We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Ammonia (BMDB00051)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-07-02 14:14:06
Accession Number BMDB00051
Common Name Ammonia
Description Ammonia is a colorless alkaline gas with a characteristic sharp smell. Ammonia is one of the most abundant nitrogen-containing compounds in the atmosphere. It is an irritant with a characteristic pungent odor, which is widely used in industry. Inasmuch as ammonia is highly soluble in water and, upon inhalation, is deposited in the upper airways, occupational exposures to ammonia have commonly been associated with sinusitis, upper airway irritation, and eye irritation. Acute exposures to high levels of ammonia have also been associated with diseases of the lower airways and interstitial lung. Ammonia has been shown to be a neurotoxin that predominantly affects astrocytes. Disturbed mitochondrial function and oxidative stress, factors implicated in the induction of the mitochondrial permeability transition, appear to be involved in the mechanism of ammonia neurotoxicity. Ammonia is formed in nearly all tissues and organs of the vertebrate organism; it is the most common endogenous neurotoxic compounds. Ammonia can affect the glutamatergic and GABAergic neuronal systems, the two prevailing neuronal systems of the cortical structures. Ammonia is well recognized to be central in the pathogenesis of hepatic encephalopathy and has been of importance to generations dating back to the early Egyptians. The gut produces ammonia which is metabolized in the liver and almost all organ systems are involved in ammonia metabolism. Colonic bacteria produce ammonia by splitting urea and other amino acids, however this does not explain hyperammonemia and hepatic encephalopathy. The alternative explanation is that hyperammonemia is the result of intestinal breakdown of amino acids, especially glutamine. The intestines have significant glutaminase activity, predominantly located in the enterocytes. On the other hand, this organ has only a little glutamine synthetase activity, making it a major glutamine-consuming organ. In addition to the intestine, the kidney is an important source of blood ammonia in patients with liver disease. Ammonia is also taken up by the muscle and brain in hepatic coma, and there is confirmation that ammonia is metabolized in muscle. The excessive formation of ammonia in the brains of Alzheimer's disease patients has been demonstrated, and it has been shown that some Alzheimer's disease patients exhibit elevated blood ammonia concentrations. Ammonia is the most important natural modulator of lysosomal protein processing: there is evidence for the involvement of aberrant lysosomal processing of beta-amyloid precursor protein (beta-APP) in the formation of amyloid deposits. Inflammatory processes and activation of microglia are widely believed to be implicated in the pathology of Alzheimer's disease. Ammonia is able to affect the characteristic functions of microglia, such as endocytosis, and cytokine production. Based on these facts, an ammonia-based hypothesis for Alzheimer's disease has been suggested. (PMID: 17006913, 16167195, 15377862, 15369278, 12020619)
Synonyms
  1. NH3
  2. NH{3)
  3. Ammoniaca [italian]
  4. Am-fol
  5. Tertiaeres amin
  6. Liquid ammonia
  7. Nitro-sil
  8. Amoniak [polish]
  9. Ammonia inhalant
  10. Ammoniak [german]
  11. Ammonia solution strong (NF)
  12. Ammonia gas
  13. Anhydrous ammonia
  14. Ammonia anhydrous
  15. Ammonia (conc 20% or greater)
  16. Aromatic ammonia vaporole
  17. Ammoniacum gummi
  18. Primaeres amin
  19. Ammonium ion
  20. Sekundaeres amin
  21. Ammoniak
  22. Ammoniakgas
  23. Ammonia solution
  24. Ammonia water
  25. Azane
  26. Ammonia solution strong [usan]
  27. Spirit of hartshorn
  28. Ammonia water (JP15)
  29. Ammoniac [french]
  30. Ammoniak kconzentrierter
  31. Ammonia
Chemical IUPAC Name ammonia
Chemical Formula NH3
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Inorganic
Super Class
  • Inorganic compounds
Class
  • Inorganic Ions and Gases
Sub Class
  • Gases
Family
  • Mammalian_Metabolite
Species
Biofunction
  • Component of Alanine and aspartate metabolism; Component of Aminosugars metabolism; Component of Arginine and proline metabolism; Component of beta-Alanine metabolism; Component of Cysteine metabolism; Component of D-Arginine and D-ornithine metabolism; Component of D-Glutamine and D-glutamate metabolism; Component of Glutamate metabolism; Component of Glycine, serine and threonine metabolism; Component of Histidine metabolism; Component of Methionine metabolism; Component of Nitrogen metabolism; Component of Peptidoglycan biosynthesis; Component of Phenylalanine metabolism; Component of Purine metabolism; Component of Pyrimidine metabolism; Component of Selenoamino acid metabolism; Component of Tryptophan metabolism; Component of Tyrosine metabolism; Component of Vitamin B6 metabolism
Application
Source
  • Endogenous
Average Molecular Weight 17.031
Monoisotopic Molecular Weight 17.026550
Isomeric SMILES N
Canonical SMILES N
KEGG Compound ID C00014 Link Image
BioCyc ID AMMONIA Link Image
BiGG ID Not Available
Wikipedia Link Ammonia Link Image
METLIN ID 3189 Link Image
PubChem Compound 222 Link Image
PubChem Substance 26715645 Link Image
ChEBI ID 16134 Link Image
CAS Registry Number 7664-41-7
InChI Identifier InChI=1/H3N/h1H3
Synthesis Reference Mohr, Rudolf. Ammonia separation from offgas obtained from melamine synthesis. U.S. (1971), 5 pp. CODEN: USXXAM US 3555784 19710119 CAN 77:50902 AN 1972:450902
Melting Point (Experimental) -77.7 oC
Experimental Water Solubility 482 mg/mL at 24 oC [DEAN,JA (1985)] Source: PhysProp
Predicted Water Solubility Not Available Calculated using ALOGPS
Physiological Charge 1
State Liquid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity 0.23 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID 1D2U Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Not Available
Not Available
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm
Biofluid Location Not Available
Tissue Location
Tissue References
All Tissues
Concentrations (Normal) Not Available
Concentrations (Abnormal) Not Available
Pathway Names
  • Arginine and Proline Metabolism
  • Glutamate Metabolism
  • Glycine, Serine and Threonine Metabolism
  • Nitrogen Metabolism
  • Purine Metabolism
  • Urea Cycle and Metabolism of Amino Groups
HMDB Pathways
Name Arginine and Proline Metabolism
Image Show Link Image
Name Glutamate Metabolism
Image Show Link Image
Name Glycine, Serine and Threonine Metabolism
Image Show Link Image
Name Nitrogen Metabolism
Image Show Link Image
Name Purine Metabolism
Image Show Link Image
Name Urea Cycle and Metabolism of Amino Groups
Image Show Link Image
KEGG Pathways
Name Arginine and Proline Metabolism
Image Show Link Image
Name Glutamate Metabolism
Image Show Link Image
Name Glycine, Serine and Threonine Metabolism
Image Show Link Image
Name Nitrogen Metabolism
Image Show Link Image
Name Purine Metabolism
Image Show Link Image
Name Urea Cycle and Metabolism of Amino Groups
Image Show Link Image
SimCell Pathways
Name Arginine and Proline Metabolism
Image Show Link Image
Graph
SBML
Name Glycine, Serine and Threonine Metabolism
Image Show Link Image
Graph Show Link Image
SBML Download (XML) Link Image
Name Nitrogen Metabolism
Image Show Link Image
Graph
SBML
Name Purine Metabolism
Image Show Link Image
Graph Show Link Image
SBML Download (XML) Link Image
Name Urea Cycle and Metabolism of Amino Groups
Image Show Link Image
Graph Show Link Image
SBML Download (XML) Link Image
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Ammonium transporter Rh type A
  2. Ammonium transporter Rh type B
  3. Ammonium transporter Rh type C
Enzyme 1 [top]
Enzyme 1 ID 2163
Enzyme 1 Name Ammonium transporter Rh type A
Enzyme 1 Synonyms
  1. Rhesus blood group family type A glycoprotein
  2. Rh family type A glycoprotein
  3. Rh type A glycoprotein
  4. Erythrocyte membrane glycoprotein Rh50
  5. CD241 antigen
Enzyme 1 Gene Name RHAG
Enzyme 1 Protein Sequence >Ammonium transporter Rh type A
MRFKFPLMAIGLEVVMIVLFALFVQYETSVNTSRNPNETESAAMDVEKTMESYPFFQDVH
IMVFAGFGFLMTFLWKYGFSGVGINLLIAALGLQWGTIIQGIFRSHGQKFLIEMKNMIHA
DFSTVTVLISFGAVLGKTSPVQMLIMTILEITVYAANEYLVFKILWASDTGESMTIHAFG
AYFGLAVAGILYRSGLKEKHSNEESVYHSDLFAMIGSLFLWIFWPSFNSATADEAKKQYR
AIVNTYFSLAASVVTAYACSSLLESRGKLNMVHIQNATLAGGVAVGTCADMEIPPYYAMI
IGSIAGAVSVFGFKFLTPLFTTKLRIHDTCGVHNLHGLPGVIGGLAGIITVALEESDSTK
TVSQAAALGSSIATALVGGLITGAILKIPFWAQPPDEDCYDDSVYWEVPERKEYDNHFHE
LLSTLH
Enzyme 1 Number of Residues 426
Enzyme 1 Molecular Weight 46718.7
Enzyme 1 Theoretical pI 5.70
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Inorganic ion transport and metabolism
Enzyme 1 Specific Function May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • 5-25 55-75 79-99 125-145 146-166 171-191 211-231 242-262 271-288 293-313 332-352 372-392
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 11610610 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q9GKN7 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name RHAG_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >1281 bp
ATGAGGTTCAAGTTCCCTCTCATGGCCATTGGCCTGGAAGTTGTCATGATTGTTTTATTT
GCATTATTTGTTCAGTATGAAACGAGTGTGAACACTTCCAGGAATCCCAACGAGACTGAG
TCAGCTGCCATGGACGTGGAGAAAACCATGGAATCGTATCCTTTCTTCCAAGATGTGCAC
ATTATGGTATTCGCTGGGTTCGGCTTCCTCATGACCTTCTTGTGGAAATATGGCTTCAGT
GGTGTGGGCATCAACCTACTTATAGCTGCTCTGGGACTCCAATGGGGCACTATTATACAG
GGGATCTTTCGTAGCCACGGACAGAAATTCCTAATAGAAATGAAAAACATGATACACGCA
GACTTCAGTACAGTCACAGTTCTGATTTCTTTTGGAGCTGTCCTGGGTAAAACAAGTCCA
GTCCAGATGCTGATCATGACAATTTTAGAAATTACTGTCTATGCTGCCAATGAATATCTG
GTTTTTAAGATATTATGGGCCTCTGATACTGGAGAATCGATGACCATCCATGCCTTTGGG
GCTTACTTTGGTTTGGCTGTAGCAGGCATCTTGTATCGATCAGGATTGAAAGAAAAACAT
TCCAATGAAGAGTCTGTATACCACTCGGACTTGTTTGCGATGATTGGGTCTCTTTTCTTA
TGGATATTTTGGCCTAGCTTTAATTCTGCCACTGCTGATGAAGCAAAGAAACAGTACAGG
GCCATCGTGAACACGTACTTCTCTCTTGCTGCCTCCGTGGTCACAGCCTACGCATGTTCC
AGCCTTCTCGAGAGCCGAGGCAAGCTCAATATGGTTCACATTCAGAATGCAACTCTGGCT
GGAGGAGTGGCTGTGGGCACTTGTGCGGACATGGAGATTCCCCCCTATTATGCTATGATC
ATTGGGAGCATTGCAGGAGCGGTCTCCGTGTTTGGGTTCAAGTTCCTGACTCCACTTTTC
ACTACTAAACTGAGGATCCATGACACCTGTGGAGTCCATAACCTACATGGCTTACCTGGT
GTGATAGGAGGCCTTGCTGGCATCATCACCGTAGCCTTGGAGGAATCTGACTCGACTAAG
ACGGTCAGTCAGGCAGCCGCGCTAGGTTCATCCATTGCAACAGCACTTGTTGGAGGGCTA
ATCACAGGTGCGATTTTAAAGATTCCTTTCTGGGCACAGCCACCTGATGAGGACTGCTAT
GATGATTCTGTTTATTGGGAGGTTCCTGAGAGGAAAGAATATGACAACCATTTCCATGAA
CTTCTCTCTACCCTCCATTAG
Enzyme 1 GenBank Gene ID AF164575 Link Image
Enzyme 1 GeneCard ID RHAG Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:6
Enzyme 1 Locus 6p21.1-p11
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available
Enzyme 2 [top]
Enzyme 2 ID 2164
Enzyme 2 Name Ammonium transporter Rh type B
Enzyme 2 Synonyms
  1. Rhesus blood group family type B glycoprotein
  2. Rh family type B glycoprotein
  3. Rh type B glycoprotein
Enzyme 2 Gene Name RHBG
Enzyme 2 Protein Sequence >Ammonium transporter Rh type B
MAWSPRHSAGRRLQLPLLCLLLQGATAILFAVFVRYNRETDAALWHWGNHSNADNEFYFR
YPSFQDVHAMIFVGFGFLMVFLQRYGFGSVGFTFLLAAFALQWSTLIQGFFHSFRGGYIL
VGMESMINADFCAGAVLISFGAVLGKTGPVQLLLMALLEVVLFGLNEFVLLSLLEVKDAG
GSMTIHTFGAYFGLILSRVLYRPQLEKSKHRQGSVYHSDLFAMIGTIFLWIFWPSFNSAP
TALGDGQHRTALNTYYSLTASTLSTFALSALVGGDGRLDMVHVQNAALAGGVVVGTSAEM
MLTPFGALAAGFLAGAISTLGYKFVTPILESKLKVQDTCGVHNLHGMPGVLGALLGGLVA
GLATREAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLTFASVGGGLGGLLLRLPIL
DSPPDSQCYEDQIYWEVPGEHEHLAQGSEETETQA
Enzyme 2 Number of Residues 455
Enzyme 2 Molecular Weight 49192.4
Enzyme 2 Theoretical pI 6.22
Enzyme 2 GO Classification
Function
Process
Component
Enzyme 2 General Function Inorganic ion transport and metabolism
Enzyme 2 Specific Function Functions as a specific ammonium transporter
Enzyme 2 Pathways Not Available
Enzyme 2 Reactions Not Available
Enzyme 2 Pfam Domain Function Not Available
Enzyme 2 Signals
  • None
Enzyme 2 Transmembrane Regions
  • 14-34 62-82 87-107 125-145 152-172 180-200 220-240 254-274 278-298 300-320 344-364 394-414
Enzyme 2 Essentiality Not Available
Enzyme 2 GenBank ID Protein 14486155 Link Image
Enzyme 2 UniProtKB/Swiss-Prot ID Q95M77 Link Image
Enzyme 2 UniProtKB/Swiss-Prot Entry Name RHBG_BOVIN Link Image
Enzyme 2 PDB ID Not Available
Enzyme 2 Cellular Location Not Available
Enzyme 2 Gene Sequence >1272 bp
ATGGCCTGGTCTCCCCGCCACTCCGCGGGCCGGCGACTGCAGCTGCCCCTGCTGTGCCTC
CTCCTCCAGGGCGCCACCGCCATCCTCTTTGCGGTCTTTGTCCGCTACAACCGTGAAACC
GACGCTGCCCTCTGGCACTGGGGCAACCACAGTAACGCGGACAATGAATTTTACTTTCGC
TACCCAAGCTTCCAGGATGTGCATGCCATGATCTTCGTGGGTTTCGGCTTCCTTATGGTC
TTCCTGCAGCGCTACGGCTTCGGCAGCGTGGGCTTCACCTTCCTCCTGGCCGCCTTTGCC
CTGCAGTGGTCCACGCTCATCCAGGGCTTCTTCCACTCCTTCCGTGGTGGCTACATCCTT
GTAGGCATGGAGAGCATGATCAATGCTGACTTCTGTGCTGGGGCTGTGCTTATCTCCTTT
GGGGCCGTACTGGGCAAGACTGGGCCGGTTCAGCTGCTGCTCATGGCCCTGCTGGAGGTG
GTGCTGTTTGGCCTCAACGAGTTTGTCCTGCTTAGCCTCCTGGAGGTGGTGCTGTTTGGC
CTCAACGAGTTTGTCCTGCTTAGCCTCCTGGAGGTGAAGGACGCAGGAGGCTCCATGACT
ATCCACACTTTTGGTGCTTACTTCGGGCTGATCCTCTCCCGGGTCCTCTATAGGCCCCAA
CTGGAGAAGCATCGCCAGGGCTCTGTCTACCATTCGGACCTCTTTGCCATGATTGGGACC
ATCTTCCTGTGGATCTTCTGGCCTAGTTTCAACTCTGCACCCACTGCCCTGGGGGACGGG
CAGCATCGGACCGCTCTCAACACATACTACTCCTTGACCGCCAGCACCCTCAGCACCTTC
GCCTTGTCAGCCCTTGTTGGGGGGGATGGGCGGCTGGACATGCCCATCCTTGAGTCCAAA
CTCAAAGTCCAAGACACATGTGGTGTGCACAACCTCCATGGGATGCCGGGGGTCCTGGGA
GCCCTCCTGGGTGGCCTTGTGGCTGGGCTGGCCACCCGTGAAGCTTATGGAGATGGCCTG
GAGAGTGTGTTTCCACTCATAGCCGAGGGCCAGCGCAGTGCCACGTCTCAGGCCATGCAC
CAGCTCTTCGGGCTGTTTGTCACACTGACATTTGCCTCTGTGGGTGGGGGCCTTGGAGGG
CTCCTGCTGAGGCTGCCCATCCTGGACTCCCCGCCAGACTCCCAGTGCTACGAGGACCAG
ATTTACTGGGAGGTGCCTGGAGAACATGAGCATTTAGCCCAGGGATCAGAGGAGACAGAG
ACTCAGGCCTAA
Enzyme 2 GenBank Gene ID AY013259 Link Image
Enzyme 2 GeneCard ID RHBG Link Image
Enzyme 2 GenAtlas ID Not Available
Enzyme 2 HGNC ID Not Available
Enzyme 2 Chromosome Location Chromosome:1
Enzyme 2 Locus 1q21.3
Enzyme 2 SNPs SNPJam Report Link Image
Enzyme 2 General References
  1. [PubMed Link Image]
Enzyme 2 Metabolite References Not Available
Enzyme 3 [top]
Enzyme 3 ID 2165
Enzyme 3 Name Ammonium transporter Rh type C
Enzyme 3 Synonyms
  1. Rhesus blood group family type C glycoprotein
  2. Rh family type C glycoprotein
  3. Rh type C glycoprotein
Enzyme 3 Gene Name RHCG
Enzyme 3 Protein Sequence >Ammonium transporter Rh type C
MIWNTNLRWRLPVACLLLEVALIALFGVFVRYDMDADPHWVQEKVIKNLSTDLENEFYYR
YPSFQDVHVMIFVGFGFLMTFLQRYGYSSVGFNFLLAAFGIQWALLMQGWLQSFDGRYIL
VDLENLINADFCVGSVCVAFGAVLGKVSPVQLLIMTLFQVTLFSINEYILLNLLEVKDSG
GSMTIHAFGAYFGLTVAWILYRPNLHLSKERQSSTYHSDLFAMIGTLFLWMYWPSFNSAI
SNHGDAQHRAAINTYCSLAACVLTSVALSSALHRKGKLDMVHIQNATLAGGVGLGTVAEL
MVLPFGSLIIGFVCGIVSTLGFVYLTPFLESRLHIQDTCGVHNLHGIPGIIGGIAGAVTA
SIANIDLYGEEGLAYAFGIERSKLNWSPNMQGRFQAAGLFVSLAMALVGGVIVGVILRLP
FWGQAPDENCFEDAVYWEIPKEPKSTALRSEDSSIKPPEP
Enzyme 3 Number of Residues 460
Enzyme 3 Molecular Weight 50833.6
Enzyme 3 Theoretical pI 5.91
Enzyme 3 GO Classification
Function
Process
Component
Enzyme 3 General Function Inorganic ion transport and metabolism
Enzyme 3 Specific Function Functions as an electroneutral and bidirectional ammonium transporter. May regulate transepithelial ammonia secretion
Enzyme 3 Pathways Not Available
Enzyme 3 Reactions Not Available
Enzyme 3 Pfam Domain Function
Enzyme 3 Signals
  • None
Enzyme 3 Transmembrane Regions
  • 10-30 62-82 90-110 126-145 152-174 180-200 220-240 252-272 286-303 307-329 347-367 397-417
Enzyme 3 Essentiality Not Available
Enzyme 3 GenBank ID Protein 14486157 Link Image
Enzyme 3 UniProtKB/Swiss-Prot ID Q2T9S6 Link Image
Enzyme 3 UniProtKB/Swiss-Prot Entry Name RHCG_BOVIN Link Image
Enzyme 3 PDB ID Not Available
Enzyme 3 Cellular Location Not Available
Enzyme 3 Gene Sequence >1380 bp
ATGATCTGGAACACCAATCTCCGCTGGCGGCTGCCGGTCGCCTGCCTGCTCCTGGAGGTG
GCCCTGATAGCCCTCTTCGGTGTGTTCGTGCGCTACGACATGGATGCCGATCCCCACTGG
GTGCAGGAGAAGGTGATCAAGAACTTGTCCACTGACTTGGAAAACGAATTCTACTATCGC
TACCCGAGCTTCCAGGACGTACACGTGATGATCTTCGTGGGCTTCGGGTTCCTCATGACC
TTCCTGCAGCGCTACGGCTACAGCTCTGTGGGCTTCAACTTTCTGGCGGCCTTCGGCATC
CAGTGGGCGCTGCTCATGCAGGGCTGGCTTCAATCTTTTGACGGACGCTACATTCTGGTG
GACCTAGAGAACCTCATCAATGCGGACTTCTGCGTGGGCTCTGTCTGTGTGGCCTTTGGG
GCAGTTCTGGGCAAAGTCAGCCCTGTCCAGCTCCTCATCATGACTCTCTTCCAAGTGACC
CTCTTCTCAATCAATGAATACATTCTCCTCAACCTGTTAGAGGTGAAGGATTCAGGGGGC
TCCATGACCATCCATGCATTCGGCGCCTACTTTGGGCTCACAGTGGCCTGGATCCTCTAC
CGCCCTAACCTACACCTCAGCAAGGAGAGGCAGAGTTCTACGTACCACTCGGACCTCTTT
GCCATGATCGGCACCCTCTTCCTGTGGATGTACTGGCCCAGCTTCAACTCGGCTATATCC
AATCACGGAGATGCTCAGCACCGAGCGGCCATCAACACCTACTGCTCCTTAGCAGCCTGC
GTGCTCACCTCAGTGGCGCTGTCCAGCGCCCTACATAGAAAGGGCAAGCTGGACATGGTG
CACATCCAGAATGCGACGCTCGCCGGAGGAGTGGGCCTGGGCACCGTTGCCGAGCTGATG
GTTCTTCCTTTCGGCTCCCTCATCATCGGCTTTGTCTGCGGCATCGTCTCCACCCTGGGT
TTTGTGTACCTGACGCCATTCCTGGAGTCCCGGTTGCACATCCAGGACACGTGTGGTGTT
CACAACCTGCACGGCATTCCTGGCATCATAGGCGGTATTGCGGGCGCAGTGACGGCAAGC
ATCGCCAACATTGATCTGTATGGGGAGGAAGGGCTTGCCTATGCCTTTGGCATTGAAAGA
TCCAAATTAAACTGGAGCCCAAACATGCAGGGCAGGTTCCAGGCTGCCGGGCTCTTTGTG
TCACTGGCCATGGCCCTGGTGGGCGGCGTCATCGTAGGGGTCATTCTGAGATTACCATTC
TGGGGACAAGCACCTGATGAGAACTGCTTTGAGGATGCAGTCTACTGGGAGATACCCAAG
GAGCCGAAAAGCACTGCCCTCCGTTCTGAGGACTCCAGCATCAAGCCCCCAGAACCTTAA
Enzyme 3 GenBank Gene ID AY013260 Link Image
Enzyme 3 GeneCard ID RHCG Link Image
Enzyme 3 GenAtlas ID Not Available
Enzyme 3 HGNC ID Not Available
Enzyme 3 Chromosome Location Chromosome:1
Enzyme 3 Locus 15q25
Enzyme 3 SNPs SNPJam Report Link Image
Enzyme 3 General References
  1. [PubMed Link Image]
Enzyme 3 Metabolite References Not Available