELFVLDPAGDWYYRWLFLIALPVLYNWCLLVARACFSDLQKGYYIVWLVLDY
VSDVVYIADLFIRLRTGFLEQGLLVKDTKKLRDNYIHTMQFKLDVASIIPTDLIYFAVGI
HNPEVRFNRLLHFARMFEFFDRTETRTSYPNIFRISNLILYILIIIHWNACIYYAISKSI
GFGVDTWVYPNITDPEYGYLSREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIG
VLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKEMEAKVIRWFDYLWTNK
KSVDEREVLKNLPAKLRAEIAINVHLSTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDY
ICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANI
RSLGYSDLFCLSKDDLMEAVTEYPDAKRVLEERGREILMKEGLLDENEVAASMEVDVQEK
LEQLETNMDTLYTRFARLLAEYTGAQQKLKQRITVLETKMKQNNEDDSLSDGMNSPEPPA
EKP
Enzyme 12 Number of Residues 663
Enzyme 12 Molecular Weight 76013.6
Enzyme 12 Theoretical pI 6.74
Enzyme 12 GO Classification
Function
Process
Component
Enzyme 12 General Function Signal transduction mechanisms
Enzyme 12 Specific Function Odorant signal transduction is probably mediated by a G- protein coupled cascade using cAMP as second messenger. The olfactory channel can be shown to be activated by cyclic nucleotides which leads to a depolarization of olfactory sensory neurons
Enzyme 12 Pathways Not Available
Enzyme 12 Reactions Not Available
Enzyme 12 Pfam Domain Function
Enzyme 12 Signals
  • None
Enzyme 12 Transmembrane Regions
  • 141-160 174-192 217-236 275-297 350-369 454-474
Enzyme 12 Essentiality Not Available
Enzyme 12 GenBank ID Protein 287744 Link Image
Enzyme 12 UniProtKB/Swiss-Prot ID Q03041 Link Image
Enzyme 12 UniProtKB/Swiss-Prot Entry Name CNGA2_BOVIN Link Image
Enzyme 12 PDB ID Not Available
Enzyme 12 Cellular Location Not Available
Enzyme 12 Gene Sequence >1992 bp
ATGACAGAAAAAGCCAATGGCGTGAAGAGCTCCCCAGCCAATAACCACAACCACCATGCC
CCTCCTGCCATCAAGGCCAGTGGCAAAGATGACCACAGGGCCAGCAGCCGGCCACAGTCT
GCTGCTGCTGATGACACCTCCTCAGAGCTACAGCAACTGGCAGAGATGGATGCCCCCCAG
CAGAGGAGGGGTGGCTTCCGCAGGATTGCCCGCCTGGTGGGGGTCCTCAGAGAGTGGGCT
TACAGGAACTTCCGTGAGGAGGAGCCTAGACCTGACTCATTCCTTGAGCGTTTCCGGGGG
CCTGAGCTCCACACCGTGACAACACAACAAGGAGACGGCAAAGGCGACAAGGACGGCGAG
GGCAAGGGCACCAAGAAGAAGTTTGAACTCTTTGTCTTGGACCCAGCCGGGGACTGGTAC
TACCGCTGGCTTTTTCTCATTGCCTTGCCCGTCCTCTACAACTGGTGCCTATTGGTGGCC
AGAGCCTGCTTCAGTGACCTGCAGAAAGGCTACTACATAGTGTGGCTGGTGCTGGATTAC
GTCTCAGATGTGGTCTACATCGCAGACCTCTTCATCCGACTGCGCACAGGTTTCTTGGAG
CAGGGGCTACTGGTGAAAGACACCAAGAAGTTGCGGGACAACTACATCCACACCATGCAG
TTTAAGCTGGATGTGGCCTCCATCATCCCTACAGACCTGATCTATTTTGCTGTGGGGATC
CATAACCCTGAGGTGCGCTTCAACCGCCTGCTACACTTTGCCCGCATGTTTGAGTTCTTT
GACCGCACTGAGACACGCACCAGCTACCCCAACATCTTCCGAATAAGCAACCTGATCCTC
TACATCTTGATCATCATTCACTGGAATGCCTGCATCTACTATGCCATCTCCAAGTCCATC
GGCTTTGGGGTAGACACCTGGGTTTACCCCAACATCACTGACCCTGAGTATGGCTACCTG
TCTAGGGAGTACATCTATTGCCTTTACTGGTCTACACTGACCCTCACCACCATTGGGGAG
ACACCACCCCCTGTAAAGGATGAGGAGTACCTGTTTGTCATCTTTGACTTCCTGATTGGT
GTCCTCATCTTTGCCACCATCGTGGGAAATGTGGGCTCCATGATCTCCAACATGAATGCC
ACCCGGGCTGAGTTCCAGGCCAAGATTGATGCTGTCAAACATTATATGCAGTTCCGAAAG
GTCAGCAAGGAGATGGAAGCCAAGGTCATTAGGTGGTTTGACTACTTGTGGACCAATAAG
AAGAGTGTAGATGAGCGAGAAGTCCTCAAAAACCTGCCAGCAAAGCTCAGGGCTGAGATA
GCCATCAACGTCCACCTGTCCACACTCAAGAAAGTGCGCATCTTTCAGGACTGTGAGGCT
GGCCTGCTGGTGGAACTGGTATTAAAGCTCCGGCCTCAGGTCTTTAGCCCTGGGGACTAC
ATTTGCCGCAAGGGGGATATTGGGAAGGAGATGTACATAATCAAGGAGGGAAAATTGGCA
GTGGTGGCTGATGACGGTGTCACTCAGTATGCCCTGCTCTCGGCTGGGAGTTGCTTTGGA
GAGATCAGTATCCTTAATATTAAGGGCAGCAAAATGGGCAATCGGCGCACAGCCAACATC
CGCAGTCTTGGCTACTCTGATCTGTTCTGCTTGTCCAAGGATGATCTTATGGAAGCTGTG
ACTGAGTACCCTGATGCCAAGAGGGTCTTGGAGGAGAGAGGCCGGGAGATTCTGATGAAG
GAGGGCTTGTTGGATGAGAATGAGGTGGCAGCCAGCATGGAGGTAGATGTGCAGGAAAAG
CTAGAACAGCTGGAGACCAACATGGACACCTTGTACACTCGTTTTGCCCGCCTGCTGGCC
GAGTACACGGGAGCCCAGCAGAAGCTCAAGCAGCGCATCACAGTTTTGGAAACGAAGATG
AAGCAGAATAATGAGGATGACTCCCTGTCAGATGGGATGAACAGCCCAGAGCCACCTGCC
GAGAAGCCATAA
Enzyme 12 GenBank Gene ID X55010 Link Image
Enzyme 12 GeneCard ID CNGA2 Link Image
Enzyme 12 GenAtlas ID Not Available
Enzyme 12 HGNC ID Not Available
Enzyme 12 Chromosome Location Not Available
Enzyme 12 Locus Xq27
Enzyme 12 SNPs SNPJam Report Link Image
Enzyme 12 General References
  1. [PubMed Link Image]
Enzyme 12 Metabolite References Not Available
Enzyme 13 [top]
Enzyme 13 ID 1992
