We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Bovine Metabolome Database



Showing metabocard for Dihydrobiopterin (BMDB00038)

Legend: metabolite field enzyme field

Version 1.0
Creation Date 2005-11-16 15:48:42
Update Date 2009-05-05 20:57:38
Accession Number BMDB00038
Common Name Dihydrobiopterin
Description Dihydrobiopterin (BH2) is an oxidation product of tetrahydrobiopterin. Tetrahydrobiopterin is a natural occurring cofactor of the aromatic amino acid hydroxylase and is involved in the synthesis of tyrosine and the neurotransmitters dopamine and serotonin. Tetrahydrobiopterin is also essential for nitric oxide synthase catalyzed oxidation of L-arginine to L-citrulline and nitric oxide.
Synonyms
  1. (S-(R*,S*))-2-amino-6-(1,2-dihydroxypropyl)-7,8-dihydro-4(1H)-Pteridinone
  2. 2-amino-6-((1R,2S)-1,2-dihydroxypropyl)-7,8-dihydro-4(1H)-Pteridinone
  3. 2-amino-6-(1,2-dihydroxypropyl)-7,8-dihydro-4(1H)-Pteridinone
  4. 7,8-Dihydro-L-biopterin
  5. 7,8-Dihydrobiopterin
  6. Dihydrobiopterin
  7. L-erythro-1-(2-amino-7,8-dihydro-4-hydroxy-6-pteridinyl)-1,2-Propanediol
  8. L-erythro-7,8-Dihydrobiopterin
  9. L-erythro-Dihydrobiopterin
  10. L-erythro-q-Dihydrobiopterin
  11. Quinonoid dihydrobiopterin
  12. BH2
  13. 6,7-Dihydrobiopterin
  14. Quinoid-dihydrobiopterin
  15. (6R)-6-(L-erythro-1,2-Dihydroxypropyl)-7,8-dihydro-6H-pterin
Chemical IUPAC Name 2-amino-6-(1,2-dihydroxypropyl)-7,8-dihydro-1H-pteridin-4-one
Chemical Formula C9H13N5O3
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Heterocyclic molecules
Class
  • Pterins
Sub Class
  • Dihydro-pterins
Family
  • Mammalian_Metabolite
Species
  • imine; secondary alcohol; 1,2-diol; primary amine; primary aromatic amine; secondary amine; secondary aliphatic/aromatic amine (alkylarylamine); oxo(het)arene; aromatic compound; heterocyclic compound
Biofunction
  • Component of Folate biosynthesis
Application
Source
  • Endogenous
Average Molecular Weight 239.231
Monoisotopic Molecular Weight 239.101837
Isomeric SMILES CC(O)C(O)C1=NC2=C(NC1)N=C(N)NC2=O
Canonical SMILES CC(O)C(O)C1=NC2=C(NC1)N=C(N)NC2=O
KEGG Compound ID C02953 Link Image
BioCyc ID BIOPTERIN Link Image
BiGG ID Not Available
Wikipedia Link Dihydrobiopterin Link Image
METLIN ID 5106 Link Image
PubChem Compound 252 Link Image
PubChem Substance 2171 Link Image
ChEBI ID 15375 Link Image
CAS Registry Number 6779-87-9
InChI Identifier InChI=1/C9H13N5O3/c1-3(15)6(16)4-2-11-7-5(12-4)8(17)14-9(10)13-7/h3,6,15-16H,2H2,1H3,(H4,10,11,13,14,17)
Synthesis Reference Gal E M. Synthesis and quantitative aspects of dihydrobiopterin control of cerebral serotonin levels. Advances in experimental medicine and biology (1981), 133 197-206.
Melting Point (Experimental) Not Available
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 1.63 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge 0
State Solid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity -1.65 [Predicted by ALOGPS]; -2.2 [Predicted by PubChem via XLOGP] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID 1DCP Link Image
Experimental PDB File Show
Experimental PDB Structure
Experimental 1H NMR Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Download Spectrum
