We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Bilirubin (BMDB00054)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-06-30 18:49:50
Accession Number BMDB00054
Common Name Bilirubin
Description Bilirubin is a bile pigment that is a degradation product of heme. In particular, bilirubin is a yellow breakdown product of normal heme catabolism. Its levels are elevated in certain diseases and it is responsible for the yellow color of bruises. Bilirubin is an excretion product, and the body does not control levels. Bilirubin levels reflect the balance between production and excretion. Thus, there is no "normal" level of bilirubin. Bilirubin consists of an open chain of four pyrroles (tetrapyrrole); by contrast, the heme molecule is a closed ring of four pyrroles, called porphyrin. -- Wikipedia
Synonyms
  1. (4Z,15Z)-Bilirubin IXa
  2. (Z,Z)-Bilirubin IXa
  3. 1,10,19,22,23,24-hexahydro-2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinyl-Biline-8,12-dipropionate
  4. 1,10,19,22,23,24-hexahydro-2,7,13,17-tetramethyl-1,19-dioxo-3,18-divinyl-Biline-8,12-dipropionic acid
  5. 2,17-diethenyl-1,10,19,22,23,24-hexahydro-3,7,13,18-tetramethyl-1,19-dioxo-21H-Biline-8,12-dipropanoate
  6. 3-(2-((3-(2-Carboxyethyl)-4-methyl-5-[(Z)-(3-methyl-5-oxo-4-vinyl-1,5-dihydro-2H-pyrrol-2-ylidene)methyl]-1H-pyrrol-2-yl)methyl)-4-methyl-5-[(Z)-(4-methyl-5-oxo-3-vinyl-1,5-dihydro-2H-pyrrol-2-ylidene
  7. 3-(2-((3-(2-carboxyethyl)-4-methyl-5-((3-methyl-5-oxo-4-vinyl-1,5-dihydro-2H-pyrrol-2-ylidene)methyl)-1H-pyrrol-2-yl)methyl)-4-methyl-5-((4-methyl-5-oxo-3-vinyl-1,5-dihydro-2H-pyrrol-2-ylidene)methyl)-1H-pyrrol-3-yl)propanoate
  8. 3-[2-[[3-(2-carboxyethyl)-5-[(3-ethenyl-4-methyl-5-oxo-pyrrol-2-ylidene)methyl]-4-methyl-1H-pyrrol-2-yl]methyl]-5-[(4-ethenyl-3-methyl-5-oxo-pyrrol-2-ylidene)methyl]-4-methyl-1H-pyrrol-3-yl]propanoate
  9. 3-[2-[[3-(2-carboxyethyl)-5-[(Z)-(3-ethenyl-4-methyl-5-oxo-pyrrol-2-ylidene)methyl]-4-methyl-1H-pyrrol-2-yl]methyl]-5-[(Z)-(4-ethenyl-3-methyl-5-oxo-pyrrol-2-ylidene)methyl]-4-methyl-1H-pyrrol-3-yl]propanoate
  10. Bilirubin
  11. Bilirubin IX-alpha
  12. Cholerythrin
  13. Hematoidin
  14. 2,17-diethenyl-1,10,19,22,23,24-hexahydro-3,7,13,18-tetramethyl-1,19-dioxo-21H-Biline-8,12-dipropanoic acid
  15. 3-(2-((3-(2-carboxyethyl)-4-methyl-5-((3-methyl-5-oxo-4-vinyl-1,5-dihydro-2H-pyrrol-2-ylidene)methyl)-1H-pyrrol-2-yl)methyl)-4-methyl-5-((4-methyl-5-oxo-3-vinyl-1,5-dihydro-2H-pyrrol-2-ylidene)methyl)-1H-pyrrol-3-yl)propanoic acid