Enzyme 13 Name Cyclic AMP-dependent transcription factor ATF-3
Enzyme 13 Synonyms
  1. cAMP-dependent transcription factor ATF-3
  2. Activating transcription factor 3
Enzyme 13 Gene Name ATF3
Enzyme 13 Protein Sequence >Cyclic AMP-dependent transcription factor ATF-3
MMLQHPGQVSASEVSASAFVPCLSPPGSLVFEDFANLTPFVKEELRLAIQSKHLCHRMSS
ALDSVTVSGRPLEMSVTKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK
LESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ
S
Enzyme 13 Number of Residues 181
Enzyme 13 Molecular Weight 20566.5
Enzyme 13 Theoretical pI 8.76
Enzyme 13 GO Classification
Function
Process
Component
Enzyme 13 General Function Involved in protein dimerization activity
Enzyme 13 Specific Function This protein binds the cAMP response element (CRE) (consensus:5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter
Enzyme 13 Pathways Not Available
Enzyme 13 Reactions Not Available
Enzyme 13 Pfam Domain Function
Enzyme 13 Signals
  • None
Enzyme 13 Transmembrane Regions
  • None
Enzyme 13 Essentiality Not Available
Enzyme 13 GenBank ID Protein 86438166 Link Image
Enzyme 13 UniProtKB/Swiss-Prot ID Q2KII1 Link Image
Enzyme 13 UniProtKB/Swiss-Prot Entry Name ATF3_BOVIN Link Image
Enzyme 13 PDB ID Not Available
Enzyme 13 Cellular Location Not Available
Enzyme 13 Gene Sequence >546 bp
ATGATGCTTCAACACCCAGGCCAGGTCTCTGCCTCGGAAGTCAGTGCCTCTGCCTTCGTC
CCCTGCCTGTCCCCTCCTGGGTCACTGGTGTTTGAGGATTTTGCTAACCTGACACCCTTT
GTCAAGGAAGAGCTGAGGTTGGCCATCCAGAGCAAGCACCTCTGCCACCGGATGTCCTCG
GCGCTGGACTCCGTCACCGTCAGCGGCAGGCCCCTCGAGATGTCAGTCACCAAAGCCGAG
GTAGCCCCTGAAGAAGATGAAAGGAAAAAGAGGCGACGGGAAAGAAATAAGATTGCAGCC
GCCAAGTGCCGCAACAAGAAGAAGGAGAAGACAGAGTGCCTGCAGAAAGAGTCGGAGAAG
CTGGAGAGTGTGAATGCTGAGCTGAAGGCGCAGATTGAGGAGCTCAAGAACGAGAAGCAG
CATTTGATATACATGCTCAACCTGCACCGGCCCACGTGTATTGTCCGGGCTCAGAACGGG
CGGACTCCGGAAGATGAGAGGAACCTTTTTATCCAACAGATAAAGGAGGGAACATTGCAG
AGCTAA
Enzyme 13 GenBank Gene ID BC112629 Link Image
Enzyme 13 GeneCard ID ATF3 Link Image
Enzyme 13 GenAtlas ID Not Available
Enzyme 13 HGNC ID Not Available
Enzyme 13 Chromosome Location Chromosome:1
Enzyme 13 Locus 1q32.3
Enzyme 13 SNPs SNPJam Report Link Image
Enzyme 13 General References Not Available
Enzyme 13 Metabolite References Not Available
Enzyme 14 [top]
Enzyme 14 ID 1993
Enzyme 14 Name Cyclic AMP-dependent transcription factor ATF-4
Enzyme 14 Synonyms
  1. cAMP-dependent transcription factor ATF-4
  2. Activating transcription factor 4
Enzyme 14 Gene Name ATF4
Enzyme 14 Protein Sequence >Cyclic AMP-dependent transcription factor ATF-4
MAEMSFLSSEVLGGDFVSPFDQLGLGAEESLGLLDDNLEVAKHFKHHGFSCDKAKAGSSE
WLAVDWLVSDNSKEDAFSGTDWMVEKMDLKEFDFDILFSKDDLETMPDELLATLDDTCDL
FQPLVQETNKEPPQIVNPIGHLPEGLPTIDQGAPFTFFQPLPPSPGTLSSTPDHSFSLEL
CSEVVIPEGDSKPDSTTTGFPQCIKEEDAPSDNDSGICMSPDSSLGSPQDSPSTSRGSPN
KSLLSPGALSGSSRPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQ
EALTGECKELEKKNEALKEKADSLAKEIQYLKDQIEEVRKAREKKRVL
Enzyme 14 Number of Residues 348
Enzyme 14 Molecular Weight 38244.5
Enzyme 14 Theoretical pI 4.45
Enzyme 14 GO Classification
Function
Process
Component
Enzyme 14 General Function Involved in protein dimerization activity
Enzyme 14 Specific Function Transcriptional activator. Binds the cAMP response element (CRE) (consensus:5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters
Enzyme 14 Pathways Not Available
Enzyme 14 Reactions Not Available
Enzyme 14 Pfam Domain Function
Enzyme 14 Signals
  • None
Enzyme 14 Transmembrane Regions
  • None
Enzyme 14 Essentiality Not Available
Enzyme 14 GenBank ID Protein 73586952 Link Image
Enzyme 14 UniProtKB/Swiss-Prot ID Q3ZCH6 Link Image
Enzyme 14 UniProtKB/Swiss-Prot Entry Name ATF4_BOVIN Link Image
Enzyme 14 PDB ID 1CI6 Link Image
Enzyme 14 PDB File Show
Enzyme 14 3D Structure
Enzyme 14 Cellular Location Not Available
Enzyme 14 Gene Sequence >1047 bp
ATGGCCGAGATGAGCTTTCTGAGCAGCGAGGTGTTAGGGGGGGACTTCGTGTCCCCCTTC
GACCAGTTGGGTTTGGGGGCTGAAGAGAGCCTAGGTCTCCTAGATGACAACCTGGAGGTG
GCCAAGCACTTCAAACATCATGGGTTCTCCTGCGACAAGGCTAAGGCAGGCTCCTCCGAA
TGGCTGGCTGTGGATTGGTTGGTCTCAGACAACAGCAAGGAGGATGCTTTCTCCGGGACA
GATTGGATGGTGGAGAAAATGGATTTGAAGGAGTTTGATTTTGATATCCTGTTCAGTAAA
GATGACCTGGAAACCATGCCAGATGAGCTCTTGGCCACGTTGGATGACACGTGTGATCTC
TTTCAGCCCCTAGTCCAGGAGACTAACAAGGAGCCCCCCCAGATAGTAAACCCAATTGGC
CATCTTCCAGAAGGTTTACCAACAATTGACCAGGGTGCCCCCTTCACTTTCTTTCAACCT
CTTCCCCCTTCCCCAGGGACCCTGTCTTCCACTCCAGATCATTCCTTTAGTTTAGAGCTA
TGCAGTGAAGTGGTTATCCCTGAAGGAGATAGCAAGCCAGACTCCACCACTACTGGGTTT
CCTCAATGCATAAAAGAGGAGGATGCCCCCTCAGATAATGATAGTGGCATCTGTATGAGC
CCTGACTCCTCTCTGGGCTCTCCCCAGGATAGCCCTTCCACCTCCAGGGGCTCTCCAAAT
AAGAGCCTGCTATCTCCAGGTGCCCTCAGTGGCTCTTCCCGCCCCAAACCCTACGACCCT
CCTGGAGAGAAGATGGTAGCAGCAAAAGTCAAGGGTGAGAAGCTAGACAAGAAGCTGAAG
AAAATGGAGCAGAACAAGACAGCAGCTACTAGGTACCGCCAGAAGAAGAGGGCGGAACAG
GAGGCCCTCACTGGTGAATGTAAAGAGCTAGAAAAAAAGAATGAGGCTCTGAAAGAGAAG
GCAGATTCCTTGGCCAAGGAGATCCAGTATCTTAAAGATCAGATAGAAGAGGTTCGCAAA
GCAAGGGAGAAGAAAAGGGTCCTCTAG
Enzyme 14 GenBank Gene ID BC102236 Link Image
Enzyme 14 GeneCard ID ATF4 Link Image
Enzyme 14 GenAtlas ID Not Available
Enzyme 14 HGNC ID Not Available
Enzyme 14 Chromosome Location Chromosome:2
Enzyme 14 Locus 22q13.1
Enzyme 14 SNPs SNPJam Report Link Image
Enzyme 14 General References
  1. [PubMed Link Image]
Enzyme 14 Metabolite References Not Available
Enzyme 15 [top]
Enzyme 15 ID 1994
Enzyme 15 Name Cyclic AMP-responsive element-binding protein 3
Enzyme 15 Synonyms
  1. cAMP-responsive element-binding protein 3
  2. CREB-3
  3. Luman
  4. Processed cyclic AMP-responsive element-binding protein 3
Enzyme 15 Gene Name CREB3
Enzyme 15 Protein Sequence >Cyclic AMP-responsive element-binding protein 3
MSHMELALDPGDHDLLGFLLEESGGLGAAPDEALTSPPDWELPLSESLSDWDVEDFLSCL
PSPPAVLNVFSNSDPCLVQHDHTYSLSQEHVSIDLDNESYEKERAQMTPLRVEEPADQEI
ARLILTEEEKRLLEKEGLTLPGMLPLTKMEEQVLKRVRRKIRNKKSAQESRRKKKVYVGG
LESRVLKYTAQNLELQNKVQLLEEQNLSLLDQLRRLQAMVIQTANKASSSSTCVLVLLFS
FCLLLVPAMYSSDTRGSLPAEHRVLSRQLRALPSEDPPQLEPPALQSEVPKDSLNPELQA
ASNSCCLFHLMPQAPRAEPPLQLPLPDGFSGCSCPDSISPLHANLTREEGWLPTPSPTSV
ILQGRYSG
Enzyme 15 Number of Residues 368
Enzyme 15 Molecular Weight 40911.1
Enzyme 15 Theoretical pI 4.67
Enzyme 15 GO Classification
Function
Process
Component
Enzyme 15 General Function Involved in protein dimerization activity
Enzyme 15 Specific Function Transcription factors activated upon intramembrane proteolysis (RIP), binds the cAMP response element (CRE) (consensus:5'-GTGACGT[AG][AG]-3'). Binds to and requires HCFC1 as a coactivator. Activity and expression is suppressed when the HCFC1-CREB3 complex binds with CREBZF. Participates in LKN- 1/CCL15-induced chemotaxis signaling
Enzyme 15 Pathways Not Available
Enzyme 15 Reactions Not Available
Enzyme 15 Pfam Domain Function
Enzyme 15 Signals
  • None
Enzyme 15 Transmembrane Regions
  • 230-250
Enzyme 15 Essentiality Not Available
Enzyme 15 GenBank ID Protein 59857843 Link Image
Enzyme 15 UniProtKB/Swiss-Prot ID Q8SQ19 Link Image
Enzyme 15 UniProtKB/Swiss-Prot Entry Name CREB3_BOVIN Link Image
Enzyme 15 PDB ID Not Available
Enzyme 15 Cellular Location Not Available
Enzyme 15 Gene Sequence >1131 bp
ATGTCTCATATGGAGCTGGCGTTGGACCCGGGTGACCACGACCTGCTAGGCTTTCTGCTA
GAAGAAAGCGGTGGTTTGGGTGCGGCGCCCGACGAGGCCTTGACGTCTCCGCCGGATTGG
GAGCTGCCACTTTCTGAGCCTGTTAATTTGAACCCTGTGCAGTCTCTGAGCGACTGGGAC
GTGGAGGATTTCCTGAGCTGCCTGCCGAGTCCCCCAGCAGTGTTGAACGTTTTCAGCAAC
TCTGACCCCTGTCTTGTCCAGCATGACCACACCTATTCTCTGTCACAAGAGCATGTCTCC
ATCGATCTCGATAATGAGAGCTATGAAAAAGAGAGGGCTCAGATGACTCCACTGCGTGTG
GAGGAGCCGGCAGATCAGGAGATTGCTAGGCTGATACTGACTGAGGAGGAGAAAAGGCTG
TTGGAGAAGGAGGGGCTTACTTTGCCTGGGATGCTTCCGCTCACTAAGATGGAGGAACAA
GTTCTGAAACGGGTGCGGAGGAAGATTCGAAACAAAAAGTCTGCTCAAGAGAGCCGCAGG
AAGAAGAAGGTGTATGTGGGGGGTTTAGAAAGCAGGGTCCTGAAATACACAGCCCAGAAT
CTGGAGCTACAGAACAAAGTACAGCTCCTGGAGGAACAGAATCTGTCCCTTTTGGATCAG
CTGAGGAGACTCCAGGCCATGGTGATTCAGACAGCAAACAAAGCCAGCAGCAGCAGCACC
TGTGTCTTGGTTCTACTGTTCTCCTTCTGTCTCCTCCTCGTACCTGCTATGTACTCCTCG
GACACAAGGGGGAGCCTGCCGGCTGAGCACAGAGTGTTGTCCCGTCAGCTTCGTGCCCTC
CCCAGCGAGGACCCCCCGCAGCTGGAGCCACCTGCCCTGCAGTCAGAGGTACCAAAGGAC
AGCTTGAACCCTGAGCTCCAGGCTGCTAGCAACTCTTGCTGCCTCTTCCATCTCATGCCC
CAGGCTCCTAGAGCAGAGCCTCCCCTGCAATTGCCACTGCCTGATGGTTTCTCAGGGTGC
TCCTGCCCAGATTCCATATCTCCCCTGCATGCAAATCTCACAAGAGAGGAAGGATGGCTC
CCTACTCCCAGCCCCACATCTGTTATCTTGCAGGGCAGATACTCAGGCTAG
Enzyme 15 GenBank Gene ID BT020739 Link Image
Enzyme 15 GeneCard ID CREB3 Link Image
Enzyme 15 GenAtlas ID Not Available
Enzyme 15 HGNC ID Not Available
Enzyme 15 Chromosome Location Chromosome:9
Enzyme 15 Locus 9pter-p22.1
Enzyme 15 SNPs SNPJam Report Link Image
Enzyme 15 General References
  1. [PubMed Link Image]
Enzyme 15 Metabolite References Not Available
Enzyme 16 [top]
Enzyme 16 ID 1995
Enzyme 16 Name Cyclic nucleotide-gated cation channel beta-1
Enzyme 16 Synonyms
  1. CNG channel beta-1
  2. Cyclic nucleotide-gated channel beta-1
  3. Cyclic nucleotide-gated cation channel 4
  4. CNG channel 4
  5. CNG-4
  6. CNG4
  7. Cyclic nucleotide-gated cation channel modulatory subunit
  8. 240 kDa protein of rod photoreceptor CNG-channel
  9. Glutamic acid-rich protein
  10. GARP
  11. Cyclic nucleotide-gated cation channel gamma
Enzyme 16 Gene Name CNGB1
Enzyme 16 Protein Sequence >Cyclic nucleotide-gated cation channel beta-1
MLGWVQRVLPQPPGTPQKTKQEEEGTEPEPELEPKPETAPEETELEEVSLPPEEPCVGKE
VAAVTLGPQGTQETALTPPTSLQAQVSVAPEAHSSPRGWVLTWLRKGVEKVVPQPAHSSR
PSQNIAAGLESPDQQAGAQILGQCGTGGSDEPSEPSRAEDPGPGPWLLRWFEQNLEKMLP
QPPKISEGWRDEPTDAALGPEPPGPALEIKPMLQAQESPSLPAPGPPEPEEEPIPEPQPT
IQASSLPPPQDSARLMAWILHRLEMALPQPVIRGKGGEQESDAPVTCDVQTISILPGEQE
ESHLILEEVDPHWEEDEHQEGSTSTSPRTSEAAPADEEKGKVVEQTPRELPRIQEEKEDE
EEEKEDGEEEEEEGREKEEEEGEEKEEEEGREKEEEEGEKKEEEGREKEEEEGGEKEDEE
GREKEEEEGRGKEEEEGGEKEEEEGRGKEEVEGREEEEDEEEEQDHSVLLDSYLVPQSEE
DRSEESETQDQSEVGGAQAQGEVGGAQALSEESETQDQSEVGGAQDQSEVGGAQAQGEVG
GAQEQDGVGGAQDQSTSHQELQEEALADSSGVPATEEHPELQVEDADADSRPLIAEENPP
SPVQLPLSPAKSDTLAVPGSATGSLRKRLPSQDDEAEELKMLSPAASPVVAWSDPTSPQG
TDDQDRATSTASQNSAIINDRLQELVKLFKERTEKVKEKLIDPDVTSDEESPKPSPAKKA
PEPAPEVKPAEAGQVEEEHYCEMLCCKFKRRPWKKYQFPQSIDPLTNLMYILWLFFVVLA
WNWNCWLIPVRWAFPYQTPDNIHLWLLMDYLCDLIYLLDITVFQMRLQFVRGGDIITDKK
EMRNNYVKSQRFKMDMLCLLPLDLLYLKFGVNPLLRLPRCLKYMAFFEFNNRLESILSKA
YVYRVIRTTAYLLYSLHLNSCLYYWASAYEGLGSTHWVYDGVGNSYIRCYYWAVKTLITI
GGLPDPRTLFEIVFQGLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYMNF
YKIPRSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYSIVSKVALFQGC
DRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKSVLVTLKAGS
VFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRMLRN
NNKPKEKSVLILPPRAGTPKLFNAALAAAGKMGAKGGRGGRLALLRARLKELAALEAAAR
QQQLLEQAKSSEDAAVGEEGSASPEQPPRPEPPAPEAPAPEPTAPEPLAPEAPAPEAPAP
SSPPPASQERPEGDKDAARPEEHPVRIHVTLGPDPSEQILLVEVPEKQEEKEKKEEETEE
KEEGEEARKEKEEE
Enzyme 16 Number of Residues 1394
Enzyme 16 Molecular Weight 155063.6
Enzyme 16 Theoretical pI 4.24
Enzyme 16 GO Classification
Function
Process
Component
Enzyme 16 General Function Involved in cAMP binding
Enzyme 16 Specific Function Subunit of cyclic nucleotide-gated (CNG) channels, nonselective cation channels, which play important roles in both visual and olfactory signal transduction. When associated with CNGA1, it is involved in the regulation of ion flow into the rod photoreceptor outer segment (ROS), in response to light-induced alteration of the levels of intracellular cGMP
Enzyme 16 Pathways Not Available
Enzyme 16 Reactions Not Available
Enzyme 16 Pfam Domain Function
Enzyme 16 Signals
  • None
Enzyme 16 Transmembrane Regions
  • 771-789 804-822 848-867 905-927 972-991 1076-1096
Enzyme 16 Essentiality Not Available
Enzyme 16 GenBank ID Protein 1050441 Link Image
Enzyme 16 UniProtKB/Swiss-Prot ID Q28181 Link Image
Enzyme 16 UniProtKB/Swiss-Prot Entry Name CNGB1_BOVIN Link Image
Enzyme 16 PDB ID Not Available
Enzyme 16 Cellular Location Not Available
Enzyme 16 Gene Sequence >4185 bp
ATGCTGGGCTGGGTCCAGAGGGTGCTGCCTCAGCCCCCAGGGACCCCTCAGAAGACCAAG
CAAGAGGAGGAGGGGACAGAACCAGAGCCAGAGTTGGAGCCGAAGCCTGAAACAGCTCCC
GAGGAGACTGAGCTAGAGGAAGTGTCCCTGCCACCAGAGGAGCCCTGCGTGGGGAAGGAA
GTGGCTGCGGTTACTCTGGGTCCTCAGGGAACCCAGGAGACTGCTCTCACTCCGCCCACA
TCCCTCCAGGCTCAGGTCTCTGTGGCTCCCGAAGCTCACAGCAGTCCCAGAGGCTGGGTG
CTGACCTGGCTCAGGAAGGGTGTGGAGAAGGTTGTCCCGCAGCCCGCCCACAGCAGCAGG
CCCTCCCAGAACATTGCTGCAGGCCTGGAGAGTCCAGATCAGCAGGCAGGAGCACAGATC
CTTGGGCAGTGCGGCACTGGGGGCTCAGATGAACCCAGTGAACCCTCCAGGGCCGAAGAC
CCCGGGCCTGGGCCCTGGCTCCTCCGGTGGTTCGAACAGAATCTGGAGAAAATGCTGCCT
CAGCCCCCGAAAATCTCTGAGGGCTGGAGAGATGAGCCTACAGATGCTGCCTTGGGTCCA
GAGCCCCCAGGACCCGCCTTGGAGATCAAGCCCATGCTGCAGGCCCAGGAGAGCCCCTCC
CTGCCAGCTCCTGGCCCCCCGGAGCCTGAGGAGGAACCGATCCCAGAGCCCCAGCCCACT
ATTCAAGCCTCCTCCCTGCCGCCCCCGCAGGACTCTGCCAGGTTGATGGCATGGATCCTG
CACAGGCTGGAGATGGCCCTGCCACAGCCAGTGATCCGTGGGAAGGGTGGGGAGCAGGAG
TCTGATGCCCCAGTGACATGTGACGTGCAGACCATCAGCATCCTCCCTGGAGAGCAAGAG
GAGTCGCATCTCATCCTAGAAGAGGTTGACCCTCACTGGGAGGAGGATGAACACCAGGAG
GGCAGCACCAGCACCAGCCCGCGGACCTCAGAGGCAGCTCCAGCTGATGAAGAGAAGGGC
AAGGTGGTGGAGCAGACGCCCAGGGAGCTGCCTCGGATTCAAGAGGAGAAAGAAGATGAG
GAGGAGGAGAAGGAAGACGGAGAGGAGGAAGAAGAGGAAGGCAGAGAGAAAGAGGAGGAA
GAAGGTGAAGAAAAAGAGGAGGAGGAAGGCAGAGAGAAAGAGGAGGAAGAAGGCGAAAAA
AAAGAGGAAGAAGGCAGAGAGAAAGAGGAGGAAGAAGGTGGAGAGAAAGAAGATGAAGAA
GGCAGAGAGAAAGAGGAGGAAGAAGGCAGAGGGAAAGAGGAAGAAGAAGGTGGAGAGAAA
GAGGAAGAAGAAGGCAGAGGGAAAGAGGAGGTGGAAGGCAGAGAGGAGGAGGAAGACGAA
GAGGAGGAGCAGGATCACAGTGTCCTGCTGGATAGTTATCTGGTGCCACAGAGCGAGGAG
GACCGGAGTGAAGAAAGTGAAACCCAGGACCAGAGTGAAGTGGGCGGAGCCCAGGCCCAG
GGCGAAGTGGGCGGCGCCCAGGCCCTGAGTGAAGAAAGTGAAACCCAGGACCAGAGTGAA
GTAGGCGGAGCCCAGGACCAGAGTGAAGTGGGCGGAGCCCAGGCCCAGGGCGAAGTGGGT
GGAGCCCAGGAGCAGGACGGAGTAGGCGGAGCCCAGGACCAGAGCACCTCACACCAGGAG
CTGCAAGAAGAGGCCTTGGCCGACAGCTCAGGAGTACCTGCCACAGAAGAGCACCCCGAA
CTGCAGGTGGAAGACGCTGATGCTGACAGTCGCCCCCTCATCGCGGAGGAGAACCCACCC
TCTCCCGTGCAGCTGCCCCTGTCTCCTGCCAAATCCGACACCCTTGCAGTCCCAGGATCA
GCCACAGGGAGCCTCAGGAAGAGGCTGCCTTCCCAAGATGATGAGGCTGAAGAGCTCAAG
ATGCTGTCACCGGCTGCATCCCCCGTGGTTGCCTGGTCGGACCCCACCAGCCCACAGGGC
ACTGATGACCAGGACCGTGCAACCTCGACAGCCAGCCAGAACAGTGCCATCATCAATGAC
CGGCTCCAGGAGCTGGTGAAGCTCTTCAAGGAGCGGACGGAGAAGGTGAAGGAGAAGCTC
ATCGACCCTGACGTCACCTCCGATGAGGAGAGCCCCAAGCCCTCCCCAGCCAAAAAAGCC
CCAGAGCCGGCCCCAGAAGTGAAGCCAGCTGAAGCGGGGCAGGTGGAAGAGGAACACTAC
TGTGAGATGCTCTGCTGCAAGTTCAAACGCCGCCCCTGGAAGAAGTACCAGTTTCCCCAG
AGCATCGACCCGCTGACCAACCTGATGTACATCTTGTGGCTGTTCTTCGTGGTGCTGGCC
TGGAACTGGAACTGCTGGCTGATTCCCGTGCGCTGGGCCTTCCCCTATCAGACGCCAGAC
AACATCCACCTCTGGCTGCTGATGGATTACCTGTGTGACCTCATCTACCTCCTGGACATC
ACCGTGTTCCAGATGCGCCTGCAGTTTGTCAGAGGCGGGGACATCATTACGGACAAAAAG
GAGATGCGCAACAATTACGTGAAATCTCAGCGCTTTAAGATGGACATGCTCTGCCTCTTG
CCCTTGGACTTACTCTACTTGAAATTCGGTGTGAATCCCCTCCTGCGCTTGCCCCGCTGT
TTGAAGTATATGGCCTTCTTTGAGTTTAACAACCGCCTGGAATCCATCCTCAGCAAAGCC
TACGTTTACAGGGTTATCAGGACCACAGCCTACCTGCTCTACAGCTTACATCTGAACTCA
TGTCTCTATTACTGGGCATCGGCCTATGAGGGCCTCGGCTCCACTCACTGGGTTTATGAT
GGCGTGGGAAACAGTTACATTCGCTGTTACTACTGGGCTGTGAAGACCCTCATCACCATC
GGCGGCCTGCCCGACCCCAGGACGCTCTTTGAAATTGTCTTCCAGGGTCTAAACTATTTC
ACGGGCGTCTTCGCTTTCTCCGTGATGATCGGACAGATGAGAGACGTAGTGGGGGCCGCC
ACCGCGGGACAGACCTACTACCGCAGCTGCATGGACAGCACCGTGAAGTATATGAACTTC
TACAAGATCCCCAGGTCCGTGCAGAACCGGGTCAAGACCTGGTACGAATACACCTGGCAC
TCCCAAGGCATGCTGGATGAGTCAGAGCTGATGGTGCAGCTTCCGGACAAGATGCGGCTG
GACCTCGCCATTGACGTGAACTATTCCATCGTCAGCAAAGTGGCACTCTTCCAGGGCTGT
GACCGGCAGATGATCTTTGACATGCTGAAGAGGCTGCGCTCTGTAGTCTACCTGCCCAAT
GATTACGTGTGCAAGAAGGGGGAGATAGGCCGGGAAATGTACATCATCCAGGCGGGGCAG
GTGCAGGTCTTGGGTGGCCCGGATGGGAAATCCGTGCTGGTGACGCTGAAGGCTGGATCT
GTGTTCGGAGAAATAAGCTTGCTGGCTGTAGGGGGCGGGAACCGGCGCACAGCTAACGTG
GTGGCCCATGGGTTTACCAACCTCTTCATTCTGGATAAGAAGGACCTGAATGAAATTCTG
GTGCATTATCCCGAGTCTCAGAAGTTGCTCCGCAAGAAGGCCAGGCGAATGCTGAGAAAT
AACAACAAGCCCAAGGAGAAGAGCGTGCTTATTCTCCCTCCGCGGGCAGGCACCCCCAAG
CTCTTCAATGCCGCCCTGGCCGCAGCAGGAAAGATGGGTGCCAAGGGAGGCAGAGGTGGC
AGGCTTGCCCTCCTCAGGGCTCGACTCAAGGAGCTGGCTGCGCTGGAGGCGGCCGCCAGA
CAGCAGCAGTTGCTGGAACAGGCCAAGAGCTCGGAAGACGCCGCCGTGGGAGAGGAGGGA
TCGGCCTCCCCAGAACAGCCTCCGCGTCCAGAGCCGCCGGCCCCAGAGGCCCCCGCACCA
GAACCGACGGCCCCAGAGCCCCTGGCCCCAGAGGCCCCCGCCCCAGAGGCCCCGGCCCCA
AGCTCTCCACCACCTGCCTCCCAGGAGAGGCCGGAGGGAGACAAGGACGCGGCGCGGCCA
GAAGAGCACCCGGTGCGGATCCACGTGACCCTGGGCCCGGATCCCAGCGAACAGATCCTG
TTGGTGGAGGTCCCTGAGAAGCAGGAGGAGAAGGAGAAAAAGGAGGAGGAGACAGAGGAA
AAGGAGGAAGGGGAGGAGGCGAGGAAGGAGAAAGAGGAGGAGTAA
Enzyme 16 GenBank Gene ID X89626 Link Image
Enzyme 16 GeneCard ID CNGB1 Link Image
Enzyme 16 GenAtlas ID Not Available
Enzyme 16 HGNC ID Not Available
Enzyme 16 Chromosome Location Chromosome:1
Enzyme 16 Locus 16q13
Enzyme 16 SNPs SNPJam Report Link Image
Enzyme 16 General References
  1. [PubMed Link Image]
Enzyme 16 Metabolite References Not Available
Enzyme 17 [top]
Enzyme 17 ID 1996
Enzyme 17 Name Cisplatin resistance-associated overexpressed protein
Enzyme 17 Synonyms Not Available
Enzyme 17 Gene Name CROP
Enzyme 17 Protein Sequence >Cisplatin resistance-associated overexpressed protein
MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEK
IHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAG
PTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIE
SFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEE
PDRDERLKKEKQEREEREKEREREREERERKRRREEEEREKERARDRERRKRSRSRSRHS
SRTSDRRCSRSRDHKRSRSRERRRSRSRDRRRSRSHDRSERKHRSRSRDRRRSKSRDRKS
YKHRSKSRDREQDRKSKEKEKRGSDDKKSSVKSSSREKQSEDTNTESKESDTKNEVNGTS
EDIKSEGDTQSN
Enzyme 17 Number of Residues 432
Enzyme 17 Molecular Weight 51495.7
Enzyme 17 Theoretical pI 10.46
Enzyme 17 GO Classification
Function
Process
Component
Enzyme 17 General Function Involved in DNA binding
Enzyme 17 Specific Function Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing
Enzyme 17 Pathways Not Available
Enzyme 17 Reactions Not Available
Enzyme 17 Pfam Domain Function
Enzyme 17 Signals
  • None
Enzyme 17 Transmembrane Regions
  • None
Enzyme 17 Essentiality Not Available
Enzyme 17 GenBank ID Protein 74356344 Link Image
Enzyme 17 UniProtKB/Swiss-Prot ID Q3SX41 Link Image
Enzyme 17 UniProtKB/Swiss-Prot Entry Name CROP_BOVIN Link Image
Enzyme 17 PDB ID Not Available
Enzyme 17 Cellular Location Not Available
Enzyme 17 Gene Sequence >1299 bp
ATGATTTCGGCTGCGCAATTGTTGGATGAGTTAATGGGCAGGGACCGAAACCTCGCCCCG
GATGAGAAGCGCAGCAACGTGCGGTGGGACCACGAGAGCGTTTGTAAATACTACCTCTGT
GGTTTTTGTCCTGCGGAATTGTTCACAAACACTCGTTCTGATCTTGGACCATGTGAAAAA
ATTCATGATGAAAATCTACGAAAACAGTATGAGAAGAGTTCTCGTTTTATGAAAGTTGGC
TATGAGAGAGATTTTTTGCGATACTTACAGAGTTTACTGGCAGAAGTAGAACGTAGAATT
AGACGAGGCCATGCTCGTTTGGCATTATCTCAAAACCAGCAGTCGTCTGGGGCAGCTGGT
CCAACAGGCAAAAATGAAGAAAAAATTCAGGTTCTAACAGATAAAATTGATGTACTCCTG
CAGCAGATTGAAGAATTAGGATCTGAAGGAAAAGTAGAAGAAGCCCAGGGAATGATGAAA
TTAGTTGAACAGTTAAAAGAAGAGAGAGAGTTGCTTAGGTCCACAACTTCGACAATTGAA
AGTTTTGCTGCCCAAGAAAAACAAATGGAAGTTTGTGAAGTGTGTGGAGCCTTTTTGATA
GTGGGAGATGCCCAGTCCCGGGTAGATGATCATTTGATGGGAAAACAGCACATGGGCTAT
GCCAAAATTAAAGCTACTGTAGAAGAATTAAAAGAAAAATTAAGAAAAAGAACTGAAGAA
CCTGATCGTGATGAGCGTTTAAAAAAGGAGAAGCAAGAACGAGAAGAAAGAGAAAAAGAA
AGGGAGAGGGAAAGAGAAGAGAGAGAGAGGAAAAGACGAAGAGAAGAGGAAGAAAGAGAA
AAAGAAAGAGCTCGAGACAGAGAAAGAAGAAAGAGGAGTCGATCACGAAGTAGGCATTCA
AGCCGAACTTCTGACCGAAGATGCAGCAGGTCTCGGGATCACAAAAGATCACGAAGTAGA
GAGAGAAGGAGGAGCAGAAGTAGAGATCGACGAAGAAGCAGAAGCCACGATAGATCAGAA
AGAAAGCATAGATCTCGTAGTCGGGATCGAAGAAGATCAAAAAGCCGAGATCGAAAGTCA
TATAAGCACCGGAGCAAAAGTCGAGACAGAGAACAAGATAGAAAATCGAAGGAGAAAGAA
AAGAGGGGATCTGATGATAAAAAAAGTAGTGTGAAGTCCAGTAGTCGAGAAAAGCAGAGT
GAAGACACAAACACTGAATCAAAGGAAAGCGATACTAAGAATGAGGTCAATGGGACCAGT
GAAGACATTAAATCTGAAGGTGACACTCAGTCCAATTAA
Enzyme 17 GenBank Gene ID BC104519 Link Image
Enzyme 17 GeneCard ID CROP Link Image
Enzyme 17 GenAtlas ID Not Available
Enzyme 17 HGNC ID Not Available
Enzyme 17 Chromosome Location Chromosome:1
Enzyme 17 Locus 17q21.33
Enzyme 17 SNPs SNPJam Report Link Image
Enzyme 17 General References Not Available
Enzyme 17 Metabolite References Not Available
Enzyme 18 [top]
Enzyme 18 ID 1997
Enzyme 18 Name Agouti-signaling protein
Enzyme 18 Synonyms
  1. ASP
  2. Agouti switch protein
Enzyme 18 Gene Name ASIP
Enzyme 18 Protein Sequence >Agouti-signaling protein
MDVSRLLLATLLVCLCFLTAYSHLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSK
KISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFF
RSACSCRVLNPTC
Enzyme 18 Number of Residues 133
Enzyme 18 Molecular Weight 14840.3
Enzyme 18 Theoretical pI 10.03
Enzyme 18 GO Classification
Function
Process
Component
Enzyme 18 General Function Involved in hormone-mediated signaling
Enzyme 18 Specific Function Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment)
Enzyme 18 Pathways Not Available
Enzyme 18 Reactions Not Available
Enzyme 18 Pfam Domain Function
Enzyme 18 Signals
  • 1-22
Enzyme 18 Transmembrane Regions
  • None
Enzyme 18 Essentiality Not Available
Enzyme 18 GenBank ID Protein 1841900 Link Image
Enzyme 18 UniProtKB/Swiss-Prot ID Q29414 Link Image
Enzyme 18 UniProtKB/Swiss-Prot Entry Name ASIP_BOVIN Link Image
Enzyme 18 PDB ID Not Available
Enzyme 18 Cellular Location Not Available
Enzyme 18 Gene Sequence Not Available
Enzyme 18 GenBank Gene ID X99692 Link Image
Enzyme 18 GeneCard ID ASIP Link Image
Enzyme 18 GenAtlas ID Not Available
Enzyme 18 HGNC ID Not Available
Enzyme 18 Chromosome Location Chromosome:2
Enzyme 18 Locus 20q11.2-q12
Enzyme 18 SNPs SNPJam Report Link Image
Enzyme 18 General References
  1. [PubMed Link Image]
Enzyme 18 Metabolite References Not Available
Enzyme 19 [top]
Enzyme 19 ID 1998
Enzyme 19 Name CREB-regulated transcription coactivator 2
Enzyme 19 Synonyms
  1. Transducer of regulated cAMP response element-binding protein 2
  2. TORC-2
  3. Transducer of CREB protein 2
Enzyme 19 Gene Name CRTC2
Enzyme 19 Protein Sequence >CREB-regulated transcription coactivator 2
MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLA
YTRSSHYGGSLPNVNQIGCGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRR
YARHIDSSPYSPAYLSPPPESSWRRTMPWGSFPAEKGQLFRLPSALNRTSSDSALHTSVM
NPSPQDTYPSPAAPSVLPSRRGGCLDGETDSKVPAIEENLLDDKHLLKPWDAKKLSSSSS
RPRSCEVPGINIFPSPDQPATVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETAYPS
LSGGSSTSNLTHTMTHLGISGGLALGPGYDAPGLHSPLSHPSFQSSLSNPNLQASLSSPQ
PQLQGSHSHPSLPASSLARHALPTTSLGHPSLSAPALSSSSSSSSASSPVLGAPAYPASA
PGASPRHRRVPLSPLSLPAGPADARRSQQQLPKQFSPTMSPTLSSITQGVALDTSKLPTD
QRLPPYPYSPPSLVLPTQQPTPKPLQQPGLPSQACSVQPSGGQPPGRQLQYGTLYPPGPS
GHGQQSYHRSMSDFSLGNLEQFNMENPSTSLALDPPGFSEGPGFLGGEGPVSGPQDPHAL
NHQNVTHCSRHGSGPNVILTGDASPGFSKEIAAALAGVPGFEVSAAGLGLGLGLEEELRM
EPLGLEGLSMLSDPCALLPDPAVEDSFRSDRLQ
Enzyme 19 Number of Residues 693
Enzyme 19 Molecular Weight 72817.5
Enzyme 19 Theoretical pI 7.14
Enzyme 19 GO Classification
Function
Process
Component
Enzyme 19 General Function Not Available
Enzyme 19 Specific Function Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates gluconeogenesis as a component of the LKB1/AMPK/TORC2 signaling pathway. Regulates the expression of specific genes such as the steroidogenic gene, StAR. Potent coactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells
Enzyme 19 Pathways Not Available
Enzyme 19 Reactions Not Available
Enzyme 19 Pfam Domain Function Not Available
Enzyme 19 Signals
  • None
Enzyme 19 Transmembrane Regions
  • None
Enzyme 19 Essentiality Not Available
Enzyme 19 GenBank ID Protein 115304747 Link Image
Enzyme 19 UniProtKB/Swiss-Prot ID Q08E26 Link Image
Enzyme 19 UniProtKB/Swiss-Prot Entry Name CRTC2_BOVIN Link Image
Enzyme 19 PDB ID Not Available
Enzyme 19 Cellular Location Not Available
Enzyme 19 Gene Sequence >2082 bp
ATGGCGACGTCGGGAGCGAATGGGCCCGGTTCGGCCACGGCCTCAGCTTCCAATCCGCGT
AAGTTTAGTGAGAAGATCGCGCTGCAGAAGCAGCGTCAGGCCGAGGAGACGGCGGCCTTC
GAGGAGGTGATGATGGACATCGGCTCCACCCGGTTACAGGCCCAAAAACTTCGGCTGGCA
TACACAAGGAGCTCCCACTATGGTGGCTCTCTGCCCAATGTGAACCAGATTGGCTGTGGC
CTAGCCGAGTTCCAGAGCCCCCTCCACTCCCCTCTGGATTCATCTCGGAGCACTCGACAT
CACGGGCTGGTGGAACGGGTGCAGCGAGATCCCCGAAGAATGGTGTCCCCGCTTCGCCGC
TACGCCCGCCACATTGACAGCTCTCCCTATAGTCCTGCCTATTTATCTCCTCCCCCGGAG
TCCAGCTGGCGGAGGACAATGCCCTGGGGCAGTTTCCCTGCAGAGAAGGGACAGTTGTTT
CGACTACCATCTGCACTTAACAGGACAAGCTCTGACTCTGCCCTTCACACAAGCGTGATG
AACCCCAGCCCTCAGGACACGTATCCAAGCCCTGCAGCCCCCAGCGTCCTGCCGAGCCGC
CGTGGAGGTTGTCTGGACGGCGAGACGGACTCCAAAGTCCCTGCTATTGAGGAGAACTTG
CTAGATGATAAGCACTTGTTGAAACCATGGGATGCTAAGAAGCTGTCCTCGTCCTCCTCC
CGACCTCGGTCCTGTGAAGTCCCTGGAATTAACATCTTCCCGTCTCCTGACCAGCCTGCC
ACTGTGCCTGTCCTCCCACCTGCCATGAACACGGGAGGCTCCCTACCTGACCTCACCAAC
CTGCACTTTCCCCCACCGCTACCCACCCCCCTGGACCCAGAGGAGACAGCCTATCCCAGC
CTGAGTGGGGGCAGCAGTACCTCCAATTTGACCCACACCATGACCCACCTGGGCATCAGC
GGGGGCCTGGCCCTGGGCCCGGGCTATGATGCGCCAGGACTTCATTCACCTCTCAGCCAC
CCATCCTTTCAGTCCTCCCTAAGCAATCCCAACCTCCAGGCTTCCCTGAGCAGTCCTCAG
CCCCAGCTCCAGGGCTCCCACAGTCACCCCTCACTGCCTGCTTCCTCCTTGGCTCGCCAC
GCACTGCCCACCACCTCCCTGGGCCACCCCTCGCTCAGTGCCCCGGCCCTCTCCTCCTCC
TCTTCCTCCTCTTCCGCTTCCTCTCCGGTGCTGGGGGCCCCCGCTTACCCAGCTTCTGCC
CCTGGGGCCTCCCCCCGCCACCGCCGTGTGCCCCTCAGTCCCCTGAGTTTGCCCGCGGGC
CCAGCCGACGCCAGAAGGTCCCAACAGCAACTGCCCAAACAGTTTTCGCCAACAATGTCA
CCCACCTTGTCTTCCATCACTCAGGGCGTCGCCCTGGATACCAGTAAGCTGCCCACCGAC
CAGCGGCTGCCTCCATACCCATACAGCCCCCCAAGTCTGGTTCTGCCCACCCAGCAACCC
ACCCCAAAGCCTCTGCAGCAGCCAGGGCTGCCCTCTCAGGCCTGCTCAGTGCAGCCCTCA
GGGGGCCAGCCCCCAGGCAGGCAGCTGCAGTATGGGACACTGTACCCGCCCGGACCCAGT
GGGCACGGGCAACAGTCTTACCACCGGTCGATGAGTGACTTCAGCCTGGGGAACCTGGAG
CAGTTCAACATGGAGAACCCATCGACCAGCCTGGCGCTGGATCCCCCTGGCTTTTCCGAA
GGGCCTGGCTTCTTAGGGGGTGAGGGACCAGTGAGTGGCCCCCAGGACCCTCACGCCCTC
AACCACCAGAACGTAACCCACTGTTCCCGCCACGGCTCAGGGCCTAACGTCATCCTCACA
GGAGACGCCTCCCCAGGCTTCTCCAAGGAGATTGCAGCGGCCCTGGCCGGAGTGCCGGGC
TTCGAGGTGTCAGCAGCTGGGCTGGGGCTGGGGCTGGGGCTGGAGGAGGAGCTGCGCATG
GAGCCACTGGGCCTGGAGGGGCTCAGCATGCTGAGTGACCCCTGCGCCCTGCTGCCTGAT
CCGGCTGTGGAGGACTCGTTCCGCAGTGACCGGCTGCAGTGA
Enzyme 19 GenBank Gene ID BC123454 Link Image
Enzyme 19 GeneCard ID CRTC2 Link Image
Enzyme 19 GenAtlas ID Not Available
Enzyme 19 HGNC ID Not Available
Enzyme 19 Chromosome Location Chromosome:1
Enzyme 19 Locus 1q21.3
Enzyme 19 SNPs SNPJam Report Link Image
Enzyme 19 General References Not Available
Enzyme 19 Metabolite References Not Available
Enzyme 20 [top]
Enzyme 20 ID 1999
Enzyme 20 Name cAMP responsive element binding protein 1 isoform A
Enzyme 20 Synonyms Not Available
Enzyme 20 Gene Name CREB1
Enzyme 20 Protein Sequence >cAMP responsive element binding protein 1 isoform A
MTMESGAENQQSGDAAVTEAESQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREILSRRPSY
RKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAITQGGAIQLA
NNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAASGDVQTYQI
RTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKKKEYVKCLENR
VAVLENQNKTLIEELKALKDLYCHKSD
Enzyme 20 Number of Residues 327
Enzyme 20 Molecular Weight 35109.1
Enzyme 20 Theoretical pI 4.93
Enzyme 20 GO Classification
Function
Process
Component
Enzyme 20 General Function Involved in protein dimerization activity
Enzyme 20 Specific Function Not Available
Enzyme 20 Pathways Not Available
Enzyme 20 Reactions Not Available
Enzyme 20 Pfam Domain Function
Enzyme 20 Signals
  • None
Enzyme 20 Transmembrane Regions
  • None
Enzyme 20 Essentiality Not Available
Enzyme 20 GenBank ID Protein 111120272 Link Image
Enzyme 20 UniProtKB/Swiss-Prot ID Q0V7N6 Link Image
Enzyme 20 UniProtKB/Swiss-Prot Entry Name Q0V7N6_BOVIN Link Image
Enzyme 20 PDB ID Not Available
Enzyme 20 Cellular Location Not Available
Enzyme 20 Gene Sequence >984 bp
ATGACCATGGAATCTGGAGCAGAGAACCAGCAGAGTGGAGATGCAGCTGTAACAGAAGCT
GAAAGCCAGCAAATGACAGTTCAAGCCCAGCCACAGATTGCCACATTAGCCCAGGTATCT
ATGCCAGCAGCTCACGCAACATCATCTGCTCCCACCGTAACTTTAGTACAGCTGCCCAAT
GGGCAGACAGTTCAAGTCCATGGAGTTATTCAGGCGGCCCAGCCATCAGTTATTCAGTCT
CCACAAGTCCAGACAGTTCAGATTTCAACTATTGCAGAAAGTGAAGATTCACAGGAGTCA
GTGGATAGTGTAACCGATTCCCAAAAACGAAGAGAGATTCTTTCAAGGAGGCCTTCCTAC
AGGAAAATTTTGAATGACTTATCTTCTGATGCACCAGGAGTGCCAAGGATTGAAGAAGAG
AAATCTGAAGAGGAGACTTCAGCACCTGCCATCACCACTGTCACGGTGCCAACTCCGATT
TATCAGACTAGCAGTGGACAGTATATTGCCATTACCCAAGGAGGAGCAATACAACTGGCT
AACAATGGTACTGATGGGGTACAGGGCCTGCAGACATTAACCATGACCAATGCAGCTGCC
ACTCAGCCAGGTACTACCATCCTGCAGTATGCACAGACCACTGATGGACAGCAAATCCTA
GTGCCCAGCAACCAAGTTGTTGTTCAAGCTGCCTCTGGAGATGTACAGACATACCAGATT
CGCACAGCGCCCACTAGCACCATTGCCCCTGGAGTTGTTATGGCGTCTTCCCCAGCACTT
CCTACACAGCCTGCTGAAGAAGCGGCGCGAAAGAGAGAGGTTCGCCTCATGAAGAACAGG
GAAGCAGCACGAGAGTGTCGTAGAAAGAAGAAAGAATATGTGAAATGTCTAGAAAACAGA
GTGGCAGTGCTTGAAAATCAAAACAAGACACTGATTGAGGAGCTAAAAGCACTTAAGGAC
CTTTACTGCCACAAATCAGATTAA
Enzyme 20 GenBank Gene ID BT026534 Link Image
Enzyme 20 GeneCard ID CREB1 Link Image
Enzyme 20 GenAtlas ID Not Available
Enzyme 20 HGNC ID Not Available
Enzyme 20 Chromosome Location Chromosome:2
Enzyme 20 Locus 2q34
Enzyme 20 SNPs SNPJam Report Link Image
Enzyme 20 General References
  1. [PubMed Link Image]
Enzyme 20 Metabolite References Not Available