Download FID (Bruker)
Show Experimental Conditions Link Image
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum
Low Energy
Download File
Show Experimental Conditions Link Image
Medium Energy
Download File
Show Experimental Conditions Link Image
High Energy
Download File
Show Experimental Conditions Link Image
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Cytoplasm
Biofluid Location Not Available
Tissue Location Not Available
Concentrations (Normal) Not Available
Concentrations (Abnormal) Not Available
Pathway Names
  • Folate and Pterine Biosynthesis
HMDB Pathways
Name Folate and Pterine Biosynthesis
Image Show Link Image
KEGG Pathways
Name Folate and Pterine Biosynthesis
Image Show Link Image
SimCell Pathways
Name Folate and Pterine Biosynthesis
Image Show Link Image
Graph
SBML
General References
  1. Wikipedia Link Image
Metabolic Enzymes
  1. Sepiapterin reductase
Enzyme 1 [top]
Enzyme 1 ID 379
Enzyme 1 Name Sepiapterin reductase
Enzyme 1 Synonyms
  1. SPR
Enzyme 1 Gene Name SPR
Enzyme 1 Protein Sequence >Sepiapterin reductase
MEGSVGKVGGLGRTLCVLTGASRGFGRTLAQVLAPLMSPRSVLVLSARNDEALRQLETEL
GAEWPGLRIVRVPADLGAETGLQQLVGALCDLPRPEGLQRVLLINNAGTLGDVSKRWVDL
TDPTEVNNYWTLNLTSTLCLTSSILQAFPDSPGLSRTVVNISSICALQPFKGWGLYCAGK
AARNMMFQVLAAEEPSVRVLSYGPGPLDTDMQQLARETSVDPDLRKSLQELKRKGELVDC
KISAQKLLSLLQNDKFESGAHIDFYDE
Enzyme 1 Number of Residues 267
Enzyme 1 Molecular Weight 28938.9
Enzyme 1 Theoretical pI 5.15
Enzyme 1 GO Classification
Function
Process
Component
Enzyme 1 General Function Lipid transport and metabolism
Enzyme 1 Specific Function Catalyzes the final one or two reductions in tetra- hydrobiopterin biosynthesis to form 5,6,7,8-tetrahydrobiopterin
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals
  • None
Enzyme 1 Transmembrane Regions
  • None
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein 114797046 Link Image
Enzyme 1 UniProtKB/Swiss-Prot ID Q17QK8 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name SPRE_BOVIN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence >804 bp
ATGGAGGGCAGCGTCGGCAAGGTGGGCGGCCTGGGGCGCACCTTATGCGTGCTGACTGGG
GCTTCCCGGGGCTTCGGACGGACGCTGGCCCAAGTCCTGGCCCCGCTGATGTCGCCTCGC
TCCGTGCTGGTCCTAAGCGCCCGCAATGACGAGGCCCTGCGGCAGCTGGAGACCGAGCTG
GGCGCCGAGTGGCCGGGTCTGCGTATCGTGCGGGTGCCCGCCGACCTGGGCGCCGAGACC
GGCTTGCAGCAACTGGTCGGTGCTCTGTGCGACCTCCCCAGGCCCGAGGGCCTGCAGCGA
GTGCTGCTCATCAACAATGCGGGCACTCTTGGAGATGTATCCAAACGTTGGGTGGACCTG
ACTGACCCAACTGAAGTGAACAACTACTGGACTCTGAACTTGACTTCCACGCTCTGCCTG
ACTTCCAGTATCCTGCAGGCCTTCCCGGACAGTCCTGGCCTCAGCAGGACTGTGGTTAAC
ATCTCGTCCATCTGTGCCCTGCAGCCCTTCAAGGGCTGGGGACTGTACTGTGCTGGGAAG
GCTGCCCGTAACATGATGTTCCAGGTCCTGGCGGCGGAGGAACCTAGCGTGAGGGTGCTG
AGCTATGGCCCAGGTCCCCTGGACACTGACATGCAGCAGTTAGCCCGGGAGACCTCTGTG
GACCCAGACTTGCGAAAAAGCCTGCAGGAGCTGAAGAGAAAGGGGCAACTTGTGGATTGC
AAGATATCAGCCCAGAAACTTCTGAGCTTGCTGCAAAATGACAAGTTCGAGTCTGGAGCC
CATATTGACTTCTACGATGAATAA
Enzyme 1 GenBank Gene ID DQ978331 Link Image
Enzyme 1 GeneCard ID SPR Link Image
Enzyme 1 GenAtlas ID Not Available
Enzyme 1 HGNC ID Not Available
Enzyme 1 Chromosome Location Chromosome:2
Enzyme 1 Locus 2p14-p12
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available