  16. 3-[2-[[3-(2-carboxyethyl)-5-[(3-ethenyl-4-methyl-5-oxo-pyrrol-2-ylidene)methyl]-4-methyl-1H-pyrrol-2-yl]methyl]-5-[(4-ethenyl-3-methyl-5-oxo-pyrrol-2-ylidene)methyl]-4-methyl-1H-pyrrol-3-yl]propanoic acid
  17. 3-[2-[[3-(2-carboxyethyl)-5-[(Z)-(3-ethenyl-4-methyl-5-oxo-pyrrol-2-ylidene)methyl]-4-methyl-1H-pyrrol-2-yl]methyl]-5-[(Z)-(4-ethenyl-3-methyl-5-oxo-pyrrol-2-ylidene)methyl]-4-methyl-1H-pyrrol-3-yl]propanoic acid
Chemical IUPAC Name 3-[2-[[3-(2-carboxyethyl)-5-[(Z)-(3-ethenyl-4-methyl-5-oxo-pyrrol-2-ylidene)methyl]-4-methyl-1H-pyrrol-2-yl]methyl]-5-[(Z)-(4-ethenyl-3-methyl-5-oxo-pyrrol-2-ylidene)methyl]-4-methyl-1H-pyrrol-3-yl]propanoic acid
Chemical Formula C33H36N4O6
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Heterocyclic molecules
Class
  • Porphyrins
Sub Class
  • Bilirubins
Family
  • Mammalian_Metabolite
Species
  • carboxylic acid; oxo(het)arene; alkene; aromatic compound; heterocyclic compound
Biofunction
  • Component of Porphyrin and chlorophyll metabolism
Application
Source
  • Endogenous
Average Molecular Weight 584.662
Monoisotopic Molecular Weight 584.263489
Isomeric SMILES CC1=C(C=C)C(NC1=O)=CC1=C(C)C(CCC(O)=O)=C(CC2=C(CCC(O)=O)C(C)=C(N2)C=C2NC(=O)C(C=C)=C/2C)N1
Canonical SMILES CC1=C(C=C)C(NC1=O)=CC1=C(C)C(CCC(O)=O)=C(CC2=C(CCC(O)=O)C(C)=C(N2)C=C2NC(=O)C(C=C)=C2C)N1
KEGG Compound ID C00486 Link Image
BioCyc ID BILIRUBIN Link Image
BiGG ID 35117 Link Image
Wikipedia Link Bilirubin Link Image
METLIN ID 81 Link Image
PubChem Compound 5280352 Link Image
PubChem Substance 8144728 Link Image
ChEBI ID 16990 Link Image
CAS Registry Number 635-65-4
InChI Identifier InChI=1/C33H36N4O6/c1-7-20-19(6)32(42)37-27(20)14-25-18(5)23(10-12-31(40)41)29(35-25)15-28-22(9-11-30(38)39)17(4)24(34-28)13-26-16(3)21(8-2)33(43)36-26/h7-8,13-14,34-35H,1-2,9-12,15H2,3-6H3,(H,36,43)(H,37,42)(H,38,39)(H,40,41)/b26-13-,27-14-
Synthesis Reference Not Available
Melting Point (Experimental) Not Available
Experimental Water Solubility 0.009 mg/mL at 25 oC [BEILSTEIN] Source: PhysProp
Predicted Water Solubility 9.64e-03 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -2
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity 3.22 [Predicted by ALOGPS]; 1.945 [Predicted by PubChem via XLOGP]; 5.04 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Membrane (Predicted from LogP)
  • Cytoplasm
  • endoplasmic reticulum
  • Extracellular
Biofluid Location Not Available
Tissue Location
Tissue References
Bile Duct
Bone Marrow
Brain
Erythrocyte
Fibroblasts
Intestine
Kidney
Liver
Lymph Node
Muscle
Myelin
Nerve Cells
Neuron
Pancreas
Placenta
Platelet
Reticulocyte
Skin
Spleen
Thyroid Gland
Concentrations (Normal) Not Available
Concentrations (Abnormal) Not Available
Pathway Names
  • Porphyrin Metabolism
HMDB Pathways
Name Porphyrin Metabolism
Image Show Link Image
KEGG Pathways
Name Porphyrin Metabolism
Image Show Link Image
SimCell Pathways
Name Porphyrin Metabolism
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Prostaglandin-H2 D-isomerase
  2. Flavin reductase
  3. Glutathione S-transferase theta-1
  4. Alpha-fetoprotein
  5. Fatty acid-binding protein, liver
Enzyme 1 [top]
Enzyme 1 ID 102
Enzyme 1 Name Prostaglandin-H2 D-isomerase
Enzyme 1 Synonyms
  1. Lipocalin-type prostaglandin-D synthase
  2. Glutathione-independent PGD synthetase
  3. Prostaglandin-D2 synthase
  4. PGD2 synthase
  5. PGDS2
  6. PGDS
Enzyme 1 Gene Name PTGDS
Enzyme 1 Protein Sequence >Prostaglandin-H2 D-isomerase
MATPNRLWMALLLLGVLGVLQTPAPAQAALQPNFEEDKFLGRWFTSGLASNSSWFLEKKK
VLSMCKSVVAPAADGGLNLTSTFLRKDQCETRTLLLRPAGPPGCYSYTSPHWSSTHEVSV
AETDYETYALLYTEGVRGPGQDFRMATLYSRSQNPRAEVKEHFTTFAKSLGFTEEGIVFL
PKTDKCMEEHP
Enzyme 1 Number of Residues 191
Enzyme 1 Molecular Weight 21229.0
Enzyme 1 Theoretical pI 6.92
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Involved in prostaglandin-D synthase activity
Enzyme 1 Specific Function Catalyzes the conversion of PGH2 to PGD2, a prostaglandin involved in smooth muscle contraction/relaxation and a potent inhibitor of platelet aggregation. Involved in a variety of CNS functions, such as sedation, NREM sleep and PGE2-induced allodynia, and may have an anti-apoptotic role in oligodendrocytes. Binds small non-substrate lipophilic molecules, including biliverdin, bilirubin, retinal, retinoic acid and thyroid hormone, and may act as a scavenger for harmful hydrophopic molecules and as a secretory retinoid and thyroid hormone transporter. Possibly involved in development and maintenance of the blood-brain, blood-retina, blood-aqueous humor and blood-testis barrier. It is likely to play important roles in both maturation and maintenance of the central nervous system and male reproductive system
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • 1-28
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 2196434 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID O02853 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name PTGDS_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >576 bp
ATGGCCACTCCGAATAGGCTGTGGATGGCGCTGCTCCTGCTGGGGGTCCTGGGGGTCCTG
CAGACCCCAGCCCCCGCCCAGGCCGCCCTGCAGCCCAACTTCGAAGAGGACAAGTTTCTG
GGGCGCTGGTTCACCTCCGGCCTTGCCTCCAACTCGAGCTGGTTCCTGGAGAAGAAGAAG
GTGCTGTCCATGTGCAAGTCTGTGGTGGCCCCCGCGGCGGACGGCGGCCTCAACCTCACC
TCTACCTTCCTCAGGAAAGACCAGTGTGAGACGCGGACCTTACTGCTGCGCCCCGCCGGC
CCCCCAGGCTGCTACAGCTACACCAGCCCTCACTGGAGCAGCACCCACGAGGTGTCAGTG
GCAGAGACAGACTACGAGACCTACGCCCTGCTCTACACAGAGGGTGTCCGAGGCCCGGGG
CAGGACTTCCGCATGGCCACGCTCTACAGCCGCTCCCAGAACCCCCGAGCCGAGGTCAAG
GAACACTTCACCACCTTTGCCAAGAGCCTGGGCTTCACAGAGGAAGGCATTGTGTTCCTG
CCGAAGACTGACAAGTGCATGGAGGAGCACCCATAG
Enzyme 1 GenBank Gene ID AB004647 Link Image
Enzyme 1 GeneCard ID PTGDS Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:9
Enzyme 1 Locus 9q34.2-q34.3
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References
  1. [PubMed Link Image]
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 585
Enzyme 2 Name Flavin reductase
Enzyme 2 Synonyms
  1. FR
  2. NADPH-dependent diaphorase
  3. NADPH-flavin reductase
  4. FLR
  5. Biliverdin reductase B
  6. BVR-B
  7. Biliverdin-IX beta-reductase
  8. Green heme-binding protein
  9. GHBP
Enzyme 2 Gene Name BLVRB
Enzyme 2 Protein Sequence >Flavin reductase
MVVKKIALFGATGNTGLTTLAQAVQAGYEVTVLVRDPSRLPSEGPQPAHVVVGDVRQPAD
VDKTVAGQDAVIVLLGTRNDLSPTTVMSEGAQNIVAAMKAHGVDKVVACTSAFLLWDPSK
VPPRLQDVTDDHIRMHKVLQQSGLKYVAVMPPHIGDHPLTGAYTVTLDGRGPSRVISKHD
LGHFMLHCLTTDKYDGHTTYPSHVYE
Enzyme 2 Number of Residues 206
Enzyme 2 Molecular Weight 22132.2
Enzyme 2 Theoretical pI 7.13
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Cell wall/membrane/envelope biogenesis
Enzyme 2 Specific Function Catalyzes electron transfer from reduced pyridine nucleotides to flavins as well as methylene blue, pyrroloquinoline quinone, riboflavin, or methemoglobin. Possible role in protecting cells from oxidative damage or in regulating iron metabolism. In the liver, converts biliverdin to bilirubin
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • None
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 516594 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID P52556 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name BLVRB_BOVIN Link Image
Enzyme 2 PDB ID 1HE5 Link Image
Enzyme 2 PDB File Show
Enzyme 2 3D Structure
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >621 bp
ATGGTCGTCAAGAAGATTGCCCTTTTCGGCGCCACCGGCAACACCGGGCTCACCACGCTG
GCGCAGGCGGTGCAAGCAGGCTATGAGGTGACGGTGCTGGTGCGGGACCCCTCCAGGCTG
CCCTCAGAGGGGCCCCAGCCGGCCCACGTGGTGGTGGGTGACGTCCGGCAGCCGGCCGAT
GTGGACAAGACCGTGGCTGGGCAGGACGCTGTCATCGTGCTGCTGGGCACCCGCAATGAC
CTCAGTCCTACCACAGTGATGTCCGAGGGTGCCCAGAACATTGTGGCAGCCATGAAGGCC
CATGGCGTGGACAAGGTCGTGGCCTGCACCTCGGCCTTCCTACTGTGGGACCCTTCCAAG
GTGCCCCCAAGACTGCAGGATGTGACTGATGACCATATCCGGATGCACAAGGTACTGCAG
CAGTCGGGCCTGAAGTACGTGGCCGTGATGCCACCACATATAGGAGACCACCCATTGACT
GGGGCCTACACAGTGACCCTGGATGGACGAGGGCCCTCGAGAGTCATCTCCAAACATGAC
CTGGGCCACTTCATGCTGCACTGCCTCACCACCGATAAGTACGACGGGCACACCACCTAC
CCCTCCCATGTGTATGAATAG
Enzyme 2 GenBank Gene ID L35045 Link Image
Enzyme 2 GeneCard ID BLVRB Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 19q13.1-q13.2
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 1241
Enzyme 3 Name Glutathione S-transferase theta-1
Enzyme 3 Synonyms
  1. GST class-theta-1
Enzyme 3 Gene Name GSTT1
Enzyme 3 Protein Sequence >Glutathione S-transferase theta-1
MGLELYLDLLSQPCRAIYIFAKKNRIPFELRTVDLRKGQHLSDAFAQVNPLQKVPILKDG
DFILTESVAILLYLARKYKVPDHWYPQDLQACARVDEYLAWQHTALRRNCLRALWHKVML
PVFLGEPVSPEMLATTLAELDMALQVLEGKFLQDKAFLTGSHISLADLVAITELMHPVGA
GCQVFKGRPKLAAWRQRVEAAVGEVLFQEAHEVILKAKDSQPADPTLKQKMLPKVLAMIQ
Enzyme 3 Number of Residues 240
Enzyme 3 Molecular Weight 27148.7
Enzyme 3 Theoretical pI 8.61
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Posttranslational modification, protein turnover, chaperones
Enzyme 3 Specific Function Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Also binds steroids, bilirubin, carcinogens and numerous organic anions. Has dichloromethane dehalogenase activity
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • None
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 84708805 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q2NL00 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name GSTT1_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >723 bp
ATGGGCCTGGAGCTCTACCTGGACCTGCTGTCCCAACCCTGCCGCGCCATCTACATCTTC
GCCAAGAAGAACCGCATCCCCTTCGAGCTGCGCACCGTGGACCTGCGCAAAGGCCAGCAC
CTCAGCGATGCCTTTGCCCAGGTGAACCCCCTGCAGAAGGTGCCAATCTTGAAGGACGGG
GACTTCATCTTGACCGAGAGCGTGGCCATCCTGCTCTACCTGGCCCGCAAGTATAAGGTC
CCCGACCACTGGTACCCTCAGGACCTGCAGGCCTGTGCCCGTGTGGACGAGTACCTGGCC
TGGCAGCACACAGCCCTGCGGAGAAACTGCCTCCGAGCCCTGTGGCATAAGGTGATGCTC
CCTGTTTTCCTGGGTGAGCCGGTCTCTCCTGAGATGCTGGCGACCACGCTGGCAGAGTTG
GACATGGCCCTGCAGGTGCTTGAGGGCAAGTTCCTCCAGGACAAAGCCTTTCTCACCGGG
TCCCACATCTCTCTGGCTGACCTGGTAGCCATCACGGAGCTGATGCACCCCGTGGGTGCC
GGCTGCCAAGTCTTCAAAGGCCGACCCAAGCTGGCCGCATGGCGCCAGCGCGTGGAGGCG
GCGGTGGGGGAGGTCCTCTTCCAAGAGGCCCATGAGGTCATCCTGAAGGCCAAGGACTCT
CAGCCTGCAGACCCCACCTTAAAGCAGAAGATGCTGCCCAAAGTGCTGGCCATGATCCAG
TGA
Enzyme 3 GenBank Gene ID BC111289 Link Image
Enzyme 3 GeneCard ID GSTT1 Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:2
Enzyme 3 Locus 22q11.23
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References Not Available
Enzyme 3 Metabolite References Not Available
Enzyme 4 [top]
Enzyme 4 ID 1929
Enzyme 4 Name Alpha-fetoprotein
Enzyme 4 Synonyms
  1. Alpha-1-fetoprotein
  2. Alpha-fetoglobulin
Enzyme 4 Gene Name AFP
Enzyme 4 Protein Sequence >Alpha-fetoprotein
MKWVVSFFLLFLLNFSDSRTMHKNAYGIDSILDSSPCSSGTNLVGLATIFFAQSVQGATY
EEVSQMVKDVLTIIEKPTGSKQPAGCLENQVSAFLEEICREKEIPEKYGLSDCCSRTGEE
RHDCFLAHKKAAPASIPPFPVLEPVTSCKSYKENRELFINRYIYEIARRHPVLYAPTILS
VANQYNKIIPHCCKAENATECFETKVTSITKELRESSLLNQHICAVMGKFGPRTFRAITV
TKVSQKFPKANFTEIQKLVMDVAHIHEECCKGNVLECLQDGERVMSYICSQQDILSRQIA
ECCKLPTTLELGHCIIHAENDDKPEGLSPNVNRFLGDRDFNQLSSRDKDLSMARFTYEYS
RRHTKLAVPIILRVAKGYQELLEKCSQSENPSECQDKGEEELEKYIQESQALAKRSCGLF
QKLGEYYLQNAFLVAYTKKAPQLTSPELMALTRKMANAGAICCHLSEDKQLACGEGVADL
IIGHLCIRHEENPINPGVDQCCTSSYSNRRPCFSSLVVDETYVPPPFSDDKFIFHKDLCQ
VQGVPLQTMKQQFLINLVKQKPQITEEQLETVVADFSGLLEKCCQSQEQEVCFTEEGPAL
ISKTRAALGV
Enzyme 4 Number of Residues 610
Enzyme 4 Molecular Weight 68587.0
Enzyme 4 Theoretical pI 6.24
Enzyme 4 GO Classification
Function
Process
Component
Enzyme 4 General Function Involved in copper ion binding
Enzyme 4 Specific Function Binds copper, nickel, and fatty acids as well as, and bilirubin less well than, serum albumin
Enzyme 4 Pathways Not Available
Enzyme 4 Reactions Not Available
Enzyme 4 Pfam Domain Function
Enzyme 4 Signals
  • 1-18
Enzyme 4 Transmembrane Regions
  • None
Enzyme 4 Essentiality Not Available
Enzyme 4 GenBank ID Protein 74267840 Link Image
Enzyme 4 UniProtKB/Swiss-Prot ID Q3SZ57 Link Image
Enzyme 4 UniProtKB/Swiss-Prot Entry Name FETA_BOVIN Link Image
Enzyme 4 PDB ID Not Available
Enzyme 4 Cellular Location Not Available
Enzyme 4 Gene Sequence >1833 bp
ATGAAGTGGGTGGTATCATTCTTTTTACTTTTTCTACTAAATTTTAGCGATTCCAGAACA
ATGCATAAAAATGCATATGGAATAGATTCCATATTGGATTCTTCCCCATGTTCTTCAGGG
ACAAATTTAGTTGGCCTAGCTACCATATTTTTTGCCCAGTCTGTTCAAGGAGCCACTTAC
GAGGAAGTAAGTCAAATGGTGAAAGATGTATTGACTATAATAGAGAAACCCACTGGCAGT
AAGCAACCTGCTGGGTGTTTAGAGAACCAGGTATCTGCCTTTCTGGAAGAAATTTGCCGT
GAAAAGGAAATTCCTGAAAAGTATGGGCTTTCAGACTGCTGCAGCCGAACTGGAGAGGAA
AGACATGACTGTTTCTTGGCACACAAAAAGGCTGCTCCAGCTTCCATTCCACCCTTTCCA
GTTCTGGAACCTGTCACAAGTTGTAAATCGTACAAGGAAAATAGAGAGCTGTTCATAAAC
AGATACATCTATGAAATAGCAAGAAGGCACCCTGTCCTGTATGCACCAACAATTCTTTCT
GTGGCTAATCAATACAATAAAATTATTCCACATTGCTGCAAAGCTGAAAATGCCACTGAA
TGCTTCGAAACAAAGGTAACATCAATTACAAAAGAATTAAGAGAAAGCAGTTTGTTAAAT
CAGCATATATGTGCAGTAATGGGAAAATTTGGACCCCGGACCTTCCGAGCCATAACTGTT
ACTAAAGTGAGTCAAAAGTTTCCCAAAGCTAATTTTACTGAAATTCAGAAACTGGTCATG
GATGTGGCCCACATACATGAGGAATGCTGCAAAGGAAACGTGCTGGAGTGTCTGCAGGAT
GGGGAAAGAGTTATGTCCTACATATGTTCCCAACAAGATATTCTGTCAAGACAAATAGCA
GAGTGCTGCAAGTTGCCCACCACACTTGAACTTGGTCATTGCATAATTCATGCAGAAAAT
GATGACAAACCTGAAGGCTTATCTCCAAATGTAAATAGGTTTTTAGGAGACAGAGATTTC
AACCAACTTTCTTCAAGGGATAAAGATCTCTCCATGGCAAGATTTACATATGAATATTCA
AGAAGACACACTAAGCTTGCTGTTCCAATAATTCTAAGGGTTGCTAAAGGATATCAGGAA
TTACTGGAGAAGTGTTCCCAGTCTGAAAACCCTTCTGAATGCCAGGATAAAGGGGAAGAA
GAACTGGAGAAATATATCCAGGAGAGCCAAGCCCTGGCAAAGCGAAGCTGTGGTCTCTTT
CAGAAATTAGGAGAATATTACTTACAAAATGCGTTTCTTGTTGCTTACACAAAGAAGGCT
CCTCAGCTGACCTCGCCTGAGCTGATGGCCTTGACCAGGAAAATGGCGAACGCAGGAGCC
ATTTGTTGCCATCTCAGTGAGGACAAACAGCTGGCCTGTGGCGAGGGAGTGGCTGACCTT
ATTATAGGACACTTATGCATCAGACATGAAGAGAACCCCATAAACCCTGGTGTTGACCAG
TGCTGCACCTCTTCATACTCCAACAGGAGGCCATGCTTCAGCAGCTTGGTGGTGGATGAG
ACATACGTGCCTCCACCATTCTCCGATGACAAGTTCATCTTCCATAAGGATCTATGCCAA
GTTCAGGGTGTACCACTGCAGACAATGAAGCAACAGTTTCTCATTAACCTTGTGAAGCAG
AAGCCACAAATAACAGAGGAACAATTGGAGACGGTCGTTGCAGATTTCTCTGGCCTCCTG
GAAAAGTGTTGCCAAAGCCAAGAGCAGGAAGTCTGCTTTACAGAAGAGGGTCCAGCACTG
ATTTCAAAAACTCGTGCTGCTTTGGGAGTCTAA
Enzyme 4 GenBank Gene ID BC103123 Link Image
Enzyme 4 GeneCard ID AFP Link Image
Enzyme 4 GenAtlas ID Not Available
Enzyme 4 HGNC ID Not Available
Enzyme 4 Chromosome Location Chromosome:4
Enzyme 4 Locus 4q11-q13
Enzyme 4 SNPs SNPJam Report Link Image
Enzyme 4 General References Not Available
Enzyme 4 Metabolite References Not Available
Enzyme 5 [top]
Enzyme 5 ID 2601
Enzyme 5 Name Fatty acid-binding protein, liver
Enzyme 5 Synonyms
  1. L-FABP
Enzyme 5 Gene Name FABP1
Enzyme 5 Protein Sequence >Fatty acid-binding protein, liver
MNFSGKYQVQTQENYEAFMKAVGMPDDIIQKGKDIKGVSEIVQNGKHFKFIITAGSKVIQ
NEFTLGEECEMEFMTGEKIKAVVQQEGDNKLVTTFKGIKSVTEFNGDTVTSTMTKGDVVF
KRVSKRI
Enzyme 5 Number of Residues 127
Enzyme 5 Molecular Weight 14227.3
Enzyme 5 Theoretical pI 8.46
Enzyme 5 GO Classification
Function
Process
Component
Enzyme 5 General Function Involved in lipid binding
Enzyme 5 Specific Function Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport
Enzyme 5 Pathways Not Available
Enzyme 5 Reactions Not Available
Enzyme 5 Pfam Domain Function
Enzyme 5 Signals
  • None
Enzyme 5 Transmembrane Regions
  • None
Enzyme 5 Essentiality Not Available
Enzyme 5 GenBank ID Protein 806334 Link Image
Enzyme 5 UniProtKB/Swiss-Prot ID P80425 Link Image
Enzyme 5 UniProtKB/Swiss-Prot Entry Name FABPL_BOVIN Link Image
Enzyme 5 PDB ID Not Available
Enzyme 5 Cellular Location Not Available
Enzyme 5 Gene Sequence Not Available
Enzyme 5 GenBank Gene ID X86904 Link Image
Enzyme 5 GeneCard ID FABP1 Link Image
Enzyme 5 GenAtlas ID Not Available
Enzyme 5 HGNC ID Not Available
Enzyme 5 Chromosome Location Chromosome:2
Enzyme 5 Locus 2p11
Enzyme 5 SNPs SNPJam Report Link Image
Enzyme 5 General References
  1. [PubMed Link Image]
Enzyme 5 Metabolite References Not